data_4XDE # _entry.id 4XDE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4XDE WWPDB D_1000205476 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4XDE _pdbx_database_status.recvd_initial_deposition_date 2014-12-19 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pathak, M.' 1 'Wilmann, P.' 2 'Awford, J.' 3 'Li, C.' 4 'Fisher, P.M.' 5 'Dreveny, I.' 6 'Dekker, L.V.' 7 'Emsley, J.' 8 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Thromb.Haemost. _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1538-7836 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 13 _citation.language ? _citation.page_first 580 _citation.page_last 591 _citation.title 'Coagulation factor XII protease domain crystal structure.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/jth.12849 _citation.pdbx_database_id_PubMed 25604127 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Pathak, M.' 1 primary 'Wilmann, P.' 2 primary 'Awford, J.' 3 primary 'Li, C.' 4 primary 'Hamad, B.K.' 5 primary 'Fischer, P.M.' 6 primary 'Dreveny, I.' 7 primary 'Dekker, L.V.' 8 primary 'Emsley, J.' 9 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4XDE _cell.details ? _cell.formula_units_Z ? _cell.length_a 124.126 _cell.length_a_esd ? _cell.length_b 124.126 _cell.length_b_esd ? _cell.length_c 38.145 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4XDE _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Coagulation factor XII' 27877.229 1 3.4.21.38 C467S 'protease domain, UNP residues 373-615' ? 2 non-polymer syn 'ISOPROPYL ALCOHOL' 60.095 2 ? ? ? ? 3 non-polymer syn 'CITRATE ANION' 189.100 1 ? ? ? ? 4 water nat water 18.015 97 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Hageman factor,HAF' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;RSVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLH EAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVSLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLE RCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIR EHTVSHHTGTRHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;RSVVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLH EAFSPVSYQHDLALLRLQEDADGSCALLSPYVQPVSLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLE RCSAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIR EHTVSHHTGTRHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 SER n 1 3 VAL n 1 4 VAL n 1 5 GLY n 1 6 GLY n 1 7 LEU n 1 8 VAL n 1 9 ALA n 1 10 LEU n 1 11 ARG n 1 12 GLY n 1 13 ALA n 1 14 HIS n 1 15 PRO n 1 16 TYR n 1 17 ILE n 1 18 ALA n 1 19 ALA n 1 20 LEU n 1 21 TYR n 1 22 TRP n 1 23 GLY n 1 24 HIS n 1 25 SER n 1 26 PHE n 1 27 CYS n 1 28 ALA n 1 29 GLY n 1 30 SER n 1 31 LEU n 1 32 ILE n 1 33 ALA n 1 34 PRO n 1 35 CYS n 1 36 TRP n 1 37 VAL n 1 38 LEU n 1 39 THR n 1 40 ALA n 1 41 ALA n 1 42 HIS n 1 43 CYS n 1 44 LEU n 1 45 GLN n 1 46 ASP n 1 47 ARG n 1 48 PRO n 1 49 ALA n 1 50 PRO n 1 51 GLU n 1 52 ASP n 1 53 LEU n 1 54 THR n 1 55 VAL n 1 56 VAL n 1 57 LEU n 1 58 GLY n 1 59 GLN n 1 60 GLU n 1 61 ARG n 1 62 ARG n 1 63 ASN n 1 64 HIS n 1 65 SER n 1 66 CYS n 1 67 GLU n 1 68 PRO n 1 69 CYS n 1 70 GLN n 1 71 THR n 1 72 LEU n 1 73 ALA n 1 74 VAL n 1 75 ARG n 1 76 SER n 1 77 TYR n 1 78 ARG n 1 79 LEU n 1 80 HIS n 1 81 GLU n 1 82 ALA n 1 83 PHE n 1 84 SER n 1 85 PRO n 1 86 VAL n 1 87 SER n 1 88 TYR n 1 89 GLN n 1 90 HIS n 1 91 ASP n 1 92 LEU n 1 93 ALA n 1 94 LEU n 1 95 LEU n 1 96 ARG n 1 97 LEU n 1 98 GLN n 1 99 GLU n 1 100 ASP n 1 101 ALA n 1 102 ASP n 1 103 GLY n 1 104 SER n 1 105 CYS n 1 106 ALA n 1 107 LEU n 1 108 LEU n 1 109 SER n 1 110 PRO n 1 111 TYR n 1 112 VAL n 1 113 GLN n 1 114 PRO n 1 115 VAL n 1 116 SER n 1 117 LEU n 1 118 PRO n 1 119 SER n 1 120 GLY n 1 121 ALA n 1 122 ALA n 1 123 ARG n 1 124 PRO n 1 125 SER n 1 126 GLU n 1 127 THR n 1 128 THR n 1 129 LEU n 1 130 CYS n 1 131 GLN n 1 132 VAL n 1 133 ALA n 1 134 GLY n 1 135 TRP n 1 136 GLY n 1 137 HIS