data_4Y1X # _entry.id 4Y1X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4Y1X WWPDB D_1000206716 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 4Y1V unspecified PDB . 4Y1U unspecified PDB . 4Y1Y unspecified PDB . 4Y1Z unspecified PDB . 4Y20 unspecified PDB . 4Y22 unspecified PDB . 4Y24 unspecified PDB . 4Y26 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4Y1X _pdbx_database_status.recvd_initial_deposition_date 2015-02-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Lin, H.Y.' 1 'Hsieh, T.J.' 2 'Lin, C.H.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural basis of human galectin-1 inhibition with Ki values in the micro- to nanomolar range' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Lin, H.Y.' 1 ? primary 'Hsieh, T.J.' 2 ? primary 'Tu, Z.' 3 ? primary 'Huang, B.S.' 4 ? primary 'Wu, S.C.' 5 ? primary 'Chien, C.T.' 6 ? primary 'Hsu, S.T.' 7 ? primary 'Lin, C.H.' 8 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 4Y1X _cell.details ? _cell.formula_units_Z ? _cell.length_a 43.579 _cell.length_a_esd ? _cell.length_b 57.220 _cell.length_b_esd ? _cell.length_c 110.945 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4Y1X _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Galectin-1 16894.965 2 ? ? ? ? 2 branched syn 'beta-D-galactopyranose-(1-4)-methyl 2-acetamido-2-deoxy-6-O-sulfo-beta-D-glucopyranoside' 477.439 2 ? ? ? ? 3 water nat water 18.015 51 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;Gal-1,14 kDa laminin-binding protein,HLBP14,14 kDa lectin,Beta-galactoside-binding lectin L-14-I,Galaptin,HBL,HPL,Lactose-binding lectin 1,Lectin galactoside-binding soluble 1,Putative MAPK-activating protein PM12,S-Lac lectin 1 ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGLVPRGSHMCGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNL(CSO)LHFNPRFNAHGDAN TIV(CSO)NSKDGGAWGTEQREAVFPFQPGSVAEV(CSO)ITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKI K(CSO)VAFD ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGLVPRGSHMCGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVC NSKDGGAWGTEQREAVFPFQPGSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD ; _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 LEU n 1 15 VAL n 1 16 PRO n 1 17 ARG n 1 18 GLY n 1 19 SER n 1 20 HIS n 1 21 MET n 1 22 CYS n 1 23 GLY n 1 24 LEU n 1 25 VAL n 1 26 ALA n 1 27 SER n 1 28 ASN n 1 29 LEU n 1 30 ASN n 1 31 LEU n 1 32 LYS n 1 33 PRO n 1 34 GLY n 1 35 GLU n 1 36 CYS n 1 37 LEU n 1 38 ARG n 1 39 VAL n 1 40 ARG n 1 41 GLY n 1 42 GLU n 1 43 VAL n 1 44 ALA n 1 45 PRO n 1 46 ASP n 1 47 ALA n 1 48 LYS n 1 49 SER n 1 50 PHE n 1 51 VAL n 1 52 LEU n 1 53 ASN n 1 54 LEU n 1 55 GLY n 1 56 LYS n 1 57 ASP n 1 58 SER n 1 59 ASN n 1 60 ASN n 1 61 LEU n 1 62 CSO n 1 63 LEU n 1 64 HIS n 1 65 PHE n 1 66 ASN n 1 67 PRO n 1 68 ARG n 1 69 PHE n 1 70 ASN n 1 71 ALA n 1 72 HIS n 1 73 GLY n 1 74 ASP n 1 75 ALA n 1 76 ASN n 1 77 THR n 1 78 ILE n 1 79 VAL n 1 80 CSO n 1 81 ASN n 1 82 SER n 1 83 LYS n 1 84 ASP n 1 85 GLY n 1 86 GLY n 1 87 ALA n 1 88 TRP n 1 89 GLY n 1 90 THR n 1 91 GLU n 1 92 GLN n 1 93 ARG n 1 94 GLU n 1 95 ALA n 1 96 VAL n 1 97 PHE n 1 98 PRO n 1 99 PHE n 1 100 GLN n 1 101 PRO n 1 102 GLY n 1 103 SER n 1 104 VAL n 1 105 ALA n 1 106 GLU n 1 107 VAL n 1 108 CSO n 1 109 ILE n 1 110 THR n 1 111 PHE n 1 112 ASP n 1 113 GLN n 1 114 ALA n 1 115 ASN n 1 116 LEU n 1 117 THR n 1 118 VAL n 1 119 LYS n 1 120 LEU n 1 121 PRO n 1 122 ASP n 1 123 GLY n 1 124 TYR n 1 125 GLU n 1 126 PHE n 1 127 LYS n 1 128 PHE n 1 129 PRO n 1 130 ASN n 1 131 ARG n 1 132 LEU n 1 133 ASN n 1 134 LEU n 1 135 GLU n 1 136 ALA n 