data_4XF4 # _entry.id 4XF4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.389 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4XF4 pdb_00004xf4 10.2210/pdb4xf4/pdb WWPDB D_1000205560 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-03-16 2 'Structure model' 1 1 2016-12-14 3 'Structure model' 1 2 2017-09-06 4 'Structure model' 1 3 2019-12-04 5 'Structure model' 1 4 2023-09-27 6 'Structure model' 1 5 2023-11-15 7 'Structure model' 1 6 2024-04-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 4 'Structure model' 'Author supporting evidence' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Refinement description' 8 6 'Structure model' 'Data collection' 9 7 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_audit_support 2 4 'Structure model' pdbx_audit_support 3 5 'Structure model' chem_comp_atom 4 5 'Structure model' chem_comp_bond 5 5 'Structure model' database_2 6 5 'Structure model' pdbx_initial_refinement_model 7 5 'Structure model' struct_conn 8 5 'Structure model' struct_conn_type 9 6 'Structure model' chem_comp_atom 10 6 'Structure model' chem_comp_bond 11 7 'Structure model' chem_comp # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_audit_support.funding_organization' 2 4 'Structure model' '_pdbx_audit_support.funding_organization' 3 5 'Structure model' '_database_2.pdbx_DOI' 4 5 'Structure model' '_database_2.pdbx_database_accession' 5 5 'Structure model' '_struct_conn.conn_type_id' 6 5 'Structure model' '_struct_conn.id' 7 5 'Structure model' '_struct_conn.pdbx_dist_value' 8 5 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 9 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 10 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 11 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 12 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 13 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 14 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 15 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 16 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 17 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 18 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 19 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 20 5 'Structure model' '_struct_conn_type.id' 21 6 'Structure model' '_chem_comp_atom.atom_id' 22 6 'Structure model' '_chem_comp_bond.atom_id_2' 23 7 'Structure model' '_chem_comp.pdbx_synonyms' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4XF4 _pdbx_database_status.recvd_initial_deposition_date 2014-12-26 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'unliganded wt CDO at pH 4.0 in the presence of Cys' 4IEO unspecified PDB 'unliganded wt CDO at pH 4.5 in the presence of Cys' 4IEP unspecified PDB 'unliganded wt CDO at pH 5.0 in the presence of Cys' 4IEQ unspecified PDB 'Cys-persulfenate bound wt CDO at pH 5.5 in the presence of Cys' 4IER unspecified PDB 'Cys-persulfeante bound wt CDO at pH 6.2 in the presence of Cys' 4IES unspecified PDB 'Cys-persulfeante bound wt CDO at pH 6.8 in the presence of Cys' 4IET unspecified PDB 'Cys-persulfenate bound wt CDO at pH 7.0 in the presence of Cys' 4IEU unspecified PDB 'Cys-only bound wt CDO at pH 8.0 in the presence of Cys' 4IEV unspecified PDB 'Cys-only bound Cysteine Dioxygenase at pH 9.0 in the presence of Cys' 4IEW unspecified PDB 'unliganded room-temp wt CDO at pH 6.2' 4IEX unspecified PDB 'Cys-persulfeante bound wt CDO at pH 7.0 in the presence of Cys,home-source structure' 4IEY unspecified PDB 'unliganded wt CDO at pH 8.0' 4IEZ unspecified PDB 'wt CDO at pH 8.0 in the presence of dithionite' 4JTN unspecified PDB 'Cys-only bound wt CDO at pH 8.0 in the presence of Cys and dithionite' 4JTO unspecified PDB 'Cys-persulfide bound wt CDO' 4KWK unspecified PDB '3-mercaptopropionate-persulfide bound wt CDO' 4KWL unspecified PDB 'unliganded C93A CDO at pH 6.2' 4PIX unspecified PDB 'homocysteine-bound C93A CDO at pH 6.2' 4PIY unspecified PDB 'homocysteine-bound wt CDO at pH 6.2' 4PIZ unspecified PDB 'azide-bound wt CDO at pH 6.2' 4PJY unspecified PDB 'Fe-Cl bound Y157F at pH ~7.0 in the presence of azide' 4EXT unspecified PDB 'cysteine dioxygenase variant - Y157F at pH 8.0 with dithionite' 4XEZ unspecified PDB 'cysteine dioxygenase variant - C93A at pH 8.0 with cysteine' 4XF0 unspecified PDB 'cysteine dioxygenase variant - Y157F at pH 8.0 with cysteine' 4XF1 unspecified PDB 'cysteine dioxygenase variant - Y157F at pH 8.0 with cysteine and dithionite' 4XF3 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Driggers, C.M.' 1 'Karplus, P.A.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Mol. Biol.' _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 428 _citation.language ? _citation.page_first 3999 _citation.page_last 4012 _citation.title 'Structure-Based Insights into the Role of the Cys-Tyr Crosslink and Inhibitor Recognition by Mammalian Cysteine Dioxygenase.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2016.07.012 _citation.pdbx_database_id_PubMed 27477048 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Driggers, C.M.' 1 ? primary 'Kean, K.M.' 2 ? primary 'Hirschberger, L.L.' 3 ? primary 'Cooley, R.B.' 4 ? primary 'Stipanuk, M.H.' 5 ? primary 'Karplus, P.A.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cysteine dioxygenase type 1' 23058.889 1 1.13.11.20 ? ? ? 2 non-polymer syn 'FE (III) ION' 55.845 1 ? ? ? ? 3 non-polymer syn '2-AMINO-4-MERCAPTO-BUTYRIC ACID' 135.185 1 ? ? ? ? 