n 1 138 GLN n 1 139 PHE n 1 140 GLU n 1 141 GLY n 1 142 ALA n 1 143 GLU n 1 144 GLU n 1 145 TYR n 1 146 ALA n 1 147 SER n 1 148 PHE n 1 149 LEU n 1 150 GLN n 1 151 GLU n 1 152 ALA n 1 153 GLN n 1 154 VAL n 1 155 PRO n 1 156 PHE n 1 157 LEU n 1 158 SER n 1 159 LEU n 1 160 GLU n 1 161 ARG n 1 162 CYS n 1 163 SER n 1 164 ALA n 1 165 PRO n 1 166 ASP n 1 167 VAL n 1 168 HIS n 1 169 GLY n 1 170 SER n 1 171 SER n 1 172 ILE n 1 173 LEU n 1 174 PRO n 1 175 GLY n 1 176 MET n 1 177 LEU n 1 178 CYS n 1 179 ALA n 1 180 GLY n 1 181 PHE n 1 182 LEU n 1 183 GLU n 1 184 GLY n 1 185 GLY n 1 186 THR n 1 187 ASP n 1 188 ALA n 1 189 CYS n 1 190 GLN n 1 191 GLY n 1 192 ASP n 1 193 SER n 1 194 GLY n 1 195 GLY n 1 196 PRO n 1 197 LEU n 1 198 VAL n 1 199 CYS n 1 200 GLU n 1 201 ASP n 1 202 GLN n 1 203 ALA n 1 204 ALA n 1 205 GLU n 1 206 ARG n 1 207 ARG n 1 208 LEU n 1 209 THR n 1 210 LEU n 1 211 GLN n 1 212 GLY n 1 213 ILE n 1 214 ILE n 1 215 SER n 1 216 TRP n 1 217 GLY n 1 218 SER n 1 219 GLY n 1 220 CYS n 1 221 GLY n 1 222 ASP n 1 223 ARG n 1 224 ASN n 1 225 LYS n 1 226 PRO n 1 227 GLY n 1 228 VAL n 1 229 TYR n 1 230 THR n 1 231 ASP n 1 232 VAL n 1 233 ALA n 1 234 TYR n 1 235 TYR n 1 236 LEU n 1 237 ALA n 1 238 TRP n 1 239 ILE n 1 240 ARG n 1 241 GLU n 1 242 HIS n 1 243 THR n 1 244 VAL n 1 245 SER n 1 246 HIS n 1 247 HIS n 1 248 THR n 1 249 GLY n 1 250 THR n 1 251 ARG n 1 252 HIS n 1 253 HIS n 1 254 HIS n 1 255 HIS n 1 256 HIS n 1 257 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 257 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene F12 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'Fruit fly' _entity_src_gen.pdbx_host_org_scientific_name 'Drosophila melanogaster' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7227 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line 'Schneider 2 (S2)' _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMT-PURO _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FA12_HUMAN _struct_ref.pdbx_db_accession P00748 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VVGGLVALRGAHPYIAALYWGHSFCAGSLIAPCWVLTAAHCLQDRPAPEDLTVVLGQERRNHSCEPCQTLAVRSYRLHEA FSPVSYQHDLALLRLQEDADGSCALLSPYVQPVCLPSGAARPSETTLCQVAGWGHQFEGAEEYASFLQEAQVPFLSLERC SAPDVHGSSILPGMLCAGFLEGGTDACQGDSGGPLVCEDQAAERRLTLQGIISWGSGCGDRNKPGVYTDVAYYLAWIREH TVS ; _struct_ref.pdbx_align_begin 373 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4XDE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 245 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P00748 _struct_ref_seq.db_align_beg 373 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 615 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 354 _struct_ref_seq.pdbx_auth_seq_align_end 596 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4XDE ARG A 1 ? UNP P00748 ? ? 'expression tag' 352 1 1 4XDE SER A 2 ? UNP P00748 ? ? 'expression tag' 353 2 1 4XDE SER A 116 ? UNP P00748 CYS 486 'engineered mutation' 467 3 1 4XDE HIS A 246 ? UNP P00748 ? ? 'expression tag' 597 4 1 4XDE HIS A 247 ? UNP P00748 ? ? 'expression tag' 598 5 1 4XDE THR A 248 ? UNP P00748 ? ? 'expression tag' 599 6 1 4XDE GLY A 249 ? UNP P00748 ? ? 'expression tag' 600 7 1 4XDE THR A 250 ? UNP P00748 ? ? 'expression tag' 601 8 1 4XDE ARG A 251 ? UNP P00748 ? ? 'expression tag' 602 9 1 4XDE HIS A 252 ? UNP P00748 ? ? 'expression tag' 603 10 1 4XDE HIS A 253 ? UNP P00748 ? ? 'expression tag' 604 11 1 4XDE HIS A 254 ? UNP P00748 ? ? 'expression tag' 605 12 1 4XDE HIS A 255 ? UNP P00748 ? ? 'expression tag' 606 13 1 4XDE HIS A 256 ? UNP P00748 ? ? 'expression tag' 607 14 1 4XDE HIS A 257 ? UNP P00748 ? ? 'expression tag' 608 15 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FLC non-polymer . 'CITRATE ANION' ? 'C6 H5 O7 -3' 189.100 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IPA non-polymer . 