1 137 ILE n 1 138 ASN n 1 139 TYR n 1 140 MET n 1 141 ALA n 1 142 ALA n 1 143 ASP n 1 144 GLY n 1 145 ASP n 1 146 PHE n 1 147 LYS n 1 148 ILE n 1 149 LYS n 1 150 CSO n 1 151 VAL n 1 152 ALA n 1 153 PHE n 1 154 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 154 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LGALS1 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LEG1_HUMAN _struct_ref.pdbx_db_accession P09382 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;CGLVASNLNLKPGECLRVRGEVAPDAKSFVLNLGKDSNNLCLHFNPRFNAHGDANTIVCNSKDGGAWGTEQREAVFPFQP GSVAEVCITFDQANLTVKLPDGYEFKFPNRLNLEAINYMAADGDFKIKCVAFD ; _struct_ref.pdbx_align_begin 3 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4Y1X A 22 ? 154 ? P09382 3 ? 135 ? 2 134 2 1 4Y1X B 22 ? 154 ? P09382 3 ? 135 ? 2 134 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4Y1X MET A 1 ? UNP P09382 ? ? 'expression tag' -19 1 1 4Y1X GLY A 2 ? UNP P09382 ? ? 'expression tag' -18 2 1 4Y1X SER A 3 ? UNP P09382 ? ? 'expression tag' -17 3 1 4Y1X SER A 4 ? UNP P09382 ? ? 'expression tag' -16 4 1 4Y1X HIS A 5 ? UNP P09382 ? ? 'expression tag' -15 5 1 4Y1X HIS A 6 ? UNP P09382 ? ? 'expression tag' -14 6 1 4Y1X HIS A 7 ? UNP P09382 ? ? 'expression tag' -13 7 1 4Y1X HIS A 8 ? UNP P09382 ? ? 'expression tag' -12 8 1 4Y1X HIS A 9 ? UNP P09382 ? ? 'expression tag' -11 9 1 4Y1X HIS A 10 ? UNP P09382 ? ? 'expression tag' -10 10 1 4Y1X SER A 11 ? UNP P09382 ? ? 'expression tag' -9 11 1 4Y1X SER A 12 ? UNP P09382 ? ? 'expression tag' -8 12 1 4Y1X GLY A 13 ? UNP P09382 ? ? 'expression tag' -7 13 1 4Y1X LEU A 14 ? UNP P09382 ? ? 'expression tag' -6 14 1 4Y1X VAL A 15 ? UNP P09382 ? ? 'expression tag' -5 15 1 4Y1X PRO A 16 ? UNP P09382 ? ? 'expression tag' -4 16 1 4Y1X ARG A 17 ? UNP P09382 ? ? 'expression tag' -3 17 1 4Y1X GLY A 18 ? UNP P09382 ? ? 'expression tag' -2 18 1 4Y1X SER A 19 ? UNP P09382 ? ? 'expression tag' -1 19 1 4Y1X HIS A 20 ? UNP P09382 ? ? 'expression tag' 0 20 1 4Y1X MET A 21 ? UNP P09382 ? ? 'expression tag' 1 21 2 4Y1X MET B 1 ? UNP P09382 ? ? 'expression tag' -19 22 2 4Y1X GLY B 2 ? UNP P09382 ? ? 'expression tag' -18 23 2 4Y1X SER B 3 ? UNP P09382 ? ? 'expression tag' -17 24 2 4Y1X SER B 4 ? UNP P09382 ? ? 'expression tag' -16 25 2 4Y1X HIS B 5 ? UNP P09382 ? ? 'expression tag' -15 26 2 4Y1X HIS B 6 ? UNP P09382 ? ? 'expression tag' -14 27 2 4Y1X HIS B 7 ? UNP P09382 ? ? 'expression tag' -13 28 2 4Y1X HIS B 8 ? UNP P09382 ? ? 'expression tag' -12 29 2 4Y1X HIS B 9 ? UNP P09382 ? ? 'expression tag' -11 30 2 4Y1X HIS B 10 ? UNP P09382 ? ? 'expression tag' -10 31 2 4Y1X SER B 11 ? UNP P09382 ? ? 'expression tag' -9 32 2 4Y1X SER B 12 ? UNP P09382 ? ? 'expression tag' -8 33 2 4Y1X GLY B 13 ? UNP P09382 ? ? 'expression tag' -7 34 2 4Y1X LEU B 14 ? UNP P09382 ? ? 'expression tag' -6 35 2 4Y1X VAL B 15 ? UNP P09382 ? ? 'expression tag' -5 36 2 4Y1X PRO B 16 ? UNP P09382 ? ? 'expression tag' -4 37 2 4Y1X ARG B 17 ? UNP P09382 ? ? 'expression tag' -3 38 2 4Y1X GLY B 18 ? UNP P09382 ? ? 'expression tag' -2 39 2 4Y1X SER B 19 ? UNP P09382 ? ? 'expression tag' -1 40 2 4Y1X HIS B 20 ? UNP P09382 ? ? 'expression tag' 0 41 2 4Y1X MET B 21 ? UNP P09382 ? ? 'expression tag' 1 42 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 6S2 D-saccharide n 'methyl 2-acetamido-2-deoxy-6-O-sulfo-beta-D-glucopyranoside' ? 'C9 H17 N O9 S' 315.298 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CSO 'L-peptide linking' n S-HYDROXYCYSTEINE ? 'C3 H7 N O3 S' 137.158 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GAL 'D-saccharide, beta linking' . beta-D-galactopyranose ? 