data_4XPV # _entry.id 4XPV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4XPV pdb_00004xpv 10.2210/pdb4xpv/pdb WWPDB D_1000206088 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4XPV _pdbx_database_status.recvd_initial_deposition_date 2015-01-18 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wan, Q.' 1 'Park, J.M.' 2 'Riccardi, D.M.' 3 'Hanson, L.B.' 4 'Fisher, Z.' 5 'Smith, J.C.' 6 'Ostermann, A.' 7 'Schrader, T.' 8 'Graham, D.E.' 9 'Coates, L.' 10 'Langan, P.' 11 'Kovalevsky, A.Y.' 12 # loop_ _citation.abstract _citation.abstract_id_CAS _citation.book_id_ISBN _citation.book_publisher _citation.book_publisher_city _citation.book_title _citation.coordinate_linkage _citation.country _citation.database_id_Medline _citation.details _citation.id _citation.journal_abbrev _citation.journal_id_ASTM _citation.journal_id_CSD _citation.journal_id_ISSN _citation.journal_full _citation.journal_issue _citation.journal_volume _citation.language _citation.page_first _citation.page_last _citation.title _citation.year _citation.database_id_CSD _citation.pdbx_database_id_DOI _citation.pdbx_database_id_PubMed _citation.unpublished_flag ? ? ? ? ? ? ? US ? ? primary Proc.Natl.Acad.Sci.USA PNASA6 0040 1091-6490 ? ? 112 ? 12384 12389 ;Direct determination of protonation states and visualization of hydrogen bonding in a glycoside hydrolase with neutron crystallography. ; 2015 ? 10.1073/pnas.1504986112 26392527 ? ? ? ? ? ? ? ? DK ? ? 1 'Acta Crystallogr.,Sect.F' ? ? 1744-3091 ? ? 67 ? 283 286 ;Preliminary joint X-ray and neutron protein crystallographic studies of endoxylanase II from the fungus Trichoderma longibrachiatum. ; 2011 ? 10.1107/S174430911005075X 21301107 ? ? ? ? ? ? ? ? US ? ? 2 'Acta Crystallogr.,Sect.D' ABCRE6 ? 1399-0047 ? ? 70 ? 11 23 'X-ray crystallographic studies of family 11 xylanase Michaelis and product complexes: implications for the catalytic mechanism.' 2014 ? 10.1107/S1399004713023626 24419374 ? ? ? ? ? ? ? ? DK ? ? 3 'Acta Crystallogr.,Sect.F' ? ? 1744-3091 ? ? 69 ? 320 323 ;Heterologous expression, purification, crystallization and preliminary X-ray analysis of Trichoderma reesei xylanase II and four variants. ; 2013 ? 10.1107/S1744309113001164 23519813 ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wan, Q.' 1 ? primary 'Parks, J.M.' 2 ? primary 'Hanson, B.L.' 3 ? primary 'Fisher, S.Z.' 4 ? primary 'Ostermann, A.' 5 ? primary 'Schrader, T.E.' 6 ? primary 'Graham, D.E.' 7 ? primary 'Coates, L.' 8 ? primary 'Langan, P.' 9 ? primary 'Kovalevsky, A.' 10 ? 1 'Kovalevsky, A.Y.' 11 ? 1 'Hanson, B.L.' 12 ? 1 'Seaver, S.' 13 ? 1 'Fisher, S.Z.' 14 ? 1 'Mustyakimov, M.' 15 ? 1 'Langan, P.' 16 ? 2 'Wan, Q.' 17 ? 2 'Zhang, Q.' 18 ? 2 'Hamilton-Brehm, S.' 19 ? 2 'Weiss, K.' 20 ? 2 'Mustyakimov, M.' 21 ? 2 'Coates, L.' 22 ? 2 'Langan, P.' 23 ? 2 'Graham, D.' 24 ? 2 'Kovalevsky, A.' 25 ? 3 'Wan, Q.' 26 ? 3 'Kovalevsky, A.' 27 ? 3 'Zhang, Q.' 28 ? 3 'Hamilton-Brehm, S.' 29 ? 3 'Upton, R.' 30 ? 3 'Weiss, K.L.' 31 ? 3 'Mustyakimov, M.' 32 ? 3 'Graham, D.' 33 ? 3 'Coates, L.' 34 ? 3 'Langan, P.' 35 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 4XPV _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.194 _cell.length_a_esd ? _cell.length_b 60.287 _cell.length_b_esd ? _cell.length_c 70.520 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4XPV _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Endo-1,4-beta-xylanase 2' 20728.322 1 3.2.1.8 N44D ? ? 2 non-polymer syn 'IODIDE ION' 126.904 3 ? ? ? ? 3 water nat water 18.015 173 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Xylanase 2,1,4-beta-D-xylan xylanohydrolase 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGDFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSR NPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQ QGLTLGTMDYQIVAVEGYFSSGSASITVS ; _entity_poly.pdbx_seq_one_letter_code_can ;TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGDFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSR NPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQ QGLTLGTMDYQIVAVEGYFSSGSASITVS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 ILE n 1 3 GLN n 1 4 PRO n 1 5 GLY n 1 6 THR n 1 7 GLY n 1 8 TYR n 1 9 ASN n 1 10 ASN n 1 11 GLY n 1 12 TYR n 1 13 PHE n 1 14 TYR n 1 15 SER n 1 16 TYR n 1 17 TRP n 1 18 ASN n 1 19 ASP n 1 20 GLY n 1 21 HIS n 1 22 GLY n 1 23 GLY n 1 24 VAL n 1 25 THR n 1 26 TYR n 1 27 THR n 1 28 ASN n 1 29 GLY n 1 30 PRO n 1 31 GLY n 1 32 GLY n 1 33 GLN n 1 34 PHE n 1 35 SER n 1 36 VAL n 1 37 ASN n 1 38 TRP n 1 39 SER n 1 40 ASN n 1 41 SER n 1 42 GLY n 1 43 ASP n 1 44 PHE n 1 45 VAL n 1 46 GLY n 1 47 GLY n 1 48 LYS n 1 49 GLY n 1 50 TRP n 1 51 GLN n 1 52 PRO n 1 53 GLY n 1 54 THR n 1 55 LYS n 1 56 ASN n 1 57 LYS n 1 58 VAL n 1 59 ILE n 1 60 ASN n 1 61 PHE n 1 62 SER n 1 63 GLY n 1 64 SER n 1 65 TYR n 1 66 ASN n 1 67 PRO n 1 68 ASN n 1 69 GLY n 1 70 ASN n 1 71 SER n 1 72 TYR n 1 73 LEU n 1 74 SER n 1 75 VAL