'ISOPROPYL ALCOHOL' 2-PROPANOL 'C3 H8 O' 60.095 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4XDE _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.64 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 53.33 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.2 M Ammonium sulphate, 0.05 M tri-sodium citrate, 3%(w/v) isopropanol.' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-05-08 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9763 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I02' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9763 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I02 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4XDE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.14 _reflns.d_resolution_low 30.1 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16670 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.9 _reflns.pdbx_Rmerge_I_obs 0.085 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.14 _reflns_shell.d_res_low 2.199 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 0.89 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.89 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -1.78 _refine.B_iso_max ? _refine.B_iso_mean 29.211 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.918 _refine.correlation_coeff_Fo_to_Fc_free 0.883 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4XDE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.14 _refine.ls_d_res_low 30.1 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15301 _refine.ls_number_reflns_R_free 814 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.02 _refine.ls_percent_reflns_R_free 5.1 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.22418 _refine.ls_R_factor_R_free 0.26235 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.22223 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model '1YBW with 44% identity' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.251 _refine.pdbx_overall_ESU_R_Free 0.208 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1829 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.number_atoms_solvent 97 _refine_hist.number_atoms_total 1947 _refine_hist.d_res_high 2.14 _refine_hist.d_res_low 30.1 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 0.019 1903 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.000 0.020 1729 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.855 1.956 2600 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 3.851 3.006 3962 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.497 5.000 240 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 35.225 23.294 85 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.534 15.000 269 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 19.758 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.146 0.200 280 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.021 2194 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.009 0.020 445 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.144 _refine_ls_shell.d_res_low 2.199 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 53 _refine_ls_shell.number_reflns_R_work 953 _refine_ls_shell.percent_reflns_obs 82.93 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.278 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.278 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 4XDE _struct.title 'Coagulation Factor XII protease domain crystal structure' _struct.pdbx_descriptor 'Blood coagulation factor XII (FXII) protease domain (E.C.3.4.21.38)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4XDE _struct_keywords.text 'Factor XII, catalytic domain, Zymogens, hydrolase, blood clotting' _struct_keywords.pdbx_keywords 'BLOOD CLOTTING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ALA A 40 ? GLN A 45 ? ALA A 391 GLN A 396 5 ? 6 HELX_P HELX_P2 AA2 ALA A 49 ? ASP A 52 ? ALA A 400 ASP A 403 5 ? 