4 water nat water 18.015 280 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cysteine dioxygenase type I,CDO-I' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN ; _entity_poly.pdbx_seq_one_letter_code_can ;MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'FE (III) ION' FE 3 '2-AMINO-4-MERCAPTO-BUTYRIC ACID' HCS 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLU n 1 3 ARG n 1 4 THR n 1 5 GLU n 1 6 LEU n 1 7 LEU n 1 8 LYS n 1 9 PRO n 1 10 ARG n 1 11 THR n 1 12 LEU n 1 13 ALA n 1 14 ASP n 1 15 LEU n 1 16 ILE n 1 17 ARG n 1 18 ILE n 1 19 LEU n 1 20 HIS n 1 21 GLU n 1 22 LEU n 1 23 PHE n 1 24 ALA n 1 25 GLY n 1 26 ASP n 1 27 GLU n 1 28 VAL n 1 29 ASN n 1 30 VAL n 1 31 GLU n 1 32 GLU n 1 33 VAL n 1 34 GLN n 1 35 ALA n 1 36 VAL n 1 37 LEU n 1 38 GLU n 1 39 ALA n 1 40 TYR n 1 41 GLU n 1 42 SER n 1 43 ASN n 1 44 PRO n 1 45 ALA n 1 46 GLU n 1 47 TRP n 1 48 ALA n 1 49 LEU n 1 50 TYR n 1 51 ALA n 1 52 LYS n 1 53 PHE n 1 54 ASP n 1 55 GLN n 1 56 TYR n 1 57 ARG n 1 58 TYR n 1 59 THR n 1 60 ARG n 1 61 ASN n 1 62 LEU n 1 63 VAL n 1 64 ASP n 1 65 GLN n 1 66 GLY n 1 67 ASN n 1 68 GLY n 1 69 LYS n 1 70 PHE n 1 71 ASN n 1 72 LEU n 1 73 MET n 1 74 ILE n 1 75 LEU n 1 76 CYS n 1 77 TRP n 1 78 GLY n 1 79 GLU n 1 80 GLY n 1 81 HIS n 1 82 GLY n 1 83 SER n 1 84 SER n 1 85 ILE n 1 86 HIS n 1 87 ASP n 1 88 HIS n 1 89 THR n 1 90 ASP n 1 91 SER n 1 92 HIS n 1 93 CYS n 1 94 PHE n 1 95 LEU n 1 96 LYS n 1 97 LEU n 1 98 LEU n 1 99 GLN n 1 100 GLY n 1 101 ASN n 1 102 LEU n 1 103 LYS n 1 104 GLU n 1 105 THR n 1 106 LEU n 1 107 PHE n 1 108 ASP n 1 109 TRP n 1 110 PRO n 1 111 ASP n 1 112 LYS n 1 113 LYS n 1 114 SER n 1 115 ASN n 1 116 GLU n 1 117 MET n 1 118 ILE n 1 119 LYS n 1 120 LYS n 1 121 SER n 1 122 GLU n 1 123 ARG n 1 124 THR n 1 125 LEU n 1 126 ARG n 1 127 GLU n 1 128 ASN n 1 129 GLN n 1 130 CYS n 1 131 ALA n 1 132 TYR n 1 133 ILE n 1 134 ASN n 1 135 ASP n 1 136 SER n 1 137 ILE n 1 138 GLY n 1 139 LEU n 1 140 HIS n 1 141 ARG n 1 142 VAL n 1 143 GLU n 1 144 ASN n 1 145 VAL n 1 146 SER n 1 147 HIS n 1 148 THR n 1 149 GLU n 1 150 PRO n 1 151 ALA n 1 152 VAL n 1 153 SER n 1 154 LEU n 1 155 HIS n 1 156 LEU n 1 157 TYR n 1 158 SER n 1 159 PRO n 1 160 PRO n 1 161 PHE n 1 162 ASP n 1 163 THR n 1 164 CYS n 1 165 HIS n 1 166 ALA n 1 167 PHE n 1 168 ASP n 1 169 GLN n 1 170 ARG n 1 171 THR n 1 172 GLY n 1 173 HIS n 1 174 LYS n 1 175 ASN n 1 176 LYS n 1 177 VAL n 1 178 THR n 1 179 MET n 1 180 THR n 1 181 PHE n 1 182 HIS n 1 183 SER n 1 184 LYS n 1 185 PHE n 1 186 GLY n 1 187 ILE n 1 188 ARG n 1 189 THR n 1 190 PRO n 1 191 PHE n 1 192 THR n 1 193 THR n 1 194 SER n 1 195 GLY n 1 196 SER n 1 197 LEU n 1 198 GLU n 1 199 ASN n 1 200 ASN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 200 _entity_src_gen.gene_src_common_name Rat _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Cdo1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Rattus norvegicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10116 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 FE non-polymer . 'FE (III) ION' ? 'Fe 3' 55.845 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HCS 'L-peptide linking' . '2-AMINO-4-MERCAPTO-BUTYRIC ACID' L-Homocysteine 'C4 H9 N O2 S' 135.185 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 GLU 2 2 ? ? ? A . n A 1 3 ARG 3 3 ? ? ? A . n A 1 4 THR 4 4 ? ? ? A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 LEU 6 6 6 LEU LEU A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 THR 11 11 11 THR THR A . n A 1 12 LEU 12 12 12 LEU LEU A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ASP 14 14 14 ASP ASP A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ILE 16 16 16 ILE ILE A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 HIS 20 20 20 HIS HIS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 PHE 23 23 23 PHE PHE A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 ASP 26 26 26 ASP ASP A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 GLU 32 32 32 GLU GLU A . n A 1 33 VAL 33 33 33 VAL VAL A . n A 1 34 GLN 34 34 34 GLN GLN A . n A 1 35 ALA 35 35 35 ALA ALA A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 ALA 39 39 39 ALA ALA A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 ALA 45 45 45 ALA ALA A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 TRP 47 47 47 TRP TRP A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 TYR 50 50 50 TYR TYR A . n A 1 51 ALA 51 51 51 ALA ALA A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 GLN 55 55 55 GLN GLN A . n A 1 56 TYR 56 56 56 TYR TYR A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 TYR 58 58 58 TYR TYR A . n A 1 59 THR 59 59 59 THR THR A . n A 1 60 ARG 60 60 60 ARG ARG A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 ASP 64 64 64 ASP ASP A . n A 1 65 GLN 65 65 65 GLN GLN A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASN 67 67 67 ASN ASN A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 MET 73 73 73 MET MET A . n A 1 74 ILE 74 74 74 ILE ILE A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 CYS 76 76 76 CYS CYS A . n A 1 77 TRP 77 77 77 TRP TRP A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 GLY 80 80 80 GLY GLY A . n A 1 81 HIS 81 81 81 HIS HIS A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 HIS 86 86 86 HIS HIS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 SER 91 91 91 SER SER A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 CYS 93 93 93 CYS CYS A . n A 1 94 PHE 94 94 94 PHE PHE A . n A 1 95 LEU 95 95 95 LEU LEU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 GLN 99 99 99 GLN GLN A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 GLU 104 104 104 GLU GLU A . n A 1 105 THR 105 105 105 THR THR A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ASP 108 108 108 ASP ASP A . n A 1 109 TRP 109 109 109 TRP TRP A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 ASP 111 111 111 ASP ASP A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 GLU 116 116 116 GLU GLU A . n A 1 117 MET 117 117 117 MET MET A . n A 1 118 ILE 118 118 118 ILE ILE A . n A 1 119 LYS 119 119 119 LYS LYS A . n A 1 120 LYS 120 120 120 LYS LYS A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 GLU 122 122 122 GLU GLU A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 ARG 126 126 126 ARG ARG A . n A 1 127 GLU 127 127 127 GLU GLU A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 GLN 129 129 129 GLN GLN A . n A 1 130 CYS 130 130 130 CYS CYS A . n A 1 131 ALA 131 131 131 ALA ALA A . n A 1 132 TYR 132 132 132 TYR TYR A . n A 1 133 ILE 133 133 133 ILE ILE A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ILE 137 137 137 ILE ILE A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 LEU 139 139 139 LEU LEU A . n A 1 140 HIS 140 140 140 HIS HIS A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 ASN 144 144 144 ASN ASN