'C6 H12 O6' 180.156 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4Y1X _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.05 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Tris (pH 8.0), 0.2 M Li2SO4, 30% (w/v) PEG 3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-08-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97622 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSRRC BEAMLINE BL13C1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97622 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL13C1 _diffrn_source.pdbx_synchrotron_site NSRRC # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4Y1X _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.450 _reflns.d_resolution_low 30.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10845 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.700 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.100 _reflns.pdbx_Rmerge_I_obs 0.068 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 22.570 _reflns.pdbx_netI_over_sigmaI 12.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.980 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 54812 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.450 2.540 ? ? ? ? ? 1055 ? 99.600 ? ? ? ? 0.496 ? ? ? ? ? ? ? ? 5.100 ? 0.901 ? ? ? ? 0 1 1 ? ? 2.540 2.640 ? ? ? ? ? 1053 ? 100.000 ? ? ? ? 0.347 ? ? ? ? ? ? ? ? 5.300 ? 0.938 ? ? ? ? 0 2 1 ? ? 2.640 2.760 ? ? ? ? ? 1085 ? 100.000 ? ? ? ? 0.260 ? ? ? ? ? ? ? ? 5.300 ? 0.973 ? ? ? ? 0 3 1 ? ? 2.760 2.900 ? ? ? ? ? 1060 ? 100.000 ? ? ? ? 0.180 ? ? ? ? ? ? ? ? 5.300 ? 0.996 ? ? ? ? 0 4 1 ? ? 2.900 3.090 ? ? ? ? ? 1062 ? 99.900 ? ? ? ? 0.133 ? ? ? ? ? ? ? ? 5.300 ? 0.999 ? ? ? ? 0 5 1 ? ? 3.090 3.320 ? ? ? ? ? 1084 ? 99.900 ? ? ? ? 0.090 ? ? ? ? ? ? ? ? 5.200 ? 0.993 ? ? ? ? 0 6 1 ? ? 3.320 3.660 ? ? ? ? ? 1074 ? 100.000 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 5.200 ? 0.938 ? ? ? ? 0 7 1 ? ? 3.660 4.190 ? ? ? ? ? 1087 ? 99.800 ? ? ? ? 0.047 ? ? ? ? ? ? ? ? 5.100 ? 0.951 ? ? ? ? 0 8 1 ? ? 4.190 5.270 ? ? ? ? ? 1111 ? 99.100 ? ? ? ? 0.041 ? ? ? ? ? ? ? ? 4.700 ? 1.082 ? ? ? ? 0 9 1 ? ? 5.270 30.000 ? ? ? ? ? 1174 ? 98.500 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 4.300 ? 1.036 ? ? ? ? 0 10 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 104.640 _refine.B_iso_mean 29.0271 _refine.B_iso_min 5.600 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4Y1X _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.45 _refine.ls_d_res_low 25.2930 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 9873 _refine.ls_number_reflns_R_free 994 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.2100 _refine.ls_percent_reflns_R_free 10.0700 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2145 _refine.ls_R_factor_R_free 0.2590 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2097 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 24.1500 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.45 _refine_hist.d_res_low 25.2930 _refine_hist.pdbx_number_atoms_ligand 62 _refine_hist.number_atoms_solvent 51 _refine_hist.number_atoms_total 2159 _refine_hist.pdbx_number_residues_total 266 _refine_hist.pdbx_B_iso_mean_ligand 52.22 _refine_hist.pdbx_B_iso_mean_solvent 24.77 _refine_hist.pdbx_number_atoms_protein 2046 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # _struct.entry_id 4Y1X _struct.title 'Complex of human Galectin-1 and Galbeta1-4(6OSO3)GlcNAc' _struct.pdbx_descriptor Galectin-1 _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4Y1X _struct_keywords.text 'Complex, Galectin-1, sulfated LacNAc, Galbeta1-4(6OSO3)GlcNAc, SUGAR BINDING PROTEIN' _struct_keywords.pdbx_keywords 'SUGAR BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 2 ? E N N 3 ? F N N 3 ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A LEU 61 C ? ? ? 