4 HELX_P HELX_P3 AA3 ALA A 142 ? ALA A 146 ? ALA A 493 ALA A 497 5 ? 5 HELX_P HELX_P4 AA4 SER A 158 ? SER A 163 ? SER A 509 SER A 514 1 ? 6 HELX_P HELX_P5 AA5 HIS A 168 ? ILE A 172 ? HIS A 519 ILE A 523 5 ? 5 HELX_P HELX_P6 AA6 TYR A 235 ? HIS A 242 ? TYR A 586 HIS A 593 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 43 SG ? ? A CYS 378 A CYS 394 1_555 ? ? ? ? ? ? ? 2.095 ? disulf2 disulf ? ? A CYS 35 SG ? ? ? 1_555 A CYS 105 SG ? ? A CYS 386 A CYS 456 1_555 ? ? ? ? ? ? ? 2.101 ? disulf3 disulf ? ? A CYS 66 SG ? ? ? 1_555 A CYS 69 SG ? ? A CYS 417 A CYS 420 1_555 ? ? ? ? ? ? ? 2.097 ? disulf4 disulf ? ? A CYS 130 SG ? ? ? 1_555 A CYS 199 SG ? ? A CYS 481 A CYS 550 1_555 ? ? ? ? ? ? ? 2.038 ? disulf5 disulf ? ? A CYS 162 SG ? ? ? 1_555 A CYS 178 SG ? ? A CYS 513 A CYS 529 1_555 ? ? ? ? ? ? ? 2.029 ? disulf6 disulf ? ? A CYS 189 SG ? ? ? 1_555 A CYS 220 SG ? ? A CYS 540 A CYS 571 1_555 ? ? ? ? ? ? ? 2.058 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 17 ? TRP A 22 ? ILE A 368 TRP A 373 AA1 2 SER A 25 ? ALA A 33 ? SER A 376 ALA A 384 AA1 3 TRP A 36 ? THR A 39 ? TRP A 387 THR A 390 AA1 4 ALA A 93 ? LEU A 97 ? ALA A 444 LEU A 448 AA1 5 GLN A 70 ? LEU A 79 ? GLN A 421 LEU A 430 AA1 6 THR A 54 ? LEU A 57 ? THR A 405 LEU A 408 AA1 7 ILE A 17 ? TRP A 22 ? ILE A 368 TRP A 373 AA2 1 LEU A 129 ? GLY A 134 ? LEU A 480 GLY A 485 AA2 2 GLN A 150 ? LEU A 157 ? GLN A 501 LEU A 508 AA2 3 MET A 176 ? ALA A 179 ? MET A 527 ALA A 530 AA2 4 GLY A 227 ? ASP A 231 ? GLY A 578 ASP A 582 AA2 5 LEU A 208 ? TRP A 216 ? LEU A 559 TRP A 567 AA2 6 PRO A 196 ? GLU A 200 ? PRO A 547 GLU A 551 AA2 7 LEU A 129 ? GLY A 134 ? LEU A 480 GLY A 485 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 20 ? N LEU A 371 O CYS A 27 ? O CYS A 378 AA1 2 3 N SER A 30 ? N SER A 381 O LEU A 38 ? O LEU A 389 AA1 3 4 N VAL A 37 ? N VAL A 388 O LEU A 95 ? O LEU A 446 AA1 4 5 O ARG A 96 ? O ARG A 447 N SER A 76 ? N SER A 427 AA1 5 6 O LEU A 72 ? O LEU A 423 N VAL A 55 ? N VAL A 406 AA1 6 7 O VAL A 56 ? O VAL A 407 N ALA A 19 ? N ALA A 370 AA2 1 2 N GLY A 134 ? N GLY A 485 O GLN A 150 ? O GLN A 501 AA2 2 3 N LEU A 157 ? N LEU A 508 O CYS A 178 ? O CYS A 529 AA2 3 4 N LEU A 177 ? N LEU A 528 O TYR A 229 ? O TYR A 580 AA2 4 5 O VAL A 228 ? O VAL A 579 N TRP A 216 ? N TRP A 567 AA2 5 6 O THR A 209 ? O THR A 560 N CYS A 199 ? N CYS A 550 AA2 6 7 O VAL A 198 ? O VAL A 549 N GLN A 131 ? N GLN A 482 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A IPA 701 ? 2 'binding site for residue IPA A 701' AC2 Software A IPA 702 ? 7 'binding site for residue IPA A 702' AC3 Software A FLC 703 ? 6 'binding site for residue FLC A 703' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 LEU A 20 ? LEU A 371 . ? 1_555 ? 2 AC1 2 CYS A 43 ? CYS A 394 . ? 1_555 ? 3 AC2 7 TRP A 22 ? TRP A 373 . ? 1_555 ? 4 AC2 7 SER A 25 ? SER A 376 . ? 1_555 ? 5 AC2 7 ASP A 46 ? ASP A 397 . ? 1_555 ? 6 AC2 7 LEU A 173 ? LEU A 524 . ? 3_445 ? 7 AC2 7 PRO A 174 ? PRO A 525 . ? 3_445 ? 8 AC2 7 HOH E . ? HOH A 810 . ? 1_555 ? 9 AC2 7 HOH E . ? HOH A 853 . ? 1_555 ? 10 AC3 6 VAL A 86 ? VAL A 437 . ? 1_555 ? 11 AC3 6 SER A 87 ? SER A 438 . ? 1_555 ? 12 AC3 6 TYR A 88 ? TYR A 439 . ? 1_555 ? 13 AC3 6 SER A 171 ? SER A 522 . ? 1_555 ? 14 AC3 6 TRP A 216 ? TRP A 567 . ? 1_555 ? 15 AC3 6 HOH E . ? HOH A 861 . ? 1_555 ? # _atom_sites.entry_id 4XDE _atom_sites.fract_transf_matrix[1][1] 0.008056 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008056 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.026216 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 352 ? ? ? A . n A 1 2 SER 2 353 ? ? ? A . n A 1 3 VAL 3 354 ? ? ? A . n A 1 4 VAL 4 355 ? ? ? A . n A 1 5 GLY 5 356 ? ? ? A . n A 1 6 GLY 6 357 ? ? ? A . n A 1 7 LEU 7 358 ? ? ? A . n A 1 8 VAL 8 359 359 VAL VAL A . n A 1 9 ALA 9 360 360 ALA ALA A . n A 1 10 LEU 10 361 361 LEU LEU A . n A 1 11 ARG 11 362 362 ARG ARG A . n A 1 12 GLY 12 363 363 