A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 SER 146 146 146 SER SER A . n A 1 147 HIS 147 147 147 HIS HIS A . n A 1 148 THR 148 148 148 THR THR A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 PRO 150 150 150 PRO PRO A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 VAL 152 152 152 VAL VAL A . n A 1 153 SER 153 153 153 SER SER A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 HIS 155 155 155 HIS HIS A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 PRO 160 160 160 PRO PRO A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 ASP 162 162 162 ASP ASP A . n A 1 163 THR 163 163 163 THR THR A . n A 1 164 CYS 164 164 164 CYS CYS A . n A 1 165 HIS 165 165 165 HIS HIS A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 PHE 167 167 167 PHE PHE A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 GLN 169 169 169 GLN GLN A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 GLY 172 172 172 GLY GLY A . n A 1 173 HIS 173 173 173 HIS HIS A . n A 1 174 LYS 174 174 174 LYS LYS A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 LYS 176 176 176 LYS LYS A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 MET 179 179 179 MET MET A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 PHE 181 181 181 PHE PHE A . n A 1 182 HIS 182 182 182 HIS HIS A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 PHE 185 185 185 PHE PHE A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 ARG 188 188 188 ARG ARG A . n A 1 189 THR 189 189 189 THR THR A . n A 1 190 PRO 190 190 190 PRO PRO A . n A 1 191 PHE 191 191 ? ? ? A . n A 1 192 THR 192 192 ? ? ? A . n A 1 193 THR 193 193 ? ? ? A . n A 1 194 SER 194 194 ? ? ? A . n A 1 195 GLY 195 195 ? ? ? A . n A 1 196 SER 196 196 ? ? ? A . n A 1 197 LEU 197 197 ? ? ? A . n A 1 198 GLU 198 198 ? ? ? A . n A 1 199 ASN 199 199 ? ? ? A . n A 1 200 ASN 200 200 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 FE 1 501 501 FE FE A . C 3 HCS 1 502 502 HCS HCS A . D 4 HOH 1 601 112 HOH HOH A . D 4 HOH 2 602 89 HOH HOH A . D 4 HOH 3 603 216 HOH HOH A . D 4 HOH 4 604 48 HOH HOH A . D 4 HOH 5 605 225 HOH HOH A . D 4 HOH 6 606 172 HOH HOH A . D 4 HOH 7 607 295 HOH HOH A . D 4 HOH 8 608 192 HOH HOH A . D 4 HOH 9 609 258 HOH HOH A . D 4 HOH 10 610 77 HOH HOH A . D 4 HOH 11 611 178 HOH HOH A . D 4 HOH 12 612 237 HOH HOH A . D 4 HOH 13 613 145 HOH HOH A . D 4 HOH 14 614 276 HOH HOH A . D 4 HOH 15 615 180 HOH HOH A . D 4 HOH 16 616 57 HOH HOH A . D 4 HOH 17 617 128 HOH HOH A . D 4 HOH 18 618 263 HOH HOH A . D 4 HOH 19 619 102 HOH HOH A . D 4 HOH 20 620 282 HOH HOH A . D 4 HOH 21 621 209 HOH HOH A . D 4 HOH 22 622 75 HOH HOH A . D 4 HOH 23 623 74 HOH HOH A . D 4 HOH 24 624 31 HOH HOH A . D 4 HOH 25 625 25 HOH HOH A . D 4 HOH 26 626 236 HOH HOH A . D 4 HOH 27 627 187 HOH HOH A . D 4 HOH 28 628 104 HOH HOH A . D 4 HOH 29 629 18 HOH HOH A . D 4 HOH 30 630 243 HOH HOH A . D 4 HOH 31 631 20 HOH HOH A . D 4 HOH 32 632 175 HOH HOH A . D 4 HOH 33 633 202 HOH HOH A . D 4 HOH 34 634 179 HOH HOH A . D 4 HOH 35 635 207 HOH HOH A . D 4 HOH 36 636 53 HOH HOH A . D 4 HOH 37 637 28 HOH HOH A . D 4 HOH 38 638 52 HOH HOH A . D 4 HOH 39 639 278 HOH HOH A . D 4 HOH 40 640 261 HOH HOH A . D 4 HOH 41 641 150 HOH HOH A . D 4 HOH 42 642 111 HOH HOH A . D 4 HOH 43 643 153 HOH HOH A . D 4 HOH 44 644 224 HOH HOH A . D 4 HOH 45 645 60 HOH HOH A . D 4 HOH 46 646 29 HOH HOH A . D 4 HOH 47 647 170 HOH HOH A . D 4 HOH 48 648 138 HOH HOH A . D 4 HOH 49 649 140 HOH HOH A . D 4 HOH 50 650 257 HOH HOH A . D 4 HOH 51 651 9 HOH HOH A . D 4 HOH 52 652 238 HOH HOH A . D 4 HOH 53 653 36 HOH HOH A . D 4 HOH 54 654 34 HOH HOH A . D 4 HOH 55 655 133 HOH HOH A . D 4 HOH 56 656 11 HOH HOH A . D 4 HOH 57 657 13 HOH HOH A . D 4 HOH 58 658 95 HOH HOH A . D 4 HOH 59 659 101 HOH HOH A . D 4 HOH 60 660 50 HOH HOH A . D 4 HOH 61 661 78 HOH HOH A . D 4 HOH 62 662 51 HOH HOH A . D 4 HOH 63 663 54 HOH HOH A . D 4 HOH 64 664 70 HOH HOH A . D 4 HOH 65 665 16 HOH HOH A . D 4 HOH 66 666 182 HOH HOH A . D 4 HOH 67 667 1 HOH HOH A . D 4 HOH 68 668 27 HOH HOH A . D 4 HOH 69 669 40 HOH HOH A . D 4 HOH 70 670 117 HOH HOH A . D 4 HOH 71 671 151 HOH HOH A . D 4 HOH 72 672 186 HOH HOH A . D 4 HOH 73 673 199 HOH HOH A . D 4 HOH 74 674 118 HOH HOH A . D 4 HOH 75 675 100 HOH HOH A . D 4 HOH 76 676 215 HOH HOH A . D 4 HOH 77 677 191 HOH HOH A . D 4 HOH 78 678 108 HOH HOH A . D 4 HOH 79 679 97 HOH HOH A . D 4 HOH 80 680 212 HOH HOH A . D 4 HOH 81 681 106 HOH HOH A . D 4 HOH 82 682 165 HOH HOH A . D 4 HOH 83 683 185 HOH HOH A . D 4 HOH 84 684 39 HOH HOH A . D 4 HOH 85 685 46 HOH HOH A . D 4 HOH 86 686 64 HOH HOH A . D 4 HOH 87 687 15 HOH HOH A . D 4 HOH 88 688 67 HOH HOH A . D 4 HOH 89 689 268 HOH HOH A . D 4 HOH 90 690 85 HOH HOH A . D 4 HOH 91 691 21 HOH HOH A . D 4 HOH 92 692 19 HOH HOH A . D 4 HOH 93 693 62 HOH HOH A . D 4 HOH 94 694 14 HOH HOH A . D 4 HOH 95 695 56 HOH HOH A . D 4 HOH 96 696 58 HOH HOH A . D 4 HOH 97 697 35 HOH HOH A . D 4 HOH 98 698 61 HOH HOH A . D 4 HOH 99 699 190 HOH HOH A . D 4 HOH 100 700 22 HOH HOH A . D 4 HOH 101 701 213 HOH HOH A . D 4 HOH 102 702 252 HOH HOH A . D 4 HOH 103 703 69 HOH HOH A . D 4 HOH 104 704 63 HOH HOH A . D 4 HOH 105 705 125 HOH HOH A . D 4 HOH 106 706 219 HOH HOH A . D 4 HOH 107 707 84 HOH HOH A . D 4 HOH 108 708 30 HOH HOH A . D 4 HOH 109 709 5 HOH HOH A . D 4 HOH 110 710 126 HOH HOH A . D 4 HOH 111 711 157 HOH HOH A . D 4 HOH 112 712 277 HOH HOH A . D 4 HOH 113 713 134 HOH HOH A . D 4 HOH 114 714 79 HOH HOH A . D 4 HOH 115 715 146 HOH HOH A . D 4 HOH 116 716 256 HOH HOH A . D 4 HOH 117 717 86 HOH HOH A . D 4 HOH 118 718 12 HOH HOH A . D 4 HOH 119 719 73 HOH HOH A . D 4 HOH 120 720 92 HOH HOH A . D 4 HOH 121 721 93 HOH HOH A . D 4 HOH 122 722 137 HOH HOH A . D 4 HOH 123 723 223 HOH HOH A . D 4 HOH 124 724 163 HOH HOH A . D 4 HOH 125 725 38 HOH HOH A . D 4 HOH 126 726 10 HOH HOH A . D 4 HOH 127 727 32 HOH HOH A . D 4 HOH 128 728 184 HOH HOH A . D 4 HOH 129 729 37 HOH HOH A . D 4 HOH 130 730 23 HOH HOH A . D 4 HOH 131 731 42 HOH HOH A . D 4 HOH 132 732 270 HOH HOH A . D 4 HOH 133 733 55 HOH HOH A . D 4 HOH 134 734 3 HOH HOH A . D 4 HOH 135 735 205 HOH HOH A . D 4 HOH 136 736 127 HOH HOH A . D 4 HOH 137 737 