n 1 76 TYR n 1 77 GLY n 1 78 TRP n 1 79 SER n 1 80 ARG n 1 81 ASN n 1 82 PRO n 1 83 LEU n 1 84 ILE n 1 85 GLU n 1 86 TYR n 1 87 TYR n 1 88 ILE n 1 89 VAL n 1 90 GLU n 1 91 ASN n 1 92 PHE n 1 93 GLY n 1 94 THR n 1 95 TYR n 1 96 ASN n 1 97 PRO n 1 98 SER n 1 99 THR n 1 100 GLY n 1 101 ALA n 1 102 THR n 1 103 LYS n 1 104 LEU n 1 105 GLY n 1 106 GLU n 1 107 VAL n 1 108 THR n 1 109 SER n 1 110 ASP n 1 111 GLY n 1 112 SER n 1 113 VAL n 1 114 TYR n 1 115 ASP n 1 116 ILE n 1 117 TYR n 1 118 ARG n 1 119 THR n 1 120 GLN n 1 121 ARG n 1 122 VAL n 1 123 ASN n 1 124 GLN n 1 125 PRO n 1 126 SER n 1 127 ILE n 1 128 ILE n 1 129 GLY n 1 130 THR n 1 131 ALA n 1 132 THR n 1 133 PHE n 1 134 TYR n 1 135 GLN n 1 136 TYR n 1 137 TRP n 1 138 SER n 1 139 VAL n 1 140 ARG n 1 141 ARG n 1 142 ASN n 1 143 HIS n 1 144 ARG n 1 145 SER n 1 146 SER n 1 147 GLY n 1 148 SER n 1 149 VAL n 1 150 ASN n 1 151 THR n 1 152 ALA n 1 153 ASN n 1 154 HIS n 1 155 PHE n 1 156 ASN n 1 157 ALA n 1 158 TRP n 1 159 ALA n 1 160 GLN n 1 161 GLN n 1 162 GLY n 1 163 LEU n 1 164 THR n 1 165 LEU n 1 166 GLY n 1 167 THR n 1 168 MET n 1 169 ASP n 1 170 TYR n 1 171 GLN n 1 172 ILE n 1 173 VAL n 1 174 ALA n 1 175 VAL n 1 176 GLU n 1 177 GLY n 1 178 TYR n 1 179 PHE n 1 180 SER n 1 181 SER n 1 182 GLY n 1 183 SER n 1 184 ALA n 1 185 SER n 1 186 ILE n 1 187 THR n 1 188 VAL n 1 189 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 189 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene xyn2 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hypocrea jecorina' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 51453 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 511693 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BL21-Gold _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pJexpress401 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code XYN2_HYPJE _struct_ref.pdbx_db_accession P36217 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TIQPGTGYNNGYFYSYWNDGHGGVTYTNGPGGQFSVNWSNSGNFVGGKGWQPGTKNKVINFSGSYNPNGNSYLSVYGWSR NPLIEYYIVENFGTYNPSTGATKLGEVTSDGSVYDIYRTQRVNQPSIIGTATFYQYWSVRRNHRSSGSVNTANHFNAWAQ QGLTLGTMDYQIVAVEGYFSSGSASITVS ; _struct_ref.pdbx_align_begin 34 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4XPV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 189 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P36217 _struct_ref_seq.db_align_beg 34 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 222 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 190 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4XPV _struct_ref_seq_dif.mon_id ASP _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 43 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P36217 _struct_ref_seq_dif.db_mon_id ASN _struct_ref_seq_dif.pdbx_seq_db_seq_num 76 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 44 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 DOD non-polymer . 'DEUTERATED WATER' ? 'D2 O' 20.028 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 IOD non-polymer . 'IODIDE ION' ? 'I -1' 126.904 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _exptl.absorpt_coefficient_mu _exptl.absorpt_correction_T_max _exptl.absorpt_correction_T_min _exptl.absorpt_correction_type _exptl.absorpt_process_details _exptl.entry_id _exptl.crystals_number _exptl.details _exptl.method _exptl.method_details ? ? ? ? ? 4XPV 1 ? 'X-RAY DIFFRACTION' ? ? ? ? ? ? 4XPV 2 ? 'NEUTRON DIFFRACTION' ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.52 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 51.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '16% PEG8000, 0.2 M NaI, 0.1 M HEPES at pH 7.0' _exptl_crystal_grow.pdbx_pH_range 6-7 # loop_ _diffrn.ambient_environment _diffrn.ambient_temp _diffrn.ambient_temp_details _diffrn.ambient_temp_esd _diffrn.crystal_id _diffrn.crystal_support _diffrn.crystal_treatment _diffrn.details _diffrn.id _diffrn.ambient_pressure _diffrn.ambient_pressure_esd _diffrn.ambient_pressure_gt _diffrn.ambient_pressure_lt _diffrn.ambient_temp_gt _diffrn.ambient_temp_lt ? 290 ? ? 1 ? ? ? 1 ? ? ? ? ? ? ? 290 ? ? 1 ? ? ? 2 ? ? ? ? ? ? # loop_ _diffrn_detector.details _diffrn_detector.detector _diffrn_detector.diffrn_id _diffrn_detector.type _diffrn_detector.area_resol_mean _diffrn_detector.dtime _diffrn_detector.pdbx_frames_total _diffrn_detector.pdbx_collection_time_total _diffrn_detector.pdbx_collection_date ? 'IMAGE PLATE' 1 'RIGAKU RAXIS IV++' ? ? ? ? 2013-03-27 ? 'AREA DETECTOR' 2 CUSTOM-MADE ? ? ? ? 2013-03-12 # loop_ _diffrn_radiation.collimation _diffrn_radiation.diffrn_id _diffrn_radiation.filter_edge _diffrn_radiation.inhomogeneity _diffrn_radiation.monochromator _diffrn_radiation.polarisn_norm _diffrn_radiation.polarisn_ratio _diffrn_radiation.probe _diffrn_radiation.type _diffrn_radiation.xray_symbol _diffrn_radiation.wavelength_id _diffrn_radiation.pdbx_monochromatic_or_laue_m_l _diffrn_radiation.pdbx_wavelength_list _diffrn_radiation.pdbx_wavelength _diffrn_radiation.pdbx_diffrn_protocol _diffrn_radiation.pdbx_analyzer _diffrn_radiation.pdbx_scattering_type ? 