GLY GLY A . n A 1 13 ALA 13 364 364 ALA ALA A . n A 1 14 HIS 14 365 365 HIS HIS A . n A 1 15 PRO 15 366 366 PRO PRO A . n A 1 16 TYR 16 367 367 TYR TYR A . n A 1 17 ILE 17 368 368 ILE ILE A . n A 1 18 ALA 18 369 369 ALA ALA A . n A 1 19 ALA 19 370 370 ALA ALA A . n A 1 20 LEU 20 371 371 LEU LEU A . n A 1 21 TYR 21 372 372 TYR TYR A . n A 1 22 TRP 22 373 373 TRP TRP A . n A 1 23 GLY 23 374 374 GLY GLY A . n A 1 24 HIS 24 375 375 HIS HIS A . n A 1 25 SER 25 376 376 SER SER A . n A 1 26 PHE 26 377 377 PHE PHE A . n A 1 27 CYS 27 378 378 CYS CYS A . n A 1 28 ALA 28 379 379 ALA ALA A . n A 1 29 GLY 29 380 380 GLY GLY A . n A 1 30 SER 30 381 381 SER SER A . n A 1 31 LEU 31 382 382 LEU LEU A . n A 1 32 ILE 32 383 383 ILE ILE A . n A 1 33 ALA 33 384 384 ALA ALA A . n A 1 34 PRO 34 385 385 PRO PRO A . n A 1 35 CYS 35 386 386 CYS CYS A . n A 1 36 TRP 36 387 387 TRP TRP A . n A 1 37 VAL 37 388 388 VAL VAL A . n A 1 38 LEU 38 389 389 LEU LEU A . n A 1 39 THR 39 390 390 THR THR A . n A 1 40 ALA 40 391 391 ALA ALA A . n A 1 41 ALA 41 392 392 ALA ALA A . n A 1 42 HIS 42 393 393 HIS HIS A . n A 1 43 CYS 43 394 394 CYS CYS A . n A 1 44 LEU 44 395 395 LEU LEU A . n A 1 45 GLN 45 396 396 GLN GLN A . n A 1 46 ASP 46 397 397 ASP ASP A . n A 1 47 ARG 47 398 398 ARG ARG A . n A 1 48 PRO 48 399 399 PRO PRO A . n A 1 49 ALA 49 400 400 ALA ALA A . n A 1 50 PRO 50 401 401 PRO PRO A . n A 1 51 GLU 51 402 402 GLU GLU A . n A 1 52 ASP 52 403 403 ASP ASP A . n A 1 53 LEU 53 404 404 LEU LEU A . n A 1 54 THR 54 405 405 THR THR A . n A 1 55 VAL 55 406 406 VAL VAL A . n A 1 56 VAL 56 407 407 VAL VAL A . n A 1 57 LEU 57 408 408 LEU LEU A . n A 1 58 GLY 58 409 409 GLY GLY A . n A 1 59 GLN 59 410 410 GLN GLN A . n A 1 60 GLU 60 411 411 GLU GLU A . n A 1 61 ARG 61 412 412 ARG ARG A . n A 1 62 ARG 62 413 413 ARG ARG A . n A 1 63 ASN 63 414 414 ASN ASN A . n A 1 64 HIS 64 415 415 HIS HIS A . n A 1 65 SER 65 416 416 SER SER A . n A 1 66 CYS 66 417 417 CYS CYS A . n A 1 67 GLU 67 418 418 GLU GLU A . n A 1 68 PRO 68 419 419 PRO PRO A . n A 1 69 CYS 69 420 420 CYS CYS A . n A 1 70 GLN 70 421 421 GLN GLN A . n A 1 71 THR 71 422 422 THR THR A . n A 1 72 LEU 72 423 423 LEU LEU A . n A 1 73 ALA 73 424 424 ALA ALA A . n A 1 74 VAL 74 425 425 VAL VAL A . n A 1 75 ARG 75 426 426 ARG ARG A . n A 1 76 SER 76 427 427 SER SER A . n A 1 77 TYR 77 428 428 TYR TYR A . n A 1 78 ARG 78 429 429 ARG ARG A . n A 1 79 LEU 79 430 430 LEU LEU A . n A 1 80 HIS 80 431 431 HIS HIS A . n A 1 81 GLU 81 432 432 GLU GLU A . n A 1 82 ALA 82 433 433 ALA ALA A . n A 1 83 PHE 83 434 434 PHE PHE A . n A 1 84 SER 84 435 435 SER SER A . n A 1 85 PRO 85 436 436 PRO PRO A . n A 1 86 VAL 86 437 437 VAL VAL A . n A 1 87 SER 87 438 438 SER SER A . n A 1 88 TYR 88 439 439 TYR TYR A . n A 1 89 GLN 89 440 440 GLN GLN A . n A 1 90 HIS 90 441 441 HIS HIS A . n A 1 91 ASP 91 442 442 ASP ASP A . n A 1 92 LEU 92 443 443 LEU LEU A . n A 1 93 ALA 93 444 444 ALA ALA A . n A 1 94 LEU 94 445 445 LEU LEU A . n A 1 95 LEU 95 446 446 LEU LEU A . n A 1 96 ARG 96 447 447 ARG ARG A . n A 1 97 LEU 97 448 448 LEU LEU A . n A 1 98 GLN 98 449 449 GLN GLN A . n A 1 99 GLU 99 450 450 GLU GLU A . n A 1 100 ASP 100 451 451 ASP ASP A . n A 1 101 ALA 101 452 452 ALA ALA A . n A 1 102 ASP 102 453 453 ASP ASP A . n A 1 103 GLY 103 454 454 GLY GLY A . n A 1 104 SER 104 455 455 SER SER A . n A 1 105 CYS 105 456 456 CYS CYS A . n A 1 106 ALA 106 457 457 ALA ALA A . n A 1 107 LEU 107 458 458 LEU LEU A . n A 1 108 LEU 108 459 459 LEU LEU A . n A 1 109 SER 109 460 460 SER SER A . n A 1 110 PRO 110 461 461 PRO PRO A . n A 1 111 TYR 111 462 462 TYR TYR A . n A 1 112 VAL 112 463 463 VAL VAL A . n A 1 113 GLN 113 464 464 GLN GLN A . n A 1 114 PRO 114 465 465 PRO PRO A . n A 1 115 VAL 115 466 466 VAL VAL A . n A 1 116 SER 116 467 467 SER SER A . n A 1 117 LEU 117 468 468 LEU LEU A . n A 1 118 PRO 118 469 469 PRO PRO A . n A 1 119 SER 119 470 470 SER SER A . n A 1 120 GLY 120 471 471 GLY GLY A . n A 1 121 ALA 121 472 472 ALA ALA A . n A 1 122 ALA 122 473 473 ALA ALA A . n A 1 123 ARG 123 474 474 ARG ARG A . n A 1 124 PRO 124 475 475 PRO PRO A . n A 1 125 SER 125 476 476 SER SER A . n A 1 126 GLU 126 477 477 GLU GLU A . n A 1 127 THR 127 478 478 THR THR A . n A 1 128 THR 128 479 479 THR THR A . n A 1 129 LEU 129 480 480 LEU LEU A . n A 1 130 CYS 130 481 481 CYS CYS A . n A 1 131 GLN 131 482 482 GLN GLN A . n A 1 132 VAL 132 483 483 VAL VAL A . n A 1 133 ALA 133 484 484 ALA ALA A . n A 1 134 GLY 134 485 485 GLY GLY A . n A 1 135 TRP 135 486 486 TRP TRP A . n A 1 136 GLY 136 487 487 GLY GLY A . n A 1 137 HIS 137 488 488 HIS HIS A . n A 1 138 GLN 138 489 489 GLN GLN A . n A 1 139 PHE 139 490 490 PHE PHE A . n A 1 140 GLU 140 491 491 GLU GLU A . n A 1 141 GLY 141 492 492 GLY GLY A . n A 1 142 ALA 142 493 493 ALA ALA A . n A 1 143 GLU 143 494 494 GLU GLU A . n A 1 144 GLU 144 495 495 GLU GLU A . n A 1 145 TYR 145 496 496 TYR TYR A . n A 1 146 ALA 146 497 497 ALA ALA A . n A 1 147 SER 147 498 498 SER SER A . n A 1 148 PHE 148 499 499 PHE PHE A . n A 1 149 LEU 149 500 500 LEU LEU A . n A 1 150 GLN 150 501 501 GLN GLN A . n A 1 151 GLU 151 502 502 GLU GLU A . n A 1 152 ALA 152 503 503 ALA ALA A . n A 1 153 GLN 153 504 504 GLN GLN A . n A 1 154 VAL 154 505 505 VAL VAL A . n A 1 155 PRO 155 506 506 PRO PRO A . n A 1 156 PHE 156 507 507 PHE PHE A . n A 1 157 LEU 157 508 508 LEU LEU A . n A 1 158 SER 158 509 509 SER SER A . n A 1 159 LEU 159 510 510 LEU LEU A . n A 1 160 GLU 160 511 511 GLU GLU A . n A 1 161 ARG 161 512 512 ARG ARG A . n A 1 162 CYS 162 513 513 CYS CYS A . n A 1 163 SER 163 514 514 SER SER A . n A 1 164 ALA 164 515 515 ALA ALA A . n A 1 165 PRO 165 516 516 PRO PRO A . n A 1 166 ASP 166 517 517 ASP ASP A . n A 1 167 VAL 167 518 518 VAL VAL A . n A 1 168 HIS 168 519 519 HIS HIS A . n A 1 169 GLY 169 520 520 GLY GLY A . n A 1 170 SER 170 521 521 SER SER A . n A 1 171 SER 171 522 522 SER SER A . n A 1 172 ILE 172 523 523 ILE ILE A . n A 1 173 LEU 173 524 524 LEU LEU A . n A 1 174 PRO 174 525 525 PRO PRO A . n A 1 175 GLY 175 526 526 GLY GLY A . n A 1 176 MET 176 527 527 MET MET A . n A 1 177 LEU 177 528 528 LEU LEU A . n A 1 178 CYS 178 529 529 CYS CYS A . n A 1 179 ALA 179 530 530 ALA ALA A . n A 1 180 GLY 180 531 531 GLY GLY A . n A 1 181 PHE 181 532 532 PHE PHE A . n A 1 182 LEU 182 533 533 LEU LEU A . n A 1 183 GLU 183 534 534 GLU GLU A . n A 1 184 GLY 184 535 535 GLY GLY A . n A 1 185 GLY 185 536 536 GLY GLY A . n A 1 186 THR 186 537 537 THR THR A . n A 1 187 ASP 187 538 538 ASP ASP A . n A 1 188 ALA 188 539 539 ALA ALA A . n A 1 189 CYS 189 540 540 CYS CYS A . n A 1 190 GLN 190 541 541 GLN GLN A . n A 1 191 GLY 191 542 542 GLY GLY A . n A 1 192 ASP 192 543 543 ASP ASP A . n A 1 193 SER 193 544 544 SER SER A . n A 1 194 GLY 194 545 545 GLY GLY A . n A 1 195 GLY 195 546 546 GLY GLY A . n A 1 196 PRO 196 547 547 PRO PRO A . n A 1 197 LEU 197 548 548 LEU LEU A . n A 1 198 VAL 198 549 549 VAL VAL A . n A 1 199 CYS 199 550 550 CYS CYS A . n A 1 200 GLU 200 551 551 GLU GLU A . n A 1 201 ASP 201 552 552 ASP ASP A . n A 1 202 GLN 202 553 553 GLN GLN A . n A 1 203 ALA 203 554 554 ALA ALA A . n A 1 204 ALA 204 555 555 ALA ALA A . n A 1 205 GLU 205 556 556 GLU GLU A . n A 1 206 ARG 206 557 557 ARG ARG A . n A 1 207 ARG 207 558 558 ARG ARG A . n A 1 208 LEU 208 559 559 LEU LEU A . n A 1 209 THR 209 560 560 THR THR A . n A 1 210 LEU 210 561 561 LEU LEU A . n A 1 211 GLN 211 562 562 GLN GLN A . n A 1 212 GLY 212 563 563 GLY GLY A . n A 1 213 ILE 213 564 564 ILE ILE A . n A 1 214 ILE 214 565 565 ILE ILE A . n A 1 215 SER 215 566 566 SER SER A . n A 1 216 TRP 216 567 567 TRP TRP A . n A 1 217 GLY 217 568 568 GLY GLY A . n A 1 218 SER 218 569 569 SER SER A . n A 1 219 GLY 219 570 570 GLY GLY A . n A 1 220 CYS 220 571 571 