2 HOH HOH A . D 4 HOH 138 738 68 HOH HOH A . D 4 HOH 139 739 43 HOH HOH A . D 4 HOH 140 740 110 HOH HOH A . D 4 HOH 141 741 115 HOH HOH A . D 4 HOH 142 742 160 HOH HOH A . D 4 HOH 143 743 289 HOH HOH A . D 4 HOH 144 744 281 HOH HOH A . D 4 HOH 145 745 177 HOH HOH A . D 4 HOH 146 746 129 HOH HOH A . D 4 HOH 147 747 59 HOH HOH A . D 4 HOH 148 748 210 HOH HOH A . D 4 HOH 149 749 8 HOH HOH A . D 4 HOH 150 750 4 HOH HOH A . D 4 HOH 151 751 47 HOH HOH A . D 4 HOH 152 752 87 HOH HOH A . D 4 HOH 153 753 201 HOH HOH A . D 4 HOH 154 754 158 HOH HOH A . D 4 HOH 155 755 203 HOH HOH A . D 4 HOH 156 756 155 HOH HOH A . D 4 HOH 157 757 218 HOH HOH A . D 4 HOH 158 758 33 HOH HOH A . D 4 HOH 159 759 248 HOH HOH A . D 4 HOH 160 760 6 HOH HOH A . D 4 HOH 161 761 109 HOH HOH A . D 4 HOH 162 762 116 HOH HOH A . D 4 HOH 163 763 273 HOH HOH A . D 4 HOH 164 764 7 HOH HOH A . D 4 HOH 165 765 82 HOH HOH A . D 4 HOH 166 766 156 HOH HOH A . D 4 HOH 167 767 131 HOH HOH A . D 4 HOH 168 768 222 HOH HOH A . D 4 HOH 169 769 24 HOH HOH A . D 4 HOH 170 770 290 HOH HOH A . D 4 HOH 171 771 121 HOH HOH A . D 4 HOH 172 772 72 HOH HOH A . D 4 HOH 173 773 166 HOH HOH A . D 4 HOH 174 774 152 HOH HOH A . D 4 HOH 175 775 135 HOH HOH A . D 4 HOH 176 776 154 HOH HOH A . D 4 HOH 177 777 242 HOH HOH A . D 4 HOH 178 778 294 HOH HOH A . D 4 HOH 179 779 176 HOH HOH A . D 4 HOH 180 780 123 HOH HOH A . D 4 HOH 181 781 83 HOH HOH A . D 4 HOH 182 782 255 HOH HOH A . D 4 HOH 183 783 76 HOH HOH A . D 4 HOH 184 784 130 HOH HOH A . D 4 HOH 185 785 66 HOH HOH A . D 4 HOH 186 786 208 HOH HOH A . D 4 HOH 187 787 120 HOH HOH A . D 4 HOH 188 788 142 HOH HOH A . D 4 HOH 189 789 44 HOH HOH A . D 4 HOH 190 790 221 HOH HOH A . D 4 HOH 191 791 266 HOH HOH A . D 4 HOH 192 792 279 HOH HOH A . D 4 HOH 193 793 17 HOH HOH A . D 4 HOH 194 794 226 HOH HOH A . D 4 HOH 195 795 94 HOH HOH A . D 4 HOH 196 796 49 HOH HOH A . D 4 HOH 197 797 211 HOH HOH A . D 4 HOH 198 798 96 HOH HOH A . D 4 HOH 199 799 161 HOH HOH A . D 4 HOH 200 800 275 HOH HOH A . D 4 HOH 201 801 240 HOH HOH A . D 4 HOH 202 802 124 HOH HOH A . D 4 HOH 203 803 200 HOH HOH A . D 4 HOH 204 804 287 HOH HOH A . D 4 HOH 205 805 265 HOH HOH A . D 4 HOH 206 806 291 HOH HOH A . D 4 HOH 207 807 45 HOH HOH A . D 4 HOH 208 808 71 HOH HOH A . D 4 HOH 209 809 171 HOH HOH A . D 4 HOH 210 810 147 HOH HOH A . D 4 HOH 211 811 293 HOH HOH A . D 4 HOH 212 812 244 HOH HOH A . D 4 HOH 213 813 220 HOH HOH A . D 4 HOH 214 814 81 HOH HOH A . D 4 HOH 215 815 144 HOH HOH A . D 4 HOH 216 816 26 HOH HOH A . D 4 HOH 217 817 80 HOH HOH A . D 4 HOH 218 818 193 HOH HOH A . D 4 HOH 219 819 264 HOH HOH A . D 4 HOH 220 820 214 HOH HOH A . D 4 HOH 221 821 132 HOH HOH A . D 4 HOH 222 822 103 HOH HOH A . D 4 HOH 223 823 113 HOH HOH A . D 4 HOH 224 824 198 HOH HOH A . D 4 HOH 225 825 206 HOH HOH A . D 4 HOH 226 826 253 HOH HOH A . D 4 HOH 227 827 167 HOH HOH A . D 4 HOH 228 828 285 HOH HOH A . D 4 HOH 229 829 98 HOH HOH A . D 4 HOH 230 830 246 HOH HOH A . D 4 HOH 231 831 91 HOH HOH A . D 4 HOH 232 832 195 HOH HOH A . D 4 HOH 233 833 239 HOH HOH A . D 4 HOH 234 834 174 HOH HOH A . D 4 HOH 235 835 90 HOH HOH A . D 4 HOH 236 836 292 HOH HOH A . D 4 HOH 237 837 196 HOH HOH A . D 4 HOH 238 838 188 HOH HOH A . D 4 HOH 239 839 122 HOH HOH A . D 4 HOH 240 840 280 HOH HOH A . D 4 HOH 241 841 247 HOH HOH A . D 4 HOH 242 842 107 HOH HOH A . D 4 HOH 243 843 114 HOH HOH A . D 4 HOH 244 844 254 HOH HOH A . D 4 HOH 245 845 241 HOH HOH A . D 4 HOH 246 846 233 HOH HOH A . D 4 HOH 247 847 99 HOH HOH A . D 4 HOH 248 848 164 HOH HOH A . D 4 HOH 249 849 228 HOH HOH A . D 4 HOH 250 850 194 HOH HOH A . D 4 HOH 251 851 136 HOH HOH A . D 4 HOH 252 852 286 HOH HOH A . D 4 HOH 253 853 227 HOH HOH A . D 4 HOH 254 854 88 HOH HOH A . D 4 HOH 255 855 269 HOH HOH A . D 4 HOH 256 856 284 HOH HOH A . D 4 HOH 257 857 149 HOH HOH A . D 4 HOH 258 858 139 HOH HOH A . D 4 HOH 259 859 274 HOH HOH A . D 4 HOH 260 860 181 HOH HOH A . D 4 HOH 261 861 159 HOH HOH A . D 4 HOH 262 862 105 HOH HOH A . D 4 HOH 263 863 41 HOH HOH A . D 4 HOH 264 864 148 HOH HOH A . D 4 HOH 265 865 259 HOH HOH A . D 4 HOH 266 866 283 HOH HOH A . D 4 HOH 267 867 168 HOH HOH A . D 4 HOH 268 868 173 HOH HOH A . D 4 HOH 269 869 245 HOH HOH A . D 4 HOH 270 870 143 HOH HOH A . D 4 HOH 271 871 234 HOH HOH A . D 4 HOH 272 872 230 HOH HOH A . D 4 HOH 273 873 204 HOH HOH A . D 4 HOH 274 874 119 HOH HOH A . D 4 HOH 275 875 162 HOH HOH A . D 4 HOH 276 876 141 HOH HOH A . D 4 HOH 277 877 183 HOH HOH A . D 4 HOH 278 878 169 HOH HOH A . D 4 HOH 279 879 197 HOH HOH A . D 4 HOH 280 880 65 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 112 ? CG ? A LYS 112 CG 2 1 Y 1 A LYS 112 ? CD ? A LYS 112 CD 3 1 Y 1 A LYS 112 ? CE ? A LYS 112 CE 4 1 Y 1 A LYS 112 ? NZ ? A LYS 112 NZ 5 1 Y 1 A LYS 184 ? CE ? A LYS 184 CE 6 1 Y 1 A LYS 184 ? NZ ? A LYS 184 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? iMOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4XF4 _cell.details ? _cell.formula_units_Z ? _cell.length_a 57.600 _cell.length_a_esd ? _cell.length_b 57.600 _cell.length_b_esd ? _cell.length_c 122.400 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4XF4 _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4XF4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.13 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.2 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M tri-sodium citrate pH=5.6, 24% PEG 4000, 0.15M ammonium acetate. 1:1 drop ratio with microseeding.; Soak solution at pH 8.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-02-13 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(220) Asymmetric cut single crystal' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.977 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 5.0.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.977 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 5.0.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4XF4 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.3485 _reflns.d_resolution_low 41 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 43919 _reflns.number_obs 43838 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 23.