1 ? ? 'Ni Filter' ? ? ? ? ? 1 M ? ? 'SINGLE WAVELENGTH' ? x-ray ? 2 ? ? Chopper ? ? ? ? ? 2 L ? ? LAUE ? neutron # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.54 1.0 2 0.7 1.0 3 6.0 1.0 # loop_ _diffrn_source.current _diffrn_source.details _diffrn_source.diffrn_id _diffrn_source.power _diffrn_source.size _diffrn_source.source _diffrn_source.target _diffrn_source.type _diffrn_source.voltage _diffrn_source.take-off_angle _diffrn_source.pdbx_wavelength_list _diffrn_source.pdbx_wavelength _diffrn_source.pdbx_synchrotron_beamline _diffrn_source.pdbx_synchrotron_site ? ? 1 ? ? 'ROTATING ANODE' ? 'RIGAKU MICROMAX-007 HF' ? ? 1.54 ? ? ? ? ? 2 ? ? 'NUCLEAR REACTOR' ? 'LANSCE BEAMLINE PCS' ? ? 0.7-6.0 0.7-6.0 PCS LANSCE # loop_ _reflns.B_iso_Wilson_estimate _reflns.entry_id _reflns.data_reduction_details _reflns.data_reduction_method _reflns.d_resolution_high _reflns.d_resolution_low _reflns.details _reflns.limit_h_max _reflns.limit_h_min _reflns.limit_k_max _reflns.limit_k_min _reflns.limit_l_max _reflns.limit_l_min _reflns.number_all _reflns.number_obs _reflns.observed_criterion _reflns.observed_criterion_F_max _reflns.observed_criterion_F_min _reflns.observed_criterion_I_max _reflns.observed_criterion_I_min _reflns.observed_criterion_sigma_F _reflns.observed_criterion_sigma_I _reflns.percent_possible_obs _reflns.R_free_details _reflns.Rmerge_F_all _reflns.Rmerge_F_obs _reflns.Friedel_coverage _reflns.number_gt _reflns.threshold_expression _reflns.pdbx_redundancy _reflns.pdbx_Rmerge_I_obs _reflns.pdbx_Rmerge_I_all _reflns.pdbx_Rsym_value _reflns.pdbx_netI_over_av_sigmaI _reflns.pdbx_netI_over_sigmaI _reflns.pdbx_res_netI_over_av_sigmaI_2 _reflns.pdbx_res_netI_over_sigmaI_2 _reflns.pdbx_chi_squared _reflns.pdbx_scaling_rejects _reflns.pdbx_d_res_high_opt _reflns.pdbx_d_res_low_opt _reflns.pdbx_d_res_opt_method _reflns.phase_calculation_details _reflns.pdbx_Rrim_I_all _reflns.pdbx_Rpim_I_all _reflns.pdbx_d_opt _reflns.pdbx_number_measured_all _reflns.pdbx_diffrn_id _reflns.pdbx_ordinal _reflns.pdbx_CC_half _reflns.pdbx_R_split ? 4XPV ? ? 1.7 50.0 ? ? ? ? ? ? ? ? 22851 ? ? ? ? ? ? ? 96.2 ? ? ? ? ? ? 4.0 0.071 ? ? ? 13.40 ? ? ? ? ? ? ? ? ? ? ? ? 1 1 ? ? ? 4XPV ? ? 2.0 22.85 ? ? ? ? ? ? ? ? 12398 ? ? ? ? ? ? ? 85.5 ? ? ? ? ? ? 3.3 0.223 ? ? ? 5.00 ? ? ? ? ? ? ? ? ? ? ? ? 2 2 ? ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.7 1.76 ? ? ? ? ? ? ? ? 99.6 ? ? ? 0.468 ? ? ? ? ? ? ? ? 3.8 ? ? ? 2.8 ? ? ? 1 1 ? ? 2.0 2.11 ? ? ? ? ? ? ? ? 72.7 ? ? ? 0.369 ? ? ? ? ? ? ? ? 2.0 ? ? ? 1.6 ? ? ? 2 2 ? ? # loop_ _refine.pdbx_refine_id _refine.entry_id _refine.pdbx_diffrn_id _refine.pdbx_TLS_residual_ADP_flag _refine.ls_number_reflns_obs _refine.ls_number_reflns_all _refine.pdbx_ls_sigma_I _refine.pdbx_ls_sigma_F _refine.pdbx_data_cutoff_high_absF _refine.pdbx_data_cutoff_low_absF _refine.pdbx_data_cutoff_high_rms_absF _refine.ls_d_res_low _refine.ls_d_res_high _refine.ls_percent_reflns_obs _refine.ls_R_factor_obs _refine.ls_R_factor_all _refine.ls_R_factor_R_work _refine.ls_R_factor_R_free _refine.ls_R_factor_R_free_error _refine.ls_R_factor_R_free_error_details _refine.ls_percent_reflns_R_free _refine.ls_number_reflns_R_free _refine.ls_number_parameters _refine.ls_number_restraints _refine.occupancy_min _refine.occupancy_max _refine.correlation_coeff_Fo_to_Fc _refine.correlation_coeff_Fo_to_Fc_free _refine.B_iso_mean _refine.aniso_B[1][1] _refine.aniso_B[2][2] _refine.aniso_B[3][3] _refine.aniso_B[1][2] _refine.aniso_B[1][3] _refine.aniso_B[2][3] _refine.solvent_model_details _refine.solvent_model_param_ksol _refine.solvent_model_param_bsol _refine.pdbx_solvent_vdw_probe_radii _refine.pdbx_solvent_ion_probe_radii _refine.pdbx_solvent_shrinkage_radii _refine.pdbx_ls_cross_valid_method _refine.details _refine.pdbx_starting_model _refine.pdbx_method_to_determine_struct _refine.pdbx_isotropic_thermal_model _refine.pdbx_stereochemistry_target_values _refine.pdbx_stereochem_target_val_spec_case _refine.pdbx_R_Free_selection_details _refine.pdbx_overall_ESU_R _refine.pdbx_overall_ESU_R_Free _refine.overall_SU_ML _refine.pdbx_overall_phase_error _refine.overall_SU_B _refine.overall_SU_R_Cruickshank_DPI _refine.pdbx_overall_SU_R_free_Cruickshank_DPI _refine.pdbx_overall_SU_R_Blow_DPI _refine.pdbx_overall_SU_R_free_Blow_DPI 'X-RAY DIFFRACTION' 4XPV 1 ? 22806 ? ? ? ? ? ? 20.00 1.70 96.0 ? ? 0.133 0.157 0.006 ? 5.0 ? ? ? ? ? ? ? 18.41 ? ? ? ? ? ? ? ? ? ? ? ? 'FREE R-VALUE' ? 1RX2 'MOLECULAR REPLACEMENT' ? ? ? RANDOM ? ? ? ? ? ? ? ? ? 'NEUTRON DIFFRACTION' 4XPV 2 ? ? ? ? ? ? ? ? 20.00 2.00 80.3 ? ? 0.264 0.304 0.007 ? 5.0 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 'FREE R-VALUE' ? ? ? ? ? ? RANDOM ? ? ? ? ? ? ? ? ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.70 _refine_hist.d_res_low 20.00 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 519 _refine_hist.number_atoms_total 1994 _refine_hist.pdbx_number_residues_total 189 _refine_hist.pdbx_B_iso_mean_ligand 22.99 _refine_hist.pdbx_B_iso_mean_solvent 28.79 _refine_hist.pdbx_number_atoms_protein 1472 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 ? 3554 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.213 ? 5845 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.095 ? 206 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 706 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 9.649 ? 957 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.70 1.78 2896 . 156 2740 99.0000 . . . 0.2734 . 0.2254 . . . . . . 8 . . . 'NEUTRON DIFFRACTION' 2.00 2.31 2213 . 124 2089 71.0000 . . . 0.4167 . 0.3527 . . . . . . 4 . . . # _struct.entry_id 4XPV _struct.title 'Neutron and X-ray structure analysis of xylanase: N44D at pH6' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4XPV _struct_keywords.text 'jelly roll, hydrolase' _struct_keywords.pdbx_keywords HYDROLASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 3 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 151 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 161 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 152 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 162 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLN 51 A . ? GLN 52 A PRO 52 A ? PRO 53 A 1 2.28 2 ASN 81 A . ? ASN 82 A PRO 82 A ? PRO 83 A 1 12.05 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 9 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 5 ? ASN A 9 ? GLY A 6 ASN A 10 AA1 2 TYR A 12 ? ASN A 18 ? TYR A 13 ASN A 19 AA1 3 ASP A 43 ? TRP A 50 ? ASP A 44 TRP A 51 AA1 4 THR A 167 ? TYR A 178 ? THR A 168 TYR A 179 AA1 5 SER A 71 ? ARG A 80 ? SER A 72 ARG A 81 AA1 6 ILE A 84 ? PHE A 92 ? ILE A 85 PHE A 93 AA1 7 ALA A 131 ? ARG A 140 ? ALA A 132 ARG A 141 AA1 8 SER A 112 ? GLN A 124 ? SER A 113 GLN A 125 AA1 9 THR A 102 ? SER A 109 ? THR A 103 SER A 110 AA2 1 VAL A 24 ? ASN A 28 ? VAL A 25 ASN A 29 AA2 2 GLN A 33 ? TRP A 38 ? GLN A 34 TRP A 39 AA2 3 SER A 181 ? SER A 189 ? SER A 182 SER A 190 AA2 4 VAL A 58 ? ASN A 68 ? VAL A 59 ASN A 69 AA2 5 GLY A 147 ? ASN A 150 ? GLY A 148 ASN A 151 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ASN A 9 ? N ASN A 10 O TYR A 12 ? O TYR A 13 AA1 2 3 N PHE A 13 ? N PHE A 14 O GLY A 49 ? O GLY A 50 AA1 3 4 N TRP A 50 ? N TRP A 51 O GLN A 171 ? O GLN A 172 AA1 4 5 O ILE A 172 ? O ILE A 173 N TYR A 76 ? N TYR A 77 AA1 5 6 N GLY A 77 ? N GLY A 78 O TYR A 86 ? O TYR A 87 AA1 6 7 N VAL A 89 ? N VAL A 90 O SER A 138 ? O SER A 139 AA1 7 8 O VAL A 139 ? O VAL A 140 N ASP A 115 ? N ASP A 116 AA1 8 9 O TYR A 114 ? O TYR A 115 N VAL A 107 ? N VAL A 108 AA2 1 2 N THR A 27 ? N THR A 28 O SER A 35 ? O SER A 36 AA2 2 3 N TRP A 38 ? N TRP A 39 O GLY A 182 ? O GLY A 183 AA2 3 4 O SER A 183 ? O SER A 184 N ASN A 66 ? N ASN A 67 AA2 4 5 N ILE A 59 ? N ILE A 60 O VAL A 149 ? O VAL A 150 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A IOD 201 ? 1 'binding site for residue IOD A 201' AC2 Software A IOD 202 ? 1 'binding site for residue IOD A 202' AC3 Software A IOD 203 ? 1 'binding site for residue IOD A 203' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 SER A 145 ? SER A 146 . ? 1_555 ? 2 AC2 1 MET A 168 ? MET A 169 . ? 1_555 ? 3 AC3 1 VAL A 122 ? VAL A 123 . ? 1_555 ? # _atom_sites.entry_id 4XPV _atom_sites.fract_transf_matrix[1][1] 0.020328 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016587 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014180 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C D H I N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 2 2 THR THR A . n A 1 2 ILE 2 3 3 ILE ILE A . n A 1 3 GLN 3 4 4 GLN GLN A . n A 1 4 PRO 4 5 5 PRO PRO A . n A 1 5 GLY 5 6 6 GLY GLY A . n A 1 6 THR 6 7 7 THR THR A . n A 1 7 GLY 7 8 8 GLY GLY A . n A 1 8 TYR 8 9 9 TYR TYR A . n A 1 9 ASN 9 10 10 ASN ASN A . n A 1 10 ASN 10 11 11 ASN ASN A . n A 1 11 GLY 11 12 12 GLY GLY A . n A 1 12 TYR 12 13 13 TYR TYR A . n A 1 13 PHE 13 14 14 PHE PHE A . n A 1 14 TYR 14 15 15 TYR TYR A . n A 1 15 SER 15 16 16 SER SER A . n A 1 16 TYR 16 17 17 TYR TYR A . n A 1 17 TRP 17 18 18 TRP TRP A . n A 1 18 ASN 18 19 19 ASN ASN A . n A 1 19 ASP 19 20 20 ASP ASP A . n A 1 20 GLY 20 21 21 GLY GLY A . n A 1 21 HIS 21 22 22 HIS HIS A . n A 1 22 GLY 22 23 23 GLY GLY A . n A 1 23 GLY 23 24 24 GLY GLY A . n A 1 24 VAL 24 25 25 VAL VAL A . n A 1 25 THR 25 26 26 THR THR A . n A 1 26 TYR 26 27 27 TYR TYR A . n A 1 27 THR 27 28 28 THR THR A . n A 1 28 ASN 28 29 29 ASN ASN A . n A 1 29 GLY 29 30 30 GLY GLY A . n A 1 30 PRO 30 31 31 PRO PRO A . n A 1 31 GLY 31 32 32 GLY GLY A . n A 1 32 GLY 32 33 33 GLY GLY A . n A 1 33 GLN 33 34 34 GLN GLN A . n A 1 34 PHE 34 35 35 PHE PHE A . n A 1 35 SER 35 36 36 SER SER A . n A 1 36 VAL 36 37 37 VAL VAL