CYS CYS A . n A 1 221 GLY 221 572 572 GLY GLY A . n A 1 222 ASP 222 573 573 ASP ASP A . n A 1 223 ARG 223 574 574 ARG ARG A . n A 1 224 ASN 224 575 575 ASN ASN A . n A 1 225 LYS 225 576 576 LYS LYS A . n A 1 226 PRO 226 577 577 PRO PRO A . n A 1 227 GLY 227 578 578 GLY GLY A . n A 1 228 VAL 228 579 579 VAL VAL A . n A 1 229 TYR 229 580 580 TYR TYR A . n A 1 230 THR 230 581 581 THR THR A . n A 1 231 ASP 231 582 582 ASP ASP A . n A 1 232 VAL 232 583 583 VAL VAL A . n A 1 233 ALA 233 584 584 ALA ALA A . n A 1 234 TYR 234 585 585 TYR TYR A . n A 1 235 TYR 235 586 586 TYR TYR A . n A 1 236 LEU 236 587 587 LEU LEU A . n A 1 237 ALA 237 588 588 ALA ALA A . n A 1 238 TRP 238 589 589 TRP TRP A . n A 1 239 ILE 239 590 590 ILE ILE A . n A 1 240 ARG 240 591 591 ARG ARG A . n A 1 241 GLU 241 592 592 GLU GLU A . n A 1 242 HIS 242 593 593 HIS HIS A . n A 1 243 THR 243 594 594 THR THR A . n A 1 244 VAL 244 595 595 VAL VAL A . n A 1 245 SER 245 596 596 SER SER A . n A 1 246 HIS 246 597 597 HIS HIS A . n A 1 247 HIS 247 598 598 HIS HIS A . n A 1 248 THR 248 599 599 THR THR A . n A 1 249 GLY 249 600 ? ? ? A . n A 1 250 THR 250 601 ? ? ? A . n A 1 251 ARG 251 602 ? ? ? A . n A 1 252 HIS 252 603 ? ? ? A . n A 1 253 HIS 253 604 ? ? ? A . n A 1 254 HIS 254 605 ? ? ? A . n A 1 255 HIS 255 606 ? ? ? A . n A 1 256 HIS 256 607 ? ? ? A . n A 1 257 HIS 257 608 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IPA 1 701 701 IPA IPA A . C 2 IPA 1 702 702 IPA IPA A . D 3 FLC 1 703 801 FLC FLC A . E 4 HOH 1 801 1080 HOH HOH A . E 4 HOH 2 802 1056 HOH HOH A . E 4 HOH 3 803 1078 HOH HOH A . E 4 HOH 4 804 1085 HOH HOH A . E 4 HOH 5 805 1058 HOH HOH A . E 4 HOH 6 806 1057 HOH HOH A . E 4 HOH 7 807 1017 HOH HOH A . E 4 HOH 8 808 1042 HOH HOH A . E 4 HOH 9 809 1031 HOH HOH A . E 4 HOH 10 810 1079 HOH HOH A . E 4 HOH 11 811 1045 HOH HOH A . E 4 HOH 12 812 1007 HOH HOH A . E 4 HOH 13 813 1051 HOH HOH A . E 4 HOH 14 814 1027 HOH HOH A . E 4 HOH 15 815 1032 HOH HOH A . E 4 HOH 16 816 1034 HOH HOH A . E 4 HOH 17 817 1076 HOH HOH A . E 4 HOH 18 818 1030 HOH HOH A . E 4 HOH 19 819 1024 HOH HOH A . E 4 HOH 20 820 1009 HOH HOH A . E 4 HOH 21 821 1073 HOH HOH A . E 4 HOH 22 822 1088 HOH HOH A . E 4 HOH 23 823 1061 HOH HOH A . E 4 HOH 24 824 1005 HOH HOH A . E 4 HOH 25 825 1077 HOH HOH A . E 4 HOH 26 826 1087 HOH HOH A . E 4 HOH 27 827 1037 HOH HOH A . E 4 HOH 28 828 1049 HOH HOH A . E 4 HOH 29 829 1021 HOH HOH A . E 4 HOH 30 830 1052 HOH HOH A . E 4 HOH 31 831 1094 HOH HOH A . E 4 HOH 32 832 1097 HOH HOH A . E 4 HOH 33 833 1020 HOH HOH A . E 4 HOH 34 834 1083 HOH HOH A . E 4 HOH 35 835 1086 HOH HOH A . E 4 HOH 36 836 1062 HOH HOH A . E 4 HOH 37 837 1068 HOH HOH A . E 4 HOH 38 838 1089 HOH HOH A . E 4 HOH 39 839 1070 HOH HOH A . E 4 HOH 40 840 1050 HOH HOH A . E 4 HOH 41 841 1071 HOH HOH A . E 4 HOH 42 842 1053 HOH HOH A . E 4 HOH 43 843 1082 HOH HOH A . E 4 HOH 44 844 1001 HOH HOH A . E 4 HOH 45 845 1002 HOH HOH A . E 4 HOH 46 846 1003 HOH HOH A . E 4 HOH 47 847 1004 HOH HOH A . E 4 HOH 48 848 1006 HOH HOH A . E 4 HOH 49 849 1008 HOH HOH A . E 4 HOH 50 850 1010 HOH HOH A . E 4 HOH 51 851 1011 HOH HOH A . E 4 HOH 52 852 1012 HOH HOH A . E 4 HOH 53 853 1013 HOH HOH A . E 4 HOH 54 854 1014 HOH HOH A . E 4 HOH 55 855 1015 HOH HOH A . E 4 HOH 56 856 1016 HOH HOH A . E 4 HOH 57 857 1018 HOH HOH A . E 4 HOH 58 858 1019 HOH HOH A . E 4 HOH 59 859 1022 HOH HOH A . E 4 HOH 60 860 1023 HOH HOH A . E 4 HOH 61 861 1025 HOH HOH A . E 4 HOH 62 862 1026 HOH HOH A . E 4 HOH 63 863 1028 HOH HOH A . E 4 HOH 64 864 1029 HOH HOH A . E 4 HOH 65 865 1033 HOH HOH A . E 4 HOH 66 866 1035 HOH HOH A . E 4 HOH 67 867 1036 HOH HOH A . E 4 HOH 68 868 1038 HOH HOH A . E 4 HOH 69 869 1039 HOH HOH A . E 4 HOH 70 870 1040 HOH HOH A . E 4 HOH 71 871 1041 HOH HOH A . E 4 HOH 72 872 1043 HOH HOH A . E 4 HOH 73 873 1044 HOH HOH A . E 4 HOH 74 874 1046 HOH HOH A . E 4 HOH 75 