1_555 A CSO 62 N ? ? A LEU 41 A CSO 42 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A CSO 62 C ? ? ? 1_555 A LEU 63 N ? ? A CSO 42 A LEU 43 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale3 covale both ? A VAL 79 C ? ? ? 1_555 A CSO 80 N ? ? A VAL 59 A CSO 60 1_555 ? ? ? ? ? ? ? 1.325 ? ? covale4 covale both ? A CSO 80 C ? ? ? 1_555 A ASN 81 N ? ? A CSO 60 A ASN 61 1_555 ? ? ? ? ? ? ? 1.324 ? ? covale5 covale both ? A VAL 107 C ? ? ? 1_555 A CSO 108 N ? ? A VAL 87 A CSO 88 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale6 covale both ? A CSO 108 C ? ? ? 1_555 A ILE 109 N ? ? A CSO 88 A ILE 89 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale7 covale both ? A LYS 149 C ? ? ? 1_555 A CSO 150 N ? ? A LYS 129 A CSO 130 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale8 covale both ? A CSO 150 C ? ? ? 1_555 A VAL 151 N ? ? A CSO 130 A VAL 131 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale9 covale both ? B LEU 61 C ? ? ? 1_555 B CSO 62 N ? ? B LEU 41 B CSO 42 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale10 covale both ? B CSO 62 C ? ? ? 1_555 B LEU 63 N ? ? B CSO 42 B LEU 43 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale11 covale both ? B VAL 79 C ? ? ? 1_555 B CSO 80 N ? ? B VAL 59 B CSO 60 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale12 covale both ? B CSO 80 C ? ? ? 1_555 B ASN 81 N ? ? B CSO 60 B ASN 61 1_555 ? ? ? ? ? ? ? 1.326 ? ? covale13 covale both ? B VAL 107 C ? ? ? 1_555 B CSO 108 N ? ? B VAL 87 B CSO 88 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale14 covale both ? B CSO 108 C ? ? ? 1_555 B ILE 109 N ? ? B CSO 88 B ILE 89 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale15 covale both ? B LYS 149 C ? ? ? 1_555 B CSO 150 N ? ? B LYS 129 B CSO 130 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale16 covale both ? B CSO 150 C ? ? ? 1_555 B VAL 151 N ? ? B CSO 130 B VAL 131 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale17 covale both ? C 6S2 . O4 ? ? ? 1_555 C GAL . C1 ? ? C 6S2 1 C GAL 2 1_555 ? ? ? ? ? ? ? 1.428 sing ? covale18 covale both ? D 6S2 . O4 ? ? ? 1_555 D GAL . C1 ? ? D 6S2 1 D GAL 2 1_555 ? ? ? ? ? ? ? 1.433 sing ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 12 ? AA2 ? 12 ? AA3 ? 10 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel AA1 11 12 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA2 8 9 ? anti-parallel AA2 9 10 ? anti-parallel AA2 10 11 ? anti-parallel AA2 11 12 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel AA3 4 5 ? anti-parallel AA3 5 6 ? anti-parallel AA3 6 7 ? anti-parallel AA3 7 8 ? anti-parallel AA3 8 9 ? anti-parallel AA3 9 10 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 87 ? TRP A 88 ? ALA A 67 TRP A 68 AA1 2 ASP A 74 ? ASP A 84 ? ASP A 54 ASP A 64 AA1 3 ASN A 60 ? ALA A 71 ? ASN A 40 ALA A 51 AA1 4 PHE A 50 ? ASP A 57 ? PHE A 30 ASP A 37 AA1 5 ILE A 137 ? GLY A 144 ? ILE A 117 GLY A 124 AA1 6 VAL A 25 ? LEU A 31 ? VAL A 5 LEU A 11 AA1 7 VAL B 25 ? LEU B 31 ? VAL B 5 LEU B 11 AA1 8 ILE B 137 ? GLY B 144 ? ILE B 117 GLY B 124 AA1 9 PHE B 50 ? ASP B 57 ? PHE B 30 ASP B 37 AA1 10 ASN B 60 ? ALA B 71 ? ASN B 40 ALA B 51 AA1 11 ASP B 74 ? ASP B 84 ? ASP B 54 ASP B 64 AA1 12 ALA B 87 ? TRP B 88 ? ALA B 67 TRP B 68 AA2 1 GLN A 92 ? GLU A 94 ? GLN A 72 GLU A 74 AA2 2 ASP A 74 ? ASP A 84 ? ASP A 54 ASP A 64 AA2 3 ASN A 60 ? ALA A 71 ? ASN