A . n A 1 37 ASN 37 38 38 ASN ASN A . n A 1 38 TRP 38 39 39 TRP TRP A . n A 1 39 SER 39 40 40 SER SER A . n A 1 40 ASN 40 41 41 ASN ASN A . n A 1 41 SER 41 42 42 SER SER A . n A 1 42 GLY 42 43 43 GLY GLY A . n A 1 43 ASP 43 44 44 ASP ASP A . n A 1 44 PHE 44 45 45 PHE PHE A . n A 1 45 VAL 45 46 46 VAL VAL A . n A 1 46 GLY 46 47 47 GLY GLY A . n A 1 47 GLY 47 48 48 GLY GLY A . n A 1 48 LYS 48 49 49 LYS LYS A . n A 1 49 GLY 49 50 50 GLY GLY A . n A 1 50 TRP 50 51 51 TRP TRP A . n A 1 51 GLN 51 52 52 GLN GLN A . n A 1 52 PRO 52 53 53 PRO PRO A . n A 1 53 GLY 53 54 54 GLY GLY A . n A 1 54 THR 54 55 55 THR THR A . n A 1 55 LYS 55 56 56 LYS LYS A . n A 1 56 ASN 56 57 57 ASN ASN A . n A 1 57 LYS 57 58 58 LYS LYS A . n A 1 58 VAL 58 59 59 VAL VAL A . n A 1 59 ILE 59 60 60 ILE ILE A . n A 1 60 ASN 60 61 61 ASN ASN A . n A 1 61 PHE 61 62 62 PHE PHE A . n A 1 62 SER 62 63 63 SER SER A . n A 1 63 GLY 63 64 64 GLY GLY A . n A 1 64 SER 64 65 65 SER SER A . n A 1 65 TYR 65 66 66 TYR TYR A . n A 1 66 ASN 66 67 67 ASN ASN A . n A 1 67 PRO 67 68 68 PRO PRO A . n A 1 68 ASN 68 69 69 ASN ASN A . n A 1 69 GLY 69 70 70 GLY GLY A . n A 1 70 ASN 70 71 71 ASN ASN A . n A 1 71 SER 71 72 72 SER SER A . n A 1 72 TYR 72 73 73 TYR TYR A . n A 1 73 LEU 73 74 74 LEU LEU A . n A 1 74 SER 74 75 75 SER SER A . n A 1 75 VAL 75 76 76 VAL VAL A . n A 1 76 TYR 76 77 77 TYR TYR A . n A 1 77 GLY 77 78 78 GLY GLY A . n A 1 78 TRP 78 79 79 TRP TRP A . n A 1 79 SER 79 80 80 SER SER A . n A 1 80 ARG 80 81 81 ARG ARG A . n A 1 81 ASN 81 82 82 ASN ASN A . n A 1 82 PRO 82 83 83 PRO PRO A . n A 1 83 LEU 83 84 84 LEU LEU A . n A 1 84 ILE 84 85 85 ILE ILE A . n A 1 85 GLU 85 86 86 GLU GLU A . n A 1 86 TYR 86 87 87 TYR TYR A . n A 1 87 TYR 87 88 88 TYR TYR A . n A 1 88 ILE 88 89 89 ILE ILE A . n A 1 89 VAL 89 90 90 VAL VAL A . n A 1 90 GLU 90 91 91 GLU GLU A . n A 1 91 ASN 91 92 92 ASN ASN A . n A 1 92 PHE 92 93 93 PHE PHE A . n A 1 93 GLY 93 94 94 GLY GLY A . n A 1 94 THR 94 95 95 THR THR A . n A 1 95 TYR 95 96 96 TYR TYR A . n A 1 96 ASN 96 97 97 ASN ASN A . n A 1 97 PRO 97 98 98 PRO PRO A . n A 1 98 SER 98 99 99 SER SER A . n A 1 99 THR 99 100 100 THR THR A . n A 1 100 GLY 100 101 101 GLY GLY A . n A 1 101 ALA 101 102 102 ALA ALA A . n A 1 102 THR 102 103 103 THR THR A . n A 1 103 LYS 103 104 104 LYS LYS A . n A 1 104 LEU 104 105 105 LEU LEU A . n A 1 105 GLY 105 106 106 GLY GLY A . n A 1 106 GLU 106 107 107 GLU GLU A . n A 1 107 VAL 107 108 108 VAL VAL A . n A 1 108 THR 108 109 109 THR THR A . n A 1 109 SER 109 110 110 SER SER A . n A 1 110 ASP 110 111 111 ASP ASP A . n A 1 111 GLY 111 112 112 GLY GLY A . n A 1 112 SER 112 113 113 SER SER A . n A 1 113 VAL 113 114 114 VAL VAL A . n A 1 114 TYR 114 115 115 TYR TYR A . n A 1 115 ASP 115 116 116 ASP ASP A . n A 1 116 ILE 116 117 117 ILE ILE A . n A 1 117 TYR 117 118 118 TYR TYR A . n A 1 118 ARG 118 119 119 ARG ARG A . n A 1 119 THR 119 120 120 THR THR A . n A 1 120 GLN 120 121 121 GLN GLN A . n A 1 121 ARG 121 122 122 ARG ARG A . n A 1 122 VAL 122 123 123 VAL VAL A . n A 1 123 ASN 123 124 124 ASN ASN A . n A 1 124 GLN 124 125 125 GLN GLN A . n A 1 125 PRO 125 126 126 PRO PRO A . n A 1 126 SER 126 127 127 SER SER A . n A 1 127 ILE 127 128 128 ILE ILE A . n A 1 128 ILE 128 129 129 ILE ILE A . n A 1 129 GLY 129 130 130 GLY GLY A . n A 1 130 THR 130 131 131 THR THR A . n A 1 131 ALA 131 132 132 ALA ALA A . n A 1 132 THR 132 133 133 THR THR A . n A 1 133 PHE 133 134 134 PHE PHE A . n A 1 134 TYR 134 135 135 TYR TYR A . n A 1 135 GLN 135 136 136 GLN GLN A . n A 1 136 TYR 136 137 137 TYR TYR A . n A 1 137 TRP 137 138 138 TRP TRP A . n A 1 138 SER 138 139 139 SER SER A . n A 1 139 VAL 139 140 140 VAL VAL A . n A 1 140 ARG 140 141 141 ARG ARG A . n A 1 141 ARG 141 142 142 ARG ARG A . n A 1 142 ASN 142 143 143 ASN ASN A . n A 1 143 HIS 143 144 144 HIS HIS A . n A 1 144 ARG 144 145 145 ARG ARG A . n A 1 145 SER 145 146 146 SER SER A . n A 1 146 SER 146 147 147 SER SER A . n A 1 147 GLY 147 148 148 GLY GLY A . n A 1 148 SER 148 149 149 SER SER A . n A 1 149 VAL 149 150 150 VAL VAL A . n A 1 150 ASN 150 151 151 ASN ASN A . n A 1 151 THR 151 152 152 THR THR A . n A 1 152 ALA 152 153 153 ALA ALA A . n A 1 153 ASN 153 154 154 ASN ASN A . n A 1 154 HIS 154 155 155 HIS HIS A . n A 1 155 PHE 155 156 156 PHE PHE A . n A 1 156 ASN 156 157 157 ASN ASN A . n A 1 157 ALA 157 158 158 ALA ALA A . n A 1 158 TRP 158 159 159 TRP TRP A . n A 1 159 ALA 159 160 160 ALA ALA A . n A 1 160 GLN 160 161 161 GLN GLN A . n A 1 161 GLN 161 162 162 GLN GLN A . n A 1 162 GLY 162 163 163 GLY GLY A . n A 1 163 LEU 163 164 164 LEU LEU A . n A 1 164 THR 164 165 165 THR THR A . n A 1 165 LEU 165 166 166 LEU LEU A . n A 1 166 GLY 166 167 167 GLY GLY A . n A 1 167 THR 167 168 168 THR THR A . n A 1 168 MET 168 169 169 MET MET A . n A 1 169 ASP 169 170 170 ASP ASP A . n A 1 170 TYR 170 171 171 TYR TYR A . n A 1 171 GLN 171 172 172 GLN GLN A . n A 1 172 ILE 172 173 