875 1047 HOH HOH A . E 4 HOH 76 876 1048 HOH HOH A . E 4 HOH 77 877 1054 HOH HOH A . E 4 HOH 78 878 1055 HOH HOH A . E 4 HOH 79 879 1059 HOH HOH A . E 4 HOH 80 880 1060 HOH HOH A . E 4 HOH 81 881 1063 HOH HOH A . E 4 HOH 82 882 1064 HOH HOH A . E 4 HOH 83 883 1065 HOH HOH A . E 4 HOH 84 884 1066 HOH HOH A . E 4 HOH 85 885 1067 HOH HOH A . E 4 HOH 86 886 1069 HOH HOH A . E 4 HOH 87 887 1072 HOH HOH A . E 4 HOH 88 888 1074 HOH HOH A . E 4 HOH 89 889 1075 HOH HOH A . E 4 HOH 90 890 1081 HOH HOH A . E 4 HOH 91 891 1084 HOH HOH A . E 4 HOH 92 892 1090 HOH HOH A . E 4 HOH 93 893 1091 HOH HOH A . E 4 HOH 94 894 1092 HOH HOH A . E 4 HOH 95 895 1093 HOH HOH A . E 4 HOH 96 896 1095 HOH HOH A . E 4 HOH 97 897 1096 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 800 ? 1 MORE 8 ? 1 'SSA (A^2)' 12090 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-02-04 2 'Structure model' 1 1 2015-04-15 3 'Structure model' 1 2 2015-10-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.7.0029 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A ARG 413 ? ? N A ASN 414 ? ? 1.65 2 1 O A ASN 414 ? ? N A HIS 415 ? ? 1.79 3 1 CA A ARG 413 ? ? N A ASN 414 ? ? 1.80 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 C A ARG 413 ? ? N A ASN 414 ? ? 0.573 1.336 -0.763 0.023 Y 2 1 C A ASN 414 ? ? N A HIS 415 ? ? 1.030 1.336 -0.306 0.023 Y # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 N A LEU 361 ? ? CA A LEU 361 ? ? C A LEU 361 ? ? 127.91 111.00 16.91 2.70 N 2 1 CA A ASN 414 ? ? C A ASN 414 ? ? N A HIS 415 ? ? 133.16 117.20 15.96 2.20 Y 3 1 O A ASN 414 ? ? C A ASN 414 ? ? N A HIS 415 ? ? 105.64 122.70 -17.06 1.60 Y 4 1 N A THR 537 ? ? CA A THR 537 ? ? C A THR 537 ? ? 128.08 111.00 17.08 2.70 N 5 1 N A ASP 538 ? ? CA A ASP 538 ? ? CB A ASP 538 ? ? 121.53 110.60 10.93 1.80 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 414 ? ? 32.27 32.50 2 1 CYS A 456 ? ? -110.59 -89.09 3 1 ALA A 493 ? ? 47.76 73.31 4 1 VAL A 518 ? ? -109.49 -87.05 5 1 THR A 537 ? ? 31.38 45.51 6 1 GLN A 553 ? ? 70.43 -50.78 7 1 ALA A 554 ? ? -69.97 13.47 # _pdbx_validate_main_chain_plane.id 1 _pdbx_validate_main_chain_plane.PDB_model_num 1 _pdbx_validate_main_chain_plane.auth_comp_id ASN _pdbx_validate_main_chain_plane.auth_asym_id A _pdbx_validate_main_chain_plane.auth_seq_id 414 _pdbx_validate_main_chain_plane.PDB_ins_code ? _pdbx_validate_main_chain_plane.label_alt_id ? _pdbx_validate_main_chain_plane.improper_torsion_angle -11.12 # loop_ _pdbx_validate_polymer_linkage.id _pdbx_validate_polymer_linkage.PDB_model_num _pdbx_validate_polymer_linkage.auth_atom_id_1 _pdbx_validate_polymer_linkage.auth_asym_id_1 _pdbx_validate_polymer_linkage.auth_comp_id_1 _pdbx_validate_polymer_linkage.auth_seq_id_1 _pdbx_validate_polymer_linkage.PDB_ins_code_1 _pdbx_validate_polymer_linkage.label_alt_id_1 _pdbx_validate_polymer_linkage.auth_atom_id_2 _pdbx_validate_polymer_linkage.auth_asym_id_2 _pdbx_validate_polymer_linkage.auth_comp_id_2 _pdbx_validate_polymer_linkage.auth_seq_id_2 _pdbx_validate_polymer_linkage.PDB_ins_code_2 _pdbx_validate_polymer_linkage.label_alt_id_2 _pdbx_validate_polymer_linkage.dist 1 1 C A ARG 413 ? ? N A ASN 414 ? ? 0.57 2 1 C A ASN 414 ? ? N A HIS 415 ? ? 1.03 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ARG 352 ? A ARG 1 2 1 Y 1 A SER 353 ? A SER 2 3 1 Y 1 A VAL 354 ? A VAL 3 4 1 Y 1 A VAL 355 ? A VAL 4 5 1 Y 1 A GLY 356 ? A GLY 5 6 1 Y 1 A GLY 357 ? A GLY 6 7 1 Y 1 A LEU 358 ? A LEU 7 8 1 Y 1 A GLY 600 ? A GLY 249 9 1 Y 1 A THR 601 ? A THR 250 10 1 Y 1 A ARG 602 ? A ARG 251 11 1 Y 1 A HIS 603 ? A HIS 252 12 1 Y 1 A HIS 604 ? A HIS 253 13 1 Y 1 A HIS 605 ? A HIS 254 14 1 Y 1 A HIS 606 ? A HIS 255 15 1 Y 1 A HIS 607 ? A HIS 256 16 1 Y 1 A HIS 608 ? A HIS 257 # _pdbx_audit_support.funding_organization ? _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ISOPROPYL ALCOHOL' IPA 3 'CITRATE ANION' FLC 4 water HOH #