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 23.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.3485 _reflns_shell.d_res_low 1.37 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.0 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 68 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 10.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4XF4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.3485 _refine.ls_d_res_low 40.729 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 43838 _refine.ls_number_reflns_R_free 4306 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 94.72 _refine.ls_percent_reflns_R_free 9.82 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1652 _refine.ls_R_factor_R_free 0.1906 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1624 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_starting_model 4ieu _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'same 5% as 4ieu' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.25 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.14 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1506 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 9 _refine_hist.number_atoms_solvent 280 _refine_hist.number_atoms_total 1795 _refine_hist.d_res_high 1.3485 _refine_hist.d_res_low 40.729 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 1683 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.358 ? 2293 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.486 ? 632 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.083 ? 243 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 304 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.3485 1.3638 . . 110 894 67.00 . . . 0.3683 . 0.3248 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3638 1.3798 . . 92 972 69.00 . . . 0.3226 . 0.3102 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3798 1.3967 . . 104 1013 75.00 . . . 0.3365 . 0.2918 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.3967 1.4144 . . 109 1064 77.00 . . . 0.2656 . 0.3011 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4144 1.4330 . . 117 1123 81.00 . . . 0.2969 . 0.2777 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4330 1.4526 . . 113 1167 86.00 . . . 0.2855 . 0.2611 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4526 1.4734 . . 142 1237 91.00 . . . 0.2622 . 0.2499 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4734 1.4953 . . 144 1295 96.00 . . . 0.2602 . 0.2235 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.4953 1.5187 . . 158 1365 99.00 . . . 0.2503 . 0.2110 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5187 1.5436 . . 149 1347 100.00 . . . 0.2371 . 0.1886 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5436 1.5702 . . 173 1358 100.00 . . . 0.2016 . 0.1895 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5702 1.5988 . . 156 1369 100.00 . . . 0.1990 . 0.1654 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.5988 1.6295 . . 130 1397 100.00 . . . 0.1731 . 0.1685 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6295 1.6628 . . 157 1349 100.00 . . . 0.1917 . 0.1572 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6628 1.6990 . . 151 1387 100.00 . . . 0.1874 . 0.1678 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.6990 1.7385 . . 160 1361 100.00 . . . 0.1716 . 0.1634 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7385 1.7820 . . 151 1364 100.00 . . . 0.1855 . 0.1722 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7820 1.8301 . . 141 1400 100.00 . . . 0.1995 . 0.1646 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8301 1.8840 . . 133 1406 100.00 . . . 0.2067 . 0.1569 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8840 1.9448 . . 137 1397 100.00 . . . 0.1938 . 0.1621 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9448 2.0143 . . 169 1377 100.00 . . . 0.1839 . 0.1544 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0143 2.0949 . . 175 1358 100.00 . . . 0.1775 . 0.1559 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0949 2.1903 . . 136 1423 100.00 . . . 0.1827 . 0.1526 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1903 2.3058 . . 140 1427 100.00 . . . 0.1800 . 0.1466 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3058 2.4502 . . 146 1390 100.00 . . . 0.1942 . 0.1540 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4502 2.6393 . . 162 1419 100.00 . . . 0.1975 . 0.1581 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6393 2.9049 . . 167 1411 100.00 . . . 0.1995 . 0.1602 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9049 3.3251 . . 156 1425 100.00 . . . 0.1711 . 0.1576 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3251 4.1886 . . 159 1464 100.00 . . . 0.1833 . 0.1438 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.1886 40.7479 . . 169 1573 100.00 . . . 0.1668 . 0.1491 . . . . . . . . . . # _struct.entry_id 4XF4 _struct.title 'Cysteine dioxygenase at pH 8.0 in complex with homocysteine' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4XF4 _struct_keywords.text 'Cupin Fold, cysteine to cysteine sulfinic acid catalysis, thiol dioxygenase, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.db_code CDO1_RAT _struct_ref.db_name UNP _struct_ref.details ? _struct_ref.entity_id 1 _struct_ref.id 1 _struct_ref.seq_align ? _struct_ref.seq_dif ? _struct_ref.pdbx_db_accession P21816 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ;MERTELLKPRTLADLIRILHELFAGDEVNVEEVQAVLEAYESNPAEWALYAKFDQYRYTRNLVDQGNGKFNLMILCWGEG HGSSIHDHTDSHCFLKLLQGNLKETLFDWPDKKSNEMIKKSERTLRENQCAYINDSIGLHRVENVSHTEPAVSLHLYSPP FDTCHAFDQRTGHKNKVTMTFHSKFGIRTPFTTSGSLENN ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_align_end ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4XF4 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 200 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P21816 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 200 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 200 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 9470 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 11 ? PHE A 23 ? THR A 11 PHE A 23 1 ? 