173 ILE ILE A . n A 1 173 VAL 173 174 174 VAL VAL A . n A 1 174 ALA 174 175 175 ALA ALA A . n A 1 175 VAL 175 176 176 VAL VAL A . n A 1 176 GLU 176 177 177 GLU GLU A . n A 1 177 GLY 177 178 178 GLY GLY A . n A 1 178 TYR 178 179 179 TYR TYR A . n A 1 179 PHE 179 180 180 PHE PHE A . n A 1 180 SER 180 181 181 SER SER A . n A 1 181 SER 181 182 182 SER SER A . n A 1 182 GLY 182 183 183 GLY GLY A . n A 1 183 SER 183 184 184 SER SER A . n A 1 184 ALA 184 185 185 ALA ALA A . n A 1 185 SER 185 186 186 SER SER A . n A 1 186 ILE 186 187 187 ILE ILE A . n A 1 187 THR 187 188 188 THR THR A . n A 1 188 VAL 188 189 189 VAL VAL A . n A 1 189 SER 189 190 190 SER SER A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 IOD 1 201 500 IOD IOD A . C 2 IOD 1 202 502 IOD IOD A . D 2 IOD 1 203 503 IOD IOD A . E 3 DOD 1 301 127 DOD DOD A . E 3 DOD 2 302 54 DOD DOD A . E 3 DOD 3 303 74 DOD DOD A . E 3 DOD 4 304 120 DOD DOD A . E 3 DOD 5 305 92 DOD DOD A . E 3 DOD 6 306 101 DOD DOD A . E 3 DOD 7 307 194 DOD DOD A . E 3 DOD 8 308 132 DOD DOD A . E 3 DOD 9 309 105 DOD DOD A . E 3 DOD 10 310 126 DOD DOD A . E 3 DOD 11 311 41 DOD DOD A . E 3 DOD 12 312 19 DOD DOD A . E 3 DOD 13 313 87 DOD DOD A . E 3 DOD 14 314 110 DOD DOD A . E 3 DOD 15 315 98 DOD DOD A . E 3 DOD 16 316 131 DOD DOD A . E 3 DOD 17 317 183 DOD DOD A . E 3 DOD 18 318 124 DOD DOD A . E 3 DOD 19 319 99 DOD DOD A . E 3 DOD 20 320 63 DOD DOD A . E 3 DOD 21 321 5 DOD DOD A . E 3 DOD 22 322 20 DOD DOD A . E 3 DOD 23 323 93 DOD DOD A . E 3 DOD 24 324 68 DOD DOD A . E 3 DOD 25 325 177 DOD DOD A . E 3 DOD 26 326 179 DOD DOD A . E 3 DOD 27 327 28 DOD DOD A . E 3 DOD 28 328 184 DOD DOD A . E 3 DOD 29 329 55 DOD DOD A . E 3 DOD 30 330 48 DOD DOD A . E 3 DOD 31 331 117 DOD DOD A . E 3 DOD 32 332 166 DOD DOD A . E 3 DOD 33 333 84 DOD DOD A . E 3 DOD 34 334 49 DOD DOD A . E 3 DOD 35 335 3 DOD DOD A . E 3 DOD 36 336 42 DOD DOD A . E 3 DOD 37 337 185 DOD DOD A . E 3 DOD 38 338 89 DOD DOD A . E 3 DOD 39 339 2 DOD DOD A . E 3 DOD 40 340 56 DOD DOD A . E 3 DOD 41 341 108 DOD DOD A . E 3 DOD 42 342 39 DOD DOD A . E 3 DOD 43 343 61 DOD DOD A . E 3 DOD 44 344 7 DOD DOD A . E 3 DOD 45 345 78 DOD DOD A . E 3 DOD 46 346 69 DOD DOD A . E 3 DOD 47 347 13 DOD DOD A . E 3 DOD 48 348 27 DOD DOD A . E 3 DOD 49 349 57 DOD DOD A . E 3 DOD 50 350 37 DOD DOD A . E 3 DOD 51 351 115 DOD DOD A . E 3 DOD 52 352 32 DOD DOD A . E 3 DOD 53 353 4 DOD DOD A . E 3 DOD 54 354 24 DOD DOD A . E 3 DOD 55 355 22 DOD DOD A . E 3 DOD 56 356 29 DOD DOD A . E 3 DOD 57 357 16 DOD DOD A . E 3 DOD 58 358 53 DOD DOD A . E 3 DOD 59 359 30 DOD DOD A . E 3 DOD 60 360 168 DOD DOD A . E 3 DOD 61 361 46 DOD DOD A . E 3 DOD 62 362 189 DOD DOD A . E 3 DOD 63 363 26 DOD DOD A . E 3 DOD 64 364 12 DOD DOD A . E 3 DOD 65 365 80 DOD DOD A . E 3 DOD 66 366 96 DOD DOD A . E 3 DOD 67 367 10 DOD DOD A . E 3 DOD 68 368 186 DOD DOD A . E 3 DOD 69 369 103 DOD DOD A . E 3 DOD 70 370 1 DOD DOD A . E 3 DOD 71 371 34 DOD DOD A . E 3 DOD 72 372 94 DOD DOD A . E 3 DOD 73 373 97 DOD DOD A . E 3 DOD 74 374 70 DOD DOD A . E 3 DOD 75 375 135 DOD DOD A . E 3 DOD 76 376 62 DOD DOD A . E 3 DOD 77 377 35 DOD DOD A . E 3 DOD 78 378 60 DOD DOD A . E 3 DOD 79 379 162 DOD DOD A . E 3 DOD 80 380 14 DOD DOD A . E 3 DOD 81 381 85 DOD DOD A . E 3 DOD 82 382 71 DOD DOD A . E 3 DOD 83 383 18 DOD DOD A . E 3 DOD 84 384 51 DOD DOD A . E 3 DOD 85 385 76 DOD DOD A . E 3 DOD 86 386 47 DOD DOD A . E 3 DOD 87 387 134 DOD DOD A . E 3 DOD 88 388 31 DOD DOD A . E 3 DOD 89 389 90 DOD DOD A . E 3 DOD 90 390 79 DOD DOD A . E 3 DOD 91 391 174 DOD DOD A . E 3 DOD 92 392 178 DOD DOD A . E 3 DOD 93 393 11 DOD DOD A . E 3 DOD 94 394 21 DOD DOD A . E 3 DOD 95 395 130 DOD DOD A . E 3 DOD 96 396 145 DOD DOD A . E 3 DOD 97 397 88 DOD DOD A . E 3 DOD 98 398 129 DOD DOD A . E 3 DOD 99 399 6 DOD DOD A . E 3 DOD 100 400 23 DOD DOD A . E 3 DOD 101 401 9 DOD DOD A . E 3 DOD 102 402 59 DOD DOD A . E 3 DOD 103 403 160 DOD DOD A . E 3 DOD 104 404 58 DOD DOD A . E 3 DOD 105 405 188 DOD DOD A . E 3 DOD 106 406 121 DOD DOD A . E 3 DOD 107 407 8 DOD DOD A . E 3 DOD 108 408 102 DOD DOD A . E 3 DOD 109 409 17 DOD DOD A . E 3 DOD 110 410 86 DOD DOD A . E 3 DOD 111 411 91 DOD DOD A . E 3 DOD 112 412 190 DOD DOD A . E 3 DOD 113 413 66 DOD DOD A . E 3 DOD 114 414 95 DOD DOD A . E 3 DOD 115 415 64 DOD DOD A . E 3 DOD 116 416 72 DOD DOD A . E 3 DOD 117 417 45 DOD DOD A . E 3 DOD 118 418 146 DOD DOD A . E 3 DOD 119 419 193 DOD DOD A . E 3 DOD 120 420 82 DOD DOD A . E 3 DOD 121 421 81 DOD DOD A . E 3 DOD 122 422 118 DOD DOD A . E 3 DOD 123 423 15 DOD DOD A . E 3 DOD 124 424 125 DOD DOD A . E 3 DOD 125 425 75 DOD DOD A . E 3 DOD 126 426 122 DOD DOD A . E 3 DOD 127 427 36 DOD DOD A . E 3 DOD 128 428 142 DOD DOD A . E 3 DOD 129 429 114 DOD DOD A . E 3 DOD 130 430 158 DOD DOD A . E 3 DOD 131 431 33 DOD DOD A . E 3 DOD 132 432 141 DOD DOD A . E 3 DOD 133 433 165 DOD DOD A . E 3 DOD 134 434 144 DOD DOD A . E 3 DOD 135 435 123 