A 40 ALA A 51 AA2 4 PHE A 50 ? ASP A 57 ? PHE A 30 ASP A 37 AA2 5 ILE A 137 ? GLY A 144 ? ILE A 117 GLY A 124 AA2 6 VAL A 25 ? LEU A 31 ? VAL A 5 LEU A 11 AA2 7 VAL B 25 ? LEU B 31 ? VAL B 5 LEU B 11 AA2 8 ILE B 137 ? GLY B 144 ? ILE B 117 GLY B 124 AA2 9 PHE B 50 ? ASP B 57 ? PHE B 30 ASP B 37 AA2 10 ASN B 60 ? ALA B 71 ? ASN B 40 ALA B 51 AA2 11 ASP B 74 ? ASP B 84 ? ASP B 54 ASP B 64 AA2 12 GLN B 92 ? GLU B 94 ? GLN B 72 GLU B 74 AA3 1 GLU A 125 ? PRO A 129 ? GLU A 105 PRO A 109 AA3 2 ASN A 115 ? LYS A 119 ? ASN A 95 LYS A 99 AA3 3 SER A 103 ? PHE A 111 ? SER A 83 PHE A 91 AA3 4 LEU A 37 ? VAL A 43 ? LEU A 17 VAL A 23 AA3 5 PHE A 146 ? PHE A 153 ? PHE A 126 PHE A 133 AA3 6 PHE B 146 ? ASP B 154 ? PHE B 126 ASP B 134 AA3 7 CYS B 36 ? VAL B 43 ? CYS B 16 VAL B 23 AA3 8 SER B 103 ? PHE B 111 ? SER B 83 PHE B 91 AA3 9 ASN B 115 ? LYS B 119 ? ASN B 95 LYS B 99 AA3 10 GLU B 125 ? PRO B 129 ? GLU B 105 PRO B 109 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 87 ? O ALA A 67 N ASP A 84 ? N ASP A 64 AA1 2 3 O THR A 77 ? O THR A 57 N ARG A 68 ? N ARG A 48 AA1 3 4 O PHE A 65 ? O PHE A 45 N LEU A 52 ? N LEU A 32 AA1 4 5 N ASN A 53 ? N ASN A 33 O ALA A 141 ? O ALA A 121 AA1 5 6 O MET A 140 ? O MET A 120 N ALA A 26 ? N ALA A 6 AA1 6 7 N VAL A 25 ? N VAL A 5 O SER B 27 ? O SER B 7 AA1 7 8 N ALA B 26 ? N ALA B 6 O MET B 140 ? O MET B 120 AA1 8 9 O ALA B 141 ? O ALA B 121 N ASN B 53 ? N ASN B 33 AA1 9 10 N LEU B 52 ? N LEU B 32 O PHE B 65 ? O PHE B 45 AA1 10 11 N ARG B 68 ? N ARG B 48 O THR B 77 ? O THR B 57 AA1 11 12 N ASP B 84 ? N ASP B 64 O ALA B 87 ? O ALA B 67 AA2 1 2 O GLN A 92 ? O GLN A 72 N CSO A 80 ? N CSO A 60 AA2 2 3 O THR A 77 ? O THR A 57 N ARG A 68 ? N ARG A 48 AA2 3 4 O PHE A 65 ? O PHE A 45 N LEU A 52 ? N LEU A 32 AA2 4 5 N ASN A 53 ? N ASN A 33 O ALA A 141 ? O ALA A 121 AA2 5 6 O MET A 140 ? O MET A 120 N ALA A 26 ? N ALA A 6 AA2 6 7 N VAL A 25 ? N VAL A 5 O SER B 27 ? O SER B 7 AA2 7 8 N ALA B 26 ? N ALA B 6 O MET B 140 ? O MET B 120 AA2 8 9 O ALA B 141 ? O ALA B 121 N ASN B 53 ? N ASN B 33 AA2 9 10 N LEU B 52 ? N LEU B 32 O PHE B 65 ? O PHE B 45 AA2 10 11 N ARG B 68 ? N ARG B 48 O THR B 77 ? O THR B 57 AA2 11 12 N CSO B 80 ? N CSO B 60 O GLN B 92 ? O GLN B 72 AA3 1 2 O PHE A 128 ? O PHE A 108 N LEU A 116 ? N LEU A 96 AA3 2 3 O LYS A 119 ? O LYS A 99 N CSO A 108 ? N CSO A 88 AA3 3 4 O ILE A 109 ? O ILE A 89 N LEU A 37 ? N LEU A 17 AA3 4 5 N ARG A 38 ? N ARG A 18 O ALA A 152 ? O ALA A 132 AA3 5 6 N PHE A 153 ? N PHE A 133 O LYS B 149 ? O LYS B 129 AA3 6 7 O ALA B 152 ? O ALA B 132 N ARG B 38 ? N ARG B 18 AA3 7 8 N VAL B 39 ? N VAL B 19 O VAL B 107 ? O VAL B 87 AA3 8 9 N CSO B 108 ? N CSO B 88 O LYS B 119 ? O LYS B 99 AA3 9 10 N LEU B 116 ? N LEU B 96 O PHE B 128 ? O PHE B 108 # _atom_sites.entry_id 4Y1X _atom_sites.fract_transf_matrix[1][1] 0.022947 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017476 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009013 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -19 ? ? ? A . n A 1 2 GLY 2 -18 ? ? ? A . n A 1 3 SER 3 -17 ? ? ? A . n A 1 4 SER 4 -16 ? ? ? A . n A 1 5 HIS 5 -15 ? ? ? A . n A 1 6 HIS 6 -14 ? ? ? A . n A 1 7 HIS 7 -13 ? ? ? A . n A 1 8 HIS 8 -12 ? ? ? A . n A 1 9 HIS 9 -11 ? ? ? A . n A 1 10 HIS 10 -10 ? ? ? A . n A 1 11 SER 11 -9 ? ? ? A . n A 1 12 SER 12 -8 ? ? ? A . n A 1 13 GLY 13 -7 ? ? ? A . n A 1 14 LEU 14 -6 ? ? ? A . n A 1 15 VAL 15 -5 ? ? ? A . n A 1 16 PRO 16 -4 ? ? ? A . n A 1 17 ARG 17 -3 ? ? ? A . n A 1 18 GLY 18 -2 ? ? ? A . n A 1 19 SER 19 -1 ? ? ? A . n A 1 20 HIS 20 0 ? ? ? A . n A 1 21 MET 21 1 ? ? ? A . n A 1 22 CYS 22 2 