13 HELX_P HELX_P2 AA2 ASN A 29 ? TYR A 40 ? ASN A 29 TYR A 40 1 ? 12 HELX_P HELX_P3 AA3 ASN A 43 ? ALA A 48 ? ASN A 43 ALA A 48 1 ? 6 HELX_P HELX_P4 AA4 LEU A 49 ? ALA A 51 ? LEU A 49 ALA A 51 5 ? 3 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 93 SG ? ? ? 1_555 A TYR 157 CE2 ? ? A CYS 93 A TYR 157 1_555 ? ? ? ? ? ? ? 1.794 ? ? metalc1 metalc ? ? A HIS 86 NE2 ? ? ? 1_555 B FE . FE ? ? A HIS 86 A FE 501 1_555 ? ? ? ? ? ? ? 2.048 ? ? metalc2 metalc ? ? A HIS 88 NE2 ? ? ? 1_555 B FE . FE ? ? A HIS 88 A FE 501 1_555 ? ? ? ? ? ? ? 2.123 ? ? metalc3 metalc ? ? A HIS 140 NE2 ? ? ? 1_555 B FE . FE ? ? A HIS 140 A FE 501 1_555 ? ? ? ? ? ? ? 2.038 ? ? metalc4 metalc ? ? B FE . FE ? ? ? 1_555 C HCS . SD ? ? A FE 501 A HCS 502 1_555 ? ? ? ? ? ? ? 2.136 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 99.6 ? 2 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 97.3 ? 3 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 97.8 ? 4 NE2 ? A HIS 86 ? A HIS 86 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 SD ? C HCS . ? A HCS 502 ? 1_555 119.7 ? 5 NE2 ? A HIS 88 ? A HIS 88 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 SD ? C HCS . ? A HCS 502 ? 1_555 123.6 ? 6 NE2 ? A HIS 140 ? A HIS 140 ? 1_555 FE ? B FE . ? A FE 501 ? 1_555 SD ? C HCS . ? A HCS 502 ? 1_555 113.8 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 158 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 158 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 159 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 159 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.92 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 3 ? AA3 ? 3 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 CYS A 130 ? ILE A 133 ? CYS A 130 ILE A 133 AA1 2 HIS A 92 ? GLN A 99 ? HIS A 92 GLN A 99 AA1 3 ALA A 151 ? SER A 158 ? ALA A 151 SER A 158 AA1 4 ASN A 71 ? TRP A 77 ? ASN A 71 TRP A 77 AA1 5 THR A 59 ? ASP A 64 ? THR A 59 ASP A 64 AA1 6 SER A 183 ? LYS A 184 ? SER A 183 LYS A 184 AA1 7 ILE A 187 ? ARG A 188 ? ILE A 187 ARG A 188 AA2 1 ILE A 85 ? HIS A 86 ? ILE A 85 HIS A 86 AA2 2 THR A 163 ? PHE A 167 ? THR A 163 PHE A 167 AA2 3 LYS A 174 ? THR A 178 ? LYS A 174 THR A 178 AA3 1 LYS A 119 ? LEU A 125 ? LYS A 119 LEU A 125 AA3 2 LEU A 102 ? PHE A 107 ? LEU A 102 PHE A 107 AA3 3 LEU A 139 ? GLU A 143 ? LEU A 139 GLU A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 131 ? O ALA A 131 N LEU A 95 ? N LEU A 95 AA1 2 3 N LYS A 96 ? N LYS A 96 O LEU A 154 ? O LEU A 154 AA1 3 4 O HIS A 155 ? O HIS A 155 N MET A 73 ? N MET A 73 AA1 4 5 O LEU A 72 ? O LEU A 72 N VAL A 63 ? N VAL A 63 AA1 5 6 N LEU A 62 ? N LEU A 62 O SER A 183 ? O SER A 183 AA1 6 7 N LYS A 184 ? N LYS A 184 O ILE A 187 ? O ILE A 187 AA2 1 2 N ILE A 85 ? N ILE A 85 O PHE A 167 ? O PHE A 167 AA2 2 3 N CYS A 164 ? N CYS A 164 O VAL A 177 ? O VAL A 177 AA3 1 2 O LEU A 125 ? O LEU A 125 N LEU A 102 ? N LEU A 102 AA3 2 3 N LYS A 103 ? N LYS A 103 O GLU A 143 ? O GLU A 143 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A FE 501 ? 4 'binding site for residue FE A 501' AC2 Software A HCS 502 ? 10 'binding site for residue HCS A 502' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 86 ? HIS A 86 . ? 1_555 ? 2 AC1 4 HIS A 88 ? HIS A 88 . ? 1_555 ? 3 AC1 4 HIS A 140 ? HIS A 140 . ? 1_555 ? 4 AC1 4 HCS C . ? HCS A 502 . ? 1_555 ? 5 AC2 10 TYR A 58 ? TYR A 58 . ? 1_555 ? 6 AC2 10 ARG A 60 ? ARG A 60 . ? 1_555 ? 7 AC2 10 LEU A 75 ? LEU A 75 . ? 1_555 ? 8 AC2 10 HIS A 86 ? HIS A 86 . ? 1_555 ? 9 AC2 10 HIS A 140 ? HIS A 140 . ? 1_555 ? 10 AC2 10 HIS A 155 ? HIS A 155 . ? 1_555 ? 11 AC2 10 TYR A 157 ? TYR A 157 . ? 1_555 ? 12 AC2 10 MET A 179 ? MET A 179 . ? 1_555 ? 13 AC2 10 FE B . ? FE A 501 . ? 1_555 ? 14 AC2 10 HOH D . ? HOH A 767 . ? 1_555 ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASN _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 128 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 74.64 _pdbx_validate_torsion.psi -9.57 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 841 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -17.2038 _pdbx_refine_tls.origin_y 3.0968 _pdbx_refine_tls.origin_z -49.5634 _pdbx_refine_tls.T[1][1] 0.0598 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] -0.0003 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] -0.0024 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0824 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0029 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0720 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 0.9164 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] 0.4312 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] -0.1857 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.8816 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] 0.0919 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 0.8067 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] 0.0209 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0105 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] -0.0385 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] 0.0262 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0139 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0096 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0443 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] -0.0336 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] -0.0003 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ;chain 'A' and resid 5 through 190 ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A GLU 2 ? A GLU 2 3 1 Y 1 A ARG 3 ? A ARG 3 4 1 Y 1 A THR 4 ? A THR 4 5 1 Y 1 A PHE 191 ? A PHE 191 6 1 Y 1 A THR 192 ? A THR 192 7 1 Y 1 A THR 193 ? A THR 193 8 1 Y 1 A SER 194 ? A SER 194 9 1 Y 1 A GLY 195 ? A GLY 195 10 1 Y 1 A SER 196 ? A SER 196 11 1 Y 1 A LEU 197 ? A LEU 197 12 1 Y 1 A GLU 198 ? A GLU 198 13 1 Y 1 A ASN 199 ? A ASN 199 14 1 Y 1 A ASN 200 ? A ASN 200 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 FE FE FE N N 88 GLN N N N N 89 GLN CA C N S 90 GLN C C N N 91 GLN O O N N 92 GLN CB C N N 93 GLN CG C N N 94 GLN CD C N N 95 GLN OE1 O N N 96 GLN NE2 N N N 97 GLN OXT O N N 98 GLN H H N N 99 GLN H2 H N N 100 GLN HA H N N 101 GLN HB2 H N N 102 GLN HB3 H N N 103 GLN HG2 H N N 104 GLN HG3 H N N 105 GLN HE21 H N N 106 GLN HE22 H N N 107 GLN HXT H N N 108 GLU N N N N 109 GLU CA C N S 110 GLU C C N N 111 GLU O O N N 112 GLU CB C N N 113 GLU CG C N N 114 GLU CD C N N 115 GLU OE1 O N N 116 GLU OE2 O N N 117 GLU OXT O N N 118 GLU H H N N 119 GLU H2 H N N 120 GLU HA H N N 121 GLU HB2 H N N 122 GLU HB3 H N N 123 GLU HG2 H N N 124 GLU HG3 H N N 125 GLU HE2 H N N 126 GLU HXT H N N 127 GLY N N N N 128 GLY CA C N N 129 GLY C C N N 130 GLY O O N N 131 GLY OXT O N N 132 GLY H H N N 133 GLY H2 H N N 134 GLY HA2 H N N 135 GLY HA3 H N N 136 GLY HXT H N N 137 HCS N N N N 138 HCS CA C N S 139 HCS CB C N N 140 HCS CG C N N 141 HCS SD S N N 142 HCS C C N N 143 HCS OXT O N N 144 HCS O O N N 145 HCS H H N N 146 HCS H2 H N N 147 HCS HA H N N 148 HCS HB2 H N N 149 HCS HB3 H N N 150 HCS HG2 H N N 151 HCS HG3 H N N 152 HCS HD H N N 153 HCS HXT H N N 154 HIS N N N N 155 HIS CA C N S 156 HIS C C N N 157 HIS O O N N 158 HIS CB C N N 159 HIS CG C Y N 160 HIS ND1 N Y N 161 HIS CD2 C Y N 162 HIS CE1 C Y N 163 HIS NE2 N Y N 164 HIS OXT O N N 165 HIS H H N N 166 HIS H2 H N N 167 HIS HA H N N 168 HIS HB2 H N N 169 HIS HB3 H N N 170 HIS HD1 H N N 171 HIS HD2 H N N 172 HIS HE1 H N N 173 HIS HE2 H N N 174 HIS HXT H N N 175 HOH O O N N 176 HOH H1 H N N 177 HOH H2 H N N 178 ILE N N N N 179 ILE CA C N S 180 ILE C C N N 181 ILE O O N N 182 ILE CB C N S 183 ILE CG1 C N N 184 ILE CG2 C N N 185 ILE CD1 C N N 186 ILE OXT O N N 187 ILE H H N N 188 ILE H2 H N N 189 ILE HA H N N 190 ILE HB H N N 191 ILE HG12 H N N 192 ILE HG13 H N N 193 ILE HG21 H N N 194 ILE HG22 H N N 195 ILE HG23 H N N 196 ILE HD11 H N N 197 ILE HD12 H N N 198 ILE HD13 H N N 199 ILE HXT H N N 200 LEU N N N N 201 LEU CA C N S 202 LEU C C N N 203 LEU O O N N 204 LEU CB C N N 205 LEU CG C N N 206 LEU CD1 C N N 207 LEU CD2 C N N 208 LEU OXT O N N 209 LEU H H N N 210 LEU H2 H N N 211 LEU HA H N N 212 LEU HB2 H N N 213 LEU HB3 H N N 214 LEU HG H N N 215 LEU HD11 H N N 216 LEU HD12 H N N 217 LEU HD13 H N N 218 LEU HD21 H N N 219 LEU HD22 H N N 220 LEU HD23 H N N 221 LEU HXT H N N 222 LYS N N N N 223 LYS CA C N S 224 LYS C C N N 225 LYS O O N N 226 LYS CB C N N 227 LYS CG C N N 228 LYS CD C N N 229 LYS CE C N N 230 LYS NZ N N N 231 LYS OXT O N N 232 LYS H H N N 233 LYS H2 H N N 234 LYS HA H N N 235 LYS HB2 H N N 236 LYS HB3 H N N 237 LYS HG2 H N N 238 LYS HG3 H N N 239 LYS HD2 H N N 240 LYS HD3 H N N 241 LYS HE2 H N N 242 LYS HE3 H N N 243 LYS HZ1 H N N 244 LYS HZ2 H N N 245 LYS HZ3 H N N 246 LYS HXT H N N 247 MET N N N N 248 MET CA C N S 249 MET C C N N 250 MET O O N N 251 MET CB C N N 252 MET CG C N N 253 MET SD S N N 254 MET CE C N N 255 MET OXT O N N 256 MET H H N N 257 MET H2 H N N 258 MET HA H N N 259 MET HB2 H N N 260 MET HB3 H N N 261 MET HG2 H N N 262 MET HG3 H N N 263 MET HE1 H N N 264 MET HE2 H N N 265 MET HE3 H N N 266 MET HXT H N N 267 PHE N N N N 268 PHE CA C N S 269 PHE C C N N 270 PHE O O N N 271 PHE CB C N N 272 PHE CG C Y N 273 PHE CD1 C Y N 274 PHE CD2 C Y N 275 PHE CE1 C Y N 276 PHE CE2 C Y N 277 PHE CZ C Y N 278 PHE OXT O N N 279 PHE H H N N 280 PHE H2 H N N 281 PHE HA H N N 282 PHE HB2 H N N 283 PHE HB3 H N N 284 PHE HD1 H N N 285 PHE HD2 H N N 286 PHE HE1 H N N 287 PHE HE2 H N N 288 PHE HZ H N N 289 PHE HXT H N N 290 PRO N N N N 291 PRO CA C N S 292 PRO C C N N 293 PRO O O N N 294 PRO CB C N N 295 PRO CG C N N 296 PRO CD C N N 297 PRO OXT O N N 298 PRO H H N N 299 PRO HA H N N 300 PRO HB2 H N N 301 PRO HB3 H N N 302 PRO HG2 H N N 303 PRO HG3 H N N 304 PRO HD2 H N N 305 PRO HD3 H N N 306 PRO HXT H N N 307 SER N N N N 308 SER CA C N S 309 SER C C N N 310 SER O O N N 311 SER CB C N N 312 SER OG O N N 313 SER OXT O N N 314 SER H H N N 315 SER H2 H N N 316 SER HA H N N 317 SER HB2 H N N 318 SER HB3 H N N 319 SER HG H N N 320 SER HXT H N N 321 THR N N N N 322 THR CA C N S 323 THR C C N N 324 THR O O N N 325 THR CB C N R 326 THR OG1 O N N 327 THR CG2 C N N 328 THR OXT O N N 329 THR H H N N 330 THR H2 H N N 331 THR HA H N N 332 THR HB H N N 333 THR HG1 H N N 334 THR HG21 H N N 335 THR HG22 H N N 336 THR HG23 H N N 337 THR HXT H N N 338 TRP N N N N 339 TRP CA C N S 340 TRP C C N N 341 TRP O O N N 342 TRP CB C N N 343 TRP CG C Y N 344 TRP CD1 C Y N 345 TRP CD2 C Y N 346 TRP NE1 N Y N 347 TRP CE2 C Y N 348 TRP CE3 C Y N 349 TRP CZ2 C Y N 350 TRP CZ3 C Y N 351 TRP CH2 C Y N 352 TRP OXT O N N 353 TRP H H N N 354 TRP H2 H N N 355 TRP HA H N N 356 TRP HB2 H N N 357 TRP HB3 H N N 358 TRP HD1 H N N 359 TRP HE1 H N N 360 TRP HE3 H N N 361 TRP HZ2 H N N 362 TRP HZ3 H N N 363 TRP HH2 H N N 364 TRP HXT H N N 365 TYR N N N N 366 TYR CA C N S 367 TYR C C N N 368 TYR O O N N 369 TYR CB C N N 370 TYR CG C Y N 371 TYR CD1 C Y N 372 TYR CD2 C Y N 373 TYR CE1 C Y N 374 TYR CE2 C Y N 375 TYR CZ C Y N 376 TYR OH O N N 377 TYR OXT O N N 378 TYR H H N N 379 TYR H2 H N N 380 TYR HA H N N 381 TYR HB2 H N N 382 TYR HB3 H N N 383 TYR HD1 H N N 384 TYR HD2 H N N 385 TYR HE1 H N N 386 TYR HE2 H N N 387 TYR HH H N N 388 TYR HXT H N N 389 VAL N N N N 390 VAL CA C N S 391 VAL C C N N 392 VAL O O N N 393 VAL CB C N N 394 VAL CG1 C N N 395 VAL CG2 C N N 396 VAL OXT O N N 397 VAL H H N N 398 VAL H2 H N N 399 VAL HA H N N 400 VAL HB H N N 401 VAL HG11 H N N 402 VAL HG12 H N N 403 VAL HG13 H N N 404 VAL HG21 H N N 405 VAL HG22 H N N 406 VAL HG23 H N N 407 VAL HXT H N N 408 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HCS N CA sing N N 129 HCS N H sing N N 130 HCS N H2 sing N N 131 HCS CA CB sing N N 132 HCS CA C sing N N 133 HCS CA HA sing N N 134 HCS CB CG sing N N 135 HCS CB HB2 sing N N 136 HCS CB HB3 sing N N 137 HCS CG SD sing N N 138 HCS CG HG2 sing N N 139 HCS CG HG3 sing N N 140 HCS SD HD sing N N 141 HCS C OXT sing N N 142 HCS C O doub N N 143 HCS OXT HXT sing N N 144 HIS N CA sing N N 145 HIS N H sing N N 146 HIS N H2 sing N N 147 HIS CA C sing N N 148 HIS CA CB sing N N 149 HIS CA HA sing N N 150 HIS C O doub N N 151 HIS C OXT sing N N 152 HIS CB CG sing N N 153 HIS CB HB2 sing N N 154 HIS CB HB3 sing N N 155 HIS CG ND1 sing Y N 156 HIS CG CD2 doub Y N 157 HIS ND1 CE1 doub Y N 158 HIS ND1 HD1 sing N N 159 HIS CD2 NE2 sing Y N 160 HIS CD2 HD2 sing N N 161 HIS CE1 NE2 sing Y N 162 HIS CE1 HE1 sing N N 163 HIS NE2 HE2 sing N N 164 HIS OXT HXT sing N N 165 HOH O H1 sing N N 166 HOH O H2 sing N N 167 ILE N CA sing N N 168 ILE N H sing N N 169 ILE N H2 sing N N 170 ILE CA C sing N N 171 ILE CA CB sing N N 172 ILE CA HA sing N N 173 ILE C O doub N N 174 ILE C OXT sing N N 175 ILE CB CG1 sing N N 176 ILE CB CG2 sing N N 177 ILE CB HB sing N N 178 ILE CG1 CD1 sing N N 179 ILE CG1 HG12 sing N N 180 ILE CG1 HG13 sing N N 181 ILE CG2 HG21 sing N N 182 ILE CG2 HG22 sing N N 183 ILE CG2 HG23 sing N N 184 ILE CD1 HD11 sing N N 185 ILE CD1 HD12 sing N N 186 ILE CD1 HD13 sing N N 187 ILE OXT HXT sing N N 188 LEU N CA sing N N 189 LEU N H sing N N 190 LEU N H2 sing N N 191 LEU CA C sing N N 192 LEU CA CB sing N N 193 LEU CA HA sing N N 194 LEU C O doub N N 195 LEU C OXT sing N N 196 LEU CB CG sing N N 197 LEU CB HB2 sing N N 198 LEU CB HB3 sing N N 199 LEU CG CD1 sing N N 200 LEU CG CD2 sing N N 201 LEU CG HG sing N N 202 LEU CD1 HD11 sing N N 203 LEU CD1 HD12 sing N N 204 LEU CD1 HD13 sing N N 205 LEU CD2 HD21 sing N N 206 LEU CD2 HD22 sing N N 207 LEU CD2 HD23 sing N N 208 LEU OXT HXT sing N N 209 LYS N CA sing N N 210 LYS N H sing N N 211 LYS N H2 sing N N 212 LYS CA C sing N N 213 LYS CA CB sing N N 214 LYS CA HA sing N N 215 LYS C O doub N N 216 LYS C OXT sing N N 217 LYS CB CG sing N N 218 LYS CB HB2 sing N N 219 LYS CB HB3 sing N N 220 LYS CG CD sing N N 221 LYS CG HG2 sing N N 222 LYS CG HG3 sing N N 223 LYS CD CE sing N N 224 LYS CD HD2 sing N N 225 LYS CD HD3 sing N N 226 LYS CE NZ sing N N 227 LYS CE HE2 sing N N 228 LYS CE HE3 sing N N 229 LYS NZ HZ1 sing N N 230 LYS NZ HZ2 sing N N 231 LYS NZ HZ3 sing N N 232 LYS OXT HXT sing N N 233 MET N CA sing N N 234 MET N H sing N N 235 MET N H2 sing N N 236 MET CA C sing N N 237 MET CA CB sing N N 238 MET CA HA sing N N 239 MET C O doub N N 240 MET C OXT sing N N 241 MET CB CG sing N N 242 MET CB HB2 sing N N 243 MET CB HB3 sing N N 244 MET CG SD sing N N 245 MET CG HG2 sing N N 246 MET CG HG3 sing N N 247 MET SD CE sing N N 248 MET CE HE1 sing N N 249 MET CE HE2 sing N N 250 MET CE HE3 sing N N 251 MET OXT HXT sing N N 252 PHE N CA sing N N 253 PHE N H sing N N 254 PHE N H2 sing N N 255 PHE CA C sing N N 256 PHE CA CB sing N N 257 PHE CA HA sing N N 258 PHE C O doub N N 259 PHE C OXT sing N N 260 PHE CB CG sing N N 261 PHE CB HB2 sing N N 262 PHE CB HB3 sing N N 263 PHE CG CD1 doub Y N 264 PHE CG CD2 sing Y N 265 PHE CD1 CE1 sing Y N 266 PHE CD1 HD1 sing N N 267 PHE CD2 CE2 doub Y N 268 PHE CD2 HD2 sing N N 269 PHE CE1 CZ doub Y N 270 PHE CE1 HE1 sing N N 271 PHE CE2 CZ sing Y N 272 PHE CE2 HE2 sing N N 273 PHE CZ HZ sing N N 274 PHE OXT HXT sing N N 275 PRO N CA sing N N 276 PRO N CD sing N N 277 PRO N H sing N N 278 PRO CA C sing N N 279 PRO CA CB sing N N 280 PRO CA HA sing N N 281 PRO C O doub N N 282 PRO C OXT sing N N 283 PRO CB CG sing N N 284 PRO CB HB2 sing N N 285 PRO CB HB3 sing N N 286 PRO CG CD sing N N 287 PRO CG HG2 sing N N 288 PRO CG HG3 sing N N 289 PRO CD HD2 sing N N 290 PRO CD HD3 sing N N 291 PRO OXT HXT sing N N 292 SER N CA sing N N 293 SER N H sing N N 294 SER N H2 sing N N 295 SER CA C sing N N 296 SER CA CB sing N N 297 SER CA HA sing N N 298 SER C O doub N N 299 SER C OXT sing N N 300 SER CB OG sing N N 301 SER CB HB2 sing N N 302 SER CB HB3 sing N N 303 SER OG HG sing N N 304 SER OXT HXT sing N N 305 THR N CA sing N N 306 THR N H sing N N 307 THR N H2 sing N N 308 THR CA C sing N N 309 THR CA CB sing N N 310 THR CA HA sing N N 311 THR C O doub N N 312 THR C OXT sing N N 313 THR CB OG1 sing N N 314 THR CB CG2 sing N N 315 THR CB HB sing N N 316 THR OG1 HG1 sing N N 317 THR CG2 HG21 sing N N 318 THR CG2 HG22 sing N N 319 THR CG2 HG23 sing N N 320 THR OXT HXT sing N N 321 TRP N CA sing N N 322 TRP N H sing N N 323 TRP N H2 sing N N 324 TRP CA C sing N N 325 TRP CA CB sing N N 326 TRP CA HA sing N N 327 TRP C O doub N N 328 TRP C OXT sing N N 329 TRP CB CG sing N N 330 TRP CB HB2 sing N N 331 TRP CB HB3 sing N N 332 TRP CG CD1 doub Y N 333 TRP CG CD2 sing Y N 334 TRP CD1 NE1 sing Y N 335 TRP CD1 HD1 sing N N 336 TRP CD2 CE2 doub Y N 337 TRP CD2 CE3 sing Y N 338 TRP NE1 CE2 sing Y N 339 TRP NE1 HE1 sing N N 340 TRP CE2 CZ2 sing Y N 341 TRP CE3 CZ3 doub Y N 342 TRP CE3 HE3 sing N N 343 TRP CZ2 CH2 doub Y N 344 TRP CZ2 HZ2 sing N N 345 TRP CZ3 CH2 sing Y N 346 TRP CZ3 HZ3 sing N N 347 TRP CH2 HH2 sing N N 348 TRP OXT HXT sing N N 349 TYR N CA sing N N 350 TYR N H sing N N 351 TYR N H2 sing N N 352 TYR CA C sing N N 353 TYR CA CB sing N N 354 TYR CA HA sing N N 355 TYR C O doub N N 356 TYR C OXT sing N N 357 TYR CB CG sing N N 358 TYR CB HB2 sing N N 359 TYR CB HB3 sing N N 360 TYR CG CD1 doub Y N 361 TYR CG CD2 sing Y N 362 TYR CD1 CE1 sing Y N 363 TYR CD1 HD1 sing N N 364 TYR CD2 CE2 doub Y N 365 TYR CD2 HD2 sing N N 366 TYR CE1 CZ doub Y N 367 TYR CE1 HE1 sing N N 368 TYR CE2 CZ sing Y N 369 TYR CE2 HE2 sing N N 370 TYR CZ OH sing N N 371 TYR OH HH sing N N 372 TYR OXT HXT sing N N 373 VAL N CA sing N N 374 VAL N H sing N N 375 VAL N H2 sing N N 376 VAL CA C sing N N 377 VAL CA CB sing N N 378 VAL CA HA sing N N 379 VAL C O doub N N 380 VAL C OXT sing N N 381 VAL CB CG1 sing N N 382 VAL CB CG2 sing N N 383 VAL CB HB sing N N 384 VAL CG1 HG11 sing N N 385 VAL CG1 HG12 sing N N 386 VAL CG1 HG13 sing N N 387 VAL CG2 HG21 sing N N 388 VAL CG2 HG22 sing N N 389 VAL CG2 HG23 sing N N 390 VAL OXT HXT sing N N 391 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of Diabetes and Digestive and Kidney Disease (NIH/NIDDK)' 'United States' NIH-DK-056649 1 'Department of Energy (DOE, United States)' 'United States' DE-AC02-98CH10886 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4IEU _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 4XF4 _atom_sites.fract_transf_matrix[1][1] 0.017361 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017361 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008170 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_