DOD DOD A . E 3 DOD 136 436 113 DOD DOD A . E 3 DOD 137 437 107 DOD DOD A . E 3 DOD 138 438 44 DOD DOD A . E 3 DOD 139 439 173 DOD DOD A . E 3 DOD 140 440 65 DOD DOD A . E 3 DOD 141 441 147 DOD DOD A . E 3 DOD 142 442 112 DOD DOD A . E 3 DOD 143 443 77 DOD DOD A . E 3 DOD 144 444 25 DOD DOD A . E 3 DOD 145 445 40 DOD DOD A . E 3 DOD 146 446 138 DOD DOD A . E 3 DOD 147 447 119 DOD DOD A . E 3 DOD 148 448 181 DOD DOD A . E 3 DOD 149 449 38 DOD DOD A . E 3 DOD 150 450 67 DOD DOD A . E 3 DOD 151 451 106 DOD DOD A . E 3 DOD 152 452 50 DOD DOD A . E 3 DOD 153 453 109 DOD DOD A . E 3 DOD 154 454 128 DOD DOD A . E 3 DOD 155 455 169 DOD DOD A . E 3 DOD 156 456 148 DOD DOD A . E 3 DOD 157 457 175 DOD DOD A . E 3 DOD 158 458 171 DOD DOD A . E 3 DOD 159 459 180 DOD DOD A . E 3 DOD 160 460 156 DOD DOD A . E 3 DOD 161 461 111 DOD DOD A . E 3 DOD 162 462 73 DOD DOD A . E 3 DOD 163 463 154 DOD DOD A . E 3 DOD 164 464 167 DOD DOD A . E 3 DOD 165 465 176 DOD DOD A . E 3 DOD 166 466 164 DOD DOD A . E 3 DOD 167 467 196 DOD DOD A . E 3 DOD 168 468 172 DOD DOD A . E 3 DOD 169 469 195 DOD DOD A . E 3 DOD 170 470 83 DOD DOD A . E 3 DOD 171 471 187 DOD DOD A . E 3 DOD 172 472 182 DOD DOD A . E 3 DOD 173 473 170 DOD DOD A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 18570 ? 1 MORE 31 ? 1 'SSA (A^2)' 8350 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-30 2 'Structure model' 1 1 2015-10-07 3 'Structure model' 1 2 2015-10-14 4 'Structure model' 1 3 2015-10-21 5 'Structure model' 1 4 2016-07-20 6 'Structure model' 1 5 2017-09-20 7 'Structure model' 2 0 2018-04-25 8 'Structure model' 2 1 2019-12-25 9 'Structure model' 2 2 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Database references' 4 5 'Structure model' 'Data collection' 5 6 'Structure model' 'Author supporting evidence' 6 6 'Structure model' 'Derived calculations' 7 7 'Structure model' 'Atomic model' 8 7 'Structure model' 'Data collection' 9 7 'Structure model' 'Derived calculations' 10 8 'Structure model' 'Author supporting evidence' 11 9 'Structure model' 'Data collection' 12 9 'Structure model' 'Database references' 13 9 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 6 'Structure model' pdbx_audit_support 2 6 'Structure model' pdbx_struct_oper_list 3 7 'Structure model' atom_site 4 7 'Structure model' diffrn_detector 5 7 'Structure model' diffrn_source 6 7 'Structure model' pdbx_nonpoly_scheme 7 7 'Structure model' struct_site 8 7 'Structure model' struct_site_gen 9 8 'Structure model' pdbx_audit_support 10 9 'Structure model' chem_comp_atom 11 9 'Structure model' chem_comp_bond 12 9 'Structure model' database_2 13 9 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 6 'Structure model' '_pdbx_audit_support.funding_organization' 2 6 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 7 'Structure model' '_atom_site.B_iso_or_equiv' 4 7 'Structure model' '_atom_site.Cartn_x' 5 7 'Structure model' '_atom_site.Cartn_y' 6 7 'Structure model' '_atom_site.Cartn_z' 7 7 'Structure model' '_diffrn_detector.detector' 8 7 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 9 7 'Structure model' '_diffrn_source.pdbx_wavelength_list' 10 7 'Structure model' '_diffrn_source.source' 11 7 'Structure model' '_diffrn_source.type' 12 7 'Structure model' '_pdbx_nonpoly_scheme.auth_seq_num' 13 7 'Structure model' '_struct_site.pdbx_num_residues' 14 8 'Structure model' '_pdbx_audit_support.funding_organization' 15 9 'Structure model' '_database_2.pdbx_DOI' 16 9 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 DH _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 TYR _pdbx_validate_close_contact.auth_seq_id_1 66 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 B _pdbx_validate_close_contact.auth_atom_id_2 DG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 72 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 B _pdbx_validate_close_contact.dist 1.35 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CB _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 SER _pdbx_validate_rmsd_bond.auth_seq_id_1 63 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OG _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 SER _pdbx_validate_rmsd_bond.auth_seq_id_2 63 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.325 _pdbx_validate_rmsd_bond.bond_target_value 1.418 _pdbx_validate_rmsd_bond.bond_deviation -0.093 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.013 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 119 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 119 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH2 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 119 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 117.21 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.09 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 170 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -103.77 _pdbx_validate_torsion.psi -144.96 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 SER _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 75 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 VAL _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 76 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 148.09 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 DOD O O N N 74 DOD D1 D N N 75 DOD D2 D N N 76 GLN N N N N 77 GLN CA C N S 78 GLN C C N N 79 GLN O O N N 80 GLN CB C N N 81 GLN CG C N N 82 GLN CD C N N 83 GLN OE1 O N N 84 GLN NE2 N N N 85 GLN OXT O N N 86 GLN H H N N 87 GLN H2 H N N 88 GLN HA H N N 89 GLN HB2 H N N 90 GLN HB3 H N N 91 GLN HG2 H N N 92 GLN HG3 H N N 93 GLN HE21 H N N 94 GLN HE22 H N N 95 GLN HXT H N N 96 GLU N N N N 97 GLU CA C N S 98 GLU C C N N 99 GLU O O N N 100 GLU CB C N N 101 GLU CG C N N 102 GLU CD C N N 103 GLU OE1 O N N 104 GLU OE2 O N N 105 GLU OXT O N N 106 GLU H H N N 107 GLU H2 H N N 108 GLU HA H N N 109 GLU HB2 H N N 110 GLU HB3 H N N 111 GLU HG2 H N N 112 GLU HG3 H N N 113 GLU HE2 H N N 114 GLU HXT H N N 115 GLY N N N N 116 GLY CA C N N 117 GLY C C N N 118 GLY O O N N 119 GLY OXT O N N 120 GLY H H N N 121 GLY H2 H N N 122 GLY HA2 H N N 123 GLY HA3 H N N 124 GLY HXT H N N 125 HIS N N N N 126 HIS CA C N S 127 HIS C C N N 128 HIS O O N N 129 HIS CB C N N 130 HIS CG C Y N 131 HIS ND1 N Y N 132 HIS CD2 C Y N 133 HIS CE1 C Y N 134 HIS NE2 N Y N 135 HIS OXT O N N 136 HIS H H N N 137 HIS H2 H N N 138 HIS HA H N N 139 HIS HB2 H N N 140 HIS HB3 H N N 141 HIS HD1 H N N 142 HIS HD2 H N N 143 HIS HE1 H N N 144 HIS HE2 H N N 145 HIS HXT H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 IOD I I N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TRP N N N N 308 TRP CA C N S 309 TRP C C N N 310 TRP O O N N 311 TRP CB C N N 312 TRP CG C Y N 313 TRP CD1 C Y N 314 TRP CD2 C Y N 315 TRP NE1 N Y N 316 TRP CE2 C Y N 317 TRP CE3 C Y N 318 TRP CZ2 C Y N 319 TRP CZ3 C Y N 320 TRP CH2 C Y N 321 TRP OXT O N N 322 TRP H H N N 323 TRP H2 H N N 324 TRP HA H N N 325 TRP HB2 H N N 326 TRP HB3 H N N 327 TRP HD1 H N N 328 TRP HE1 H N N 329 TRP HE3 H N N 330 TRP HZ2 H N N 331 TRP HZ3 H N N 332 TRP HH2 H N N 333 TRP HXT H N N 334 TYR N N N N 335 TYR CA C N S 336 TYR C C N N 337 TYR O O N N 338 TYR CB C N N 339 TYR CG C Y N 340 TYR CD1 C Y N 341 TYR CD2 C Y N 342 TYR CE1 C Y N 343 TYR CE2 C Y N 344 TYR CZ C Y N 345 TYR OH O N N 346 TYR OXT O N N 347 TYR H H N N 348 TYR H2 H N N 349 TYR HA H N N 350 TYR HB2 H N N 351 TYR HB3 H N N 352 TYR HD1 H N N 353 TYR HD2 H N N 354 TYR HE1 H N N 355 TYR HE2 H N N 356 TYR HH H N N 357 TYR HXT H N N 358 VAL N N N N 359 VAL CA C N S 360 VAL C C N N 361 VAL O O N N 362 VAL CB C N N 363 VAL CG1 C N N 364 VAL CG2 C N N 365 VAL OXT O N N 366 VAL H H N N 367 VAL H2 H N N 368 VAL HA H N N 369 VAL HB H N N 370 VAL HG11 H N N 371 VAL HG12 H N N 372 VAL HG13 H N N 373 VAL HG21 H N N 374 VAL HG22 H N N 375 VAL HG23 H N N 376 VAL HXT H N N 377 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 DOD O D1 sing N N 70 DOD O D2 sing N N 71 GLN N CA sing N N 72 GLN N H sing N N 73 GLN N H2 sing N N 74 GLN CA C sing N N 75 GLN CA CB sing N N 76 GLN CA HA sing N N 77 GLN C O doub N N 78 GLN C OXT sing N N 79 GLN CB CG sing N N 80 GLN CB HB2 sing N N 81 GLN CB HB3 sing N N 82 GLN CG CD sing N N 83 GLN CG HG2 sing N N 84 GLN CG HG3 sing N N 85 GLN CD OE1 doub N N 86 GLN CD NE2 sing N N 87 GLN NE2 HE21 sing N N 88 GLN NE2 HE22 sing N N 89 GLN OXT HXT sing N N 90 GLU N CA sing N N 91 GLU N H sing N N 92 GLU N H2 sing N N 93 GLU CA C sing N N 94 GLU CA CB sing N N 95 GLU CA HA sing N N 96 GLU C O doub N N 97 GLU C OXT sing N N 98 GLU CB CG sing N N 99 GLU CB HB2 sing N N 100 GLU CB HB3 sing N N 101 GLU CG CD sing N N 102 GLU CG HG2 sing N N 103 GLU CG HG3 sing N N 104 GLU CD OE1 doub N N 105 GLU CD OE2 sing N N 106 GLU OE2 HE2 sing N N 107 GLU OXT HXT sing N N 108 GLY N CA sing N N 109 GLY N H sing N N 110 GLY N H2 sing N N 111 GLY CA C sing N N 112 GLY CA HA2 sing N N 113 GLY CA HA3 sing N N 114 GLY C O doub N N 115 GLY C OXT sing N N 116 GLY OXT HXT sing N N 117 HIS N CA sing N N 118 HIS N H sing N N 119 HIS N H2 sing N N 120 HIS CA C sing N N 121 HIS CA CB sing N N 122 HIS CA HA sing N N 123 HIS C O doub N N 124 HIS C OXT sing N N 125 HIS CB CG sing N N 126 HIS CB HB2 sing N N 127 HIS CB HB3 sing N N 128 HIS CG ND1 sing Y N 129 HIS CG CD2 doub Y N 130 HIS ND1 CE1 doub Y N 131 HIS ND1 HD1 sing N N 132 HIS CD2 NE2 sing Y N 133 HIS CD2 HD2 sing N N 134 HIS CE1 NE2 sing Y N 135 HIS CE1 HE1 sing N N 136 HIS NE2 HE2 sing N N 137 HIS OXT HXT sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' NIH-NIGMS 1 'State Education Ministry' China '2014 Scientific Research Foundation for the Returned Overseas Chinese Scholars' 2 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'IODIDE ION' IOD 3 water DOD # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1RX2 _pdbx_initial_refinement_model.details ? #