2 CYS CYS A . n A 1 23 GLY 23 3 3 GLY GLY A . n A 1 24 LEU 24 4 4 LEU LEU A . n A 1 25 VAL 25 5 5 VAL VAL A . n A 1 26 ALA 26 6 6 ALA ALA A . n A 1 27 SER 27 7 7 SER SER A . n A 1 28 ASN 28 8 8 ASN ASN A . n A 1 29 LEU 29 9 9 LEU LEU A . n A 1 30 ASN 30 10 10 ASN ASN A . n A 1 31 LEU 31 11 11 LEU LEU A . n A 1 32 LYS 32 12 12 LYS LYS A . n A 1 33 PRO 33 13 13 PRO PRO A . n A 1 34 GLY 34 14 14 GLY GLY A . n A 1 35 GLU 35 15 15 GLU GLU A . n A 1 36 CYS 36 16 16 CYS CYS A . n A 1 37 LEU 37 17 17 LEU LEU A . n A 1 38 ARG 38 18 18 ARG ARG A . n A 1 39 VAL 39 19 19 VAL VAL A . n A 1 40 ARG 40 20 20 ARG ARG A . n A 1 41 GLY 41 21 21 GLY GLY A . n A 1 42 GLU 42 22 22 GLU GLU A . n A 1 43 VAL 43 23 23 VAL VAL A . n A 1 44 ALA 44 24 24 ALA ALA A . n A 1 45 PRO 45 25 25 PRO PRO A . n A 1 46 ASP 46 26 26 ASP ASP A . n A 1 47 ALA 47 27 27 ALA ALA A . n A 1 48 LYS 48 28 28 LYS LYS A . n A 1 49 SER 49 29 29 SER SER A . n A 1 50 PHE 50 30 30 PHE PHE A . n A 1 51 VAL 51 31 31 VAL VAL A . n A 1 52 LEU 52 32 32 LEU LEU A . n A 1 53 ASN 53 33 33 ASN ASN A . n A 1 54 LEU 54 34 34 LEU LEU A . n A 1 55 GLY 55 35 35 GLY GLY A . n A 1 56 LYS 56 36 36 LYS LYS A . n A 1 57 ASP 57 37 37 ASP ASP A . n A 1 58 SER 58 38 38 SER SER A . n A 1 59 ASN 59 39 39 ASN ASN A . n A 1 60 ASN 60 40 40 ASN ASN A . n A 1 61 LEU 61 41 41 LEU LEU A . n A 1 62 CSO 62 42 42 CSO CSO A . n A 1 63 LEU 63 43 43 LEU LEU A . n A 1 64 HIS 64 44 44 HIS HIS A . n A 1 65 PHE 65 45 45 PHE PHE A . n A 1 66 ASN 66 46 46 ASN ASN A . n A 1 67 PRO 67 47 47 PRO PRO A . n A 1 68 ARG 68 48 48 ARG ARG A . n A 1 69 PHE 69 49 49 PHE PHE A . n A 1 70 ASN 70 50 50 ASN ASN A . n A 1 71 ALA 71 51 51 ALA ALA A . n A 1 72 HIS 72 52 52 HIS HIS A . n A 1 73 GLY 73 53 53 GLY GLY A . n A 1 74 ASP 74 54 54 ASP ASP A . n A 1 75 ALA 75 55 55 ALA ALA A . n A 1 76 ASN 76 56 56 ASN ASN A . n A 1 77 THR 77 57 57 THR THR A . n A 1 78 ILE 78 58 58 ILE ILE A . n A 1 79 VAL 79 59 59 VAL VAL A . n A 1 80 CSO 80 60 60 CSO CSO A . n A 1 81 ASN 81 61 61 ASN ASN A . n A 1 82 SER 82 62 62 SER SER A . n A 1 83 LYS 83 63 63 LYS LYS A . n A 1 84 ASP 84 64 64 ASP ASP A . n A 1 85 GLY 85 65 65 GLY GLY A . n A 1 86 GLY 86 66 66 GLY GLY A . n A 1 87 ALA 87 67 67 ALA ALA A . n A 1 88 TRP 88 68 68 TRP TRP A . n A 1 89 GLY 89 69 69 GLY GLY A . n A 1 90 THR 90 70 70 THR THR A . n A 1 91 GLU 91 71 71 GLU GLU A . n A 1 92 GLN 92 72 72 GLN GLN A . n A 1 93 ARG 93 73 73 ARG ARG A . n A 1 94 GLU 94 74 74 GLU GLU A . n A 1 95 ALA 95 75 75 ALA ALA A . n A 1 96 VAL 96 76 76 VAL VAL A . n A 1 97 PHE 97 77 77 PHE PHE A . n A 1 98 PRO 98 78 78 PRO PRO A . n A 1 99 PHE 99 79 79 PHE PHE A . n A 1 100 GLN 100 80 80 GLN GLN A . n A 1 101 PRO 101 81 81 PRO PRO A . n A 1 102 GLY 102 82 82 GLY GLY A . n A 1 103 SER 103 83 83 SER SER A . n A 1 104 VAL 104 84 84 VAL VAL A . n A 1 105 ALA 105 85 85 ALA ALA A . n A 1 106 GLU 106 86 86 GLU GLU A . n A 1 107 VAL 107 87 87 VAL VAL A . n A 1 108 CSO 108 88 88 CSO CSO A . n A 1 109 ILE 109 89 89 ILE ILE A . n A 1 110 THR 110 90 90 THR THR A . n A 1 111 PHE 111 91 91 PHE PHE A . n A 1 112 ASP 112 92 92 ASP ASP A . n A 1 113 GLN 113 93 93 GLN GLN A . n A 1 114 ALA 114 94 94 ALA ALA A . n A 1 115 ASN 115 95 95 ASN ASN A . n A 1 116 LEU 116 96 96 LEU LEU A . n A 1 117 THR 117 97 97 THR THR A . n A 1 118 VAL 118 98 98 VAL VAL A . n A 1 119 LYS 119 99 99 LYS LYS A . n A 1 120 LEU 120 100 100 LEU LEU A . n A 1 121 PRO 121 101 101 PRO PRO A . n A 1 122 ASP 122 102 102 ASP ASP A . n A 1 123 GLY 123 103 103 GLY GLY A . n A 1 124 TYR 124 104 104 TYR TYR A . n A 1 125 GLU 125 105 105 GLU GLU A . n A 1 126 PHE 126 106 106 PHE PHE A . n A 1 127 LYS 127 107 107 LYS LYS A . n A 1 128 PHE 128 108 108 PHE PHE A . n A 1 129 PRO 129 109 109 PRO PRO A . n A 1 130 ASN 130 110 110 ASN ASN A . n A 1 131 ARG 131 111 111 ARG ARG A . n A 1 132 LEU 132 112 112 LEU LEU A . n A 1 133 ASN 133 113 113 ASN ASN A . n A 1 134 LEU 134 114 114 LEU LEU A . n A 1 135 GLU 135 115 115 GLU GLU A . n A 1 136 ALA 136 116 116 ALA ALA A . n A 1 137 ILE 137 117 117 ILE ILE A . n A 1 138 ASN 138 118 118 ASN ASN A . n A 1 139 TYR 139 119 119 TYR TYR A . n A 1 140 MET 140 120 120 MET MET A . n A 1 141 ALA 141 121 121 ALA ALA A . n A 1 142 ALA 142 122 122 ALA ALA A . n A 1 143 ASP 143 123 123 ASP ASP A . n A 1 144 GLY 144 124 124 GLY GLY A . n A 1 145 ASP 145 125 125 ASP ASP A . n A 1 146 PHE 146 126 126 PHE PHE A . n A 1 147 LYS 147 127 127 LYS LYS A . n A 1 148 ILE 148 128 128 ILE ILE A . n A 1 149 LYS 149 129 129 LYS LYS A . n A 1 150 CSO 150 130 130 CSO CSO A . n A 1 151 VAL 151 131 131 VAL VAL A . n A 1 152 ALA 152 132 132 ALA ALA A . n A 1 153 PHE 153 133 133 PHE PHE A . n A 1 154 ASP 154 134 134 ASP ASP A . n B 1 1 MET 1 -19 ? ? ? B . n B 1 2 GLY 2 -18 ? ? ? B . n B 1 3 SER 3 -17 ? ? ? B . n B 1 4 SER 4 -16 ? ? ? B . n B 1 5 HIS 5 -15 ? ? ? B . n B 1 6 HIS 6 -14 ? ? ? B . n B 1 7 HIS 7 -13 ? ? ? B . n B 1 8 HIS 8 -12 ? ? ? B . n B 1 9 HIS 9 -11 ? ? ? B . n B 1 10 HIS 10 -10 ? ? ? B . n B 1 11 SER 11 -9 ? ? ? B . n B 1 12 SER 12 -8 ? ? ? B . n B 1 13 GLY 13 -7 ? ? ? B . n B 1 14 LEU 14 -6 ? ? ? B . n B 1 15 VAL 15 -5 ? ? ? B . n B 1 16 PRO 16 -4 ? ? ? B . n B 1 17 ARG 17 -3 ? ? ? B . n B 1 18 GLY 18 -2 ? ? ? B . n B 1 19 SER 19 -1 ? ? ? B . n B 1 20 HIS 20 0 ? ? ? B . n B 1 21 MET 21 1 ? ? ? B . n B 1 22 CYS 22 2 2 CYS CYS B . n B 1 23 GLY 23 3 3 GLY GLY B . n B 1 24 LEU 24 4 4 LEU LEU B . n B 1 25 VAL 25 5 5 VAL VAL B . n B 1 26 ALA 26 6 6 ALA ALA B . n B 1 27 SER 27 7 7 SER SER B . n B 1 28 ASN 28 8 8 ASN ASN B . n B 1 29 LEU 29 9 9 LEU LEU B . n B 1 30 ASN 30 10 10 ASN ASN B . n B 1 31 LEU 31 11 11 LEU LEU B . n B 1 32 LYS 32 12 12 LYS LYS B . n B 1 33 PRO 33 13 13 PRO PRO B . n B 1 34 GLY 34 14 14 GLY GLY B . n B 1 35 GLU 35 15 15 GLU GLU B . n B 1 36 CYS 36 16 16 CYS CYS B . n B 1 37 LEU 37 17 17 LEU LEU B . n B 1 38 ARG 38 18 18 ARG ARG B . n B 1 39 VAL 39 19 19 VAL VAL B . n B 1 40 ARG 40 20 20 ARG ARG B . n B 1 41 GLY 41 21 21 GLY GLY B . n B 1 42 GLU 42 22 22 GLU GLU B . n B 1 43 VAL 43 23 23 VAL VAL B . n B 1 44 ALA 44 24 24 ALA ALA B . n B 1 45 PRO 45 25 25 PRO PRO B . n B 1 46 ASP 46 26 26 ASP ASP B . n B 1 47 ALA 47 27 27 ALA ALA B . n B 1 48 LYS 48 28 28 LYS LYS B . n B 1 49 SER 49 29 29 SER SER B . n B 1 50 PHE 50 30 30 PHE PHE B . n B 1 51 VAL 51 31 31 VAL VAL B . n B 1 52 LEU 52 32 32 LEU LEU B . n B 1 53 ASN 53 33 33 ASN ASN B . n B 1 54 LEU 54 34 34 LEU LEU B . n B 1 55 GLY 55 35 35 GLY GLY B . n B 1 56 LYS 56 36 36 LYS LYS B . n B 1 57 ASP 57 37 37 ASP ASP B . n B 1 58 SER 58 38 38 SER SER B . n B 1 59 ASN 59 39 39 ASN ASN B . n B 1 60 ASN 60 40 40 ASN ASN B . n B 1 61 LEU 61 41 41 LEU LEU B . n B 1 62 CSO 62 42 42 CSO CSO B . n B 1 63 LEU 63 43 43 LEU LEU B . n B 1 64 HIS 64 44 44 HIS HIS B . n B 1 65 PHE 65 45 45 PHE PHE B . n B 1 66 ASN 66 46 46 ASN ASN B . n B 1 67 PRO 67 47 47 PRO PRO B . n B 1 68 ARG 68 48 48 ARG ARG B . n B 1 69 PHE 69 49 49 PHE PHE B . n B 1 70 ASN 70 50 50 ASN ASN B . n B 1 71 ALA 71 51 51 ALA ALA B . n B 1 72 HIS 72 52 52 HIS HIS B . n B 1 73 GLY 73 53 53 GLY GLY B . n B 1 74 ASP 74 54 54 ASP ASP B . n B 1 75 ALA 75 55 55 ALA ALA B . n B 1 76 ASN 76 56 56 ASN ASN B . n B 1 77 THR 77 57 57 THR THR B . n B 1 78 ILE 78 58 58 ILE ILE B . n B 1 79 VAL 79 59 59 VAL VAL B . n B 1 80 CSO 80 60 60 CSO CSO B . n B 1 81 ASN 81 61 61 ASN ASN B . n B 1 82 SER 82 62 62 SER SER B . n B 1 83 LYS 83 63 63 LYS LYS B . n B 1 84 ASP 84 64 64 ASP ASP B . n B 1 85 GLY 85 65 65 GLY GLY B . n B 1 86 GLY 86 66 66 GLY GLY B . n B 1 87 ALA 87 67 67 ALA ALA B . n B 1 88 TRP 88 68 68 TRP TRP B . n B 1 89 GLY 89 69 69 GLY GLY B . n B 1 90 THR 90 70 70 THR THR B . n B 1 91 GLU 91 71 71 GLU GLU B . n B 1 92 GLN 92 72 72 GLN GLN B . n B 1 93 ARG 93 73 73 ARG ARG B . n B 1 94 GLU 94 74 74 GLU GLU B . n B 1 95 ALA 95 75 75 ALA ALA B . n B 1 96 VAL 96 76 76 VAL VAL B . n B 1 97 PHE 97 77 77 PHE PHE B . n B 1 98 PRO 98 78 78 PRO PRO B . n B 1 99 PHE 99 79 79 PHE PHE B . n B 1 100 GLN 100 80 80 GLN GLN B . n B 1 101 PRO 101 81 81 PRO PRO B . n B 1 102 GLY 102 82 82 GLY GLY B . n B 1 103 SER 103 83 83 SER SER B . n B 1 104 VAL 104 84 84 VAL VAL B . n B 1 105 ALA 105 85 85 ALA ALA B . n B 1 106 GLU 106 86 86 GLU GLU B . n B 1 107 VAL 107 87 87 VAL VAL B . n B 1 108 CSO 108 88 88 CSO CSO B . n B 1 109 ILE 109 89 89 ILE ILE B . n B 1 110 THR 110 90 90 THR THR B . n B 1 111 PHE 111 91 91 PHE PHE B . n B 1 112 ASP 112 92 92 ASP ASP B . n B 1 113 GLN 113 93 93 GLN GLN B . n B 1 114 ALA 114 94 94 ALA ALA B . n B 1 115 ASN 115 95 95 ASN ASN B . n B 1 116 LEU 116 96 96 LEU LEU B . n B 1 117 THR 117 97 97 THR THR B . n B 1 118 VAL 118 98 98 VAL VAL B . n B 1 119 LYS 119 99 99 LYS LYS B . n B 1 120 LEU 120 100 100 LEU LEU B . n B 1 121 PRO 121 101 101 PRO PRO B . n B 1 122 ASP 122 102 102 ASP ASP B . n B 1 123 GLY 123 103 103 GLY GLY B . n B 1 124 TYR 124 104 104 TYR TYR B . n B 1 125 GLU 125 105 105 GLU GLU B . n B 1 126 PHE 126 106 106 PHE PHE B . n B 1 127 LYS 127 107 107 LYS LYS B . n B 1 128 PHE 128 108 108 PHE PHE B . n B 1 129 PRO 129 109 109 PRO PRO B . n B 1 130 ASN 130 110 110 ASN ASN B . n B 1 131 ARG 131 111 111 ARG ARG B . n B 1 132 LEU 132 112 112 LEU LEU B . n B 1 133 ASN 133 113 113 ASN ASN B . n B 1 134 LEU 134 114 114 LEU LEU B . n B 1 135 GLU 135 115 115 GLU GLU B . n B 1 136 ALA 136 116 116 ALA ALA B . n B 1 137 ILE 137 117 117 ILE ILE B . n B 1 138 ASN 138 118 118 ASN ASN B . n B 1 139 TYR 139 119 119 TYR TYR B . n B 1 140 MET 140 120 120 MET MET B . n B 1 141 ALA 141 121 121 ALA ALA B . n B 1 142 ALA 142 122 122 ALA ALA B . n B 1 143 ASP 143 123 123 ASP ASP B . n B 1 144 GLY 144 124 124 GLY GLY B . n B 1 145 ASP 145 125 125 ASP ASP B . n B 1 146 PHE 146 126 126 PHE PHE B . n B 1 147 LYS 147 127 127 LYS LYS B . n B 1 148 ILE 148 128 128 ILE ILE B . n B 1 149 LYS 149 129 129 LYS LYS B . n B 1 150 CSO 150 130 130 CSO CSO B . n B 1 151 VAL 151 131 131 VAL VAL B . n B 1 152 ALA 152 132 132 ALA ALA B . n B 1 153 PHE 153 133 133 PHE PHE B . n B 1 154 ASP 154 134 134 ASP ASP B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 3 HOH 1 301 7 HOH HOH A . E 3 HOH 2 302 23 HOH HOH A . E 3 HOH 3 303 42 HOH HOH A . E 3 HOH 4 304 27 HOH HOH A . E 3 HOH 5 305 43 HOH HOH A . E 3 HOH 6 306 22 HOH HOH A . E 3 HOH 7 307 18 HOH HOH A . E 3 HOH 8 308 19 HOH HOH A . E 3 HOH 9 309 1 HOH HOH A . E 3 HOH 10 310 26 HOH HOH A . E 3 HOH 11 311 34 HOH HOH A . E 3 HOH 12 312 10 HOH HOH A . E 3 HOH 13 313 45 HOH HOH A . E 3 HOH 14 314 46 HOH HOH A . E 3 HOH 15 315 49 HOH HOH A . E 3 HOH 16 316 50 HOH HOH A . E 3 HOH 17 317 3 HOH HOH A . E 3 HOH 18 318 12 HOH HOH A . E 3 HOH 19 319 16 HOH HOH A . E 3 HOH 20 320 29 HOH HOH A . E 3 HOH 21 321 36 HOH HOH A . F 3 HOH 1 301 47 HOH HOH B . F 3 HOH 2 302 51 HOH HOH B . F 3 HOH 3 303 25 HOH HOH B . F 3 HOH 4 304 48 HOH HOH B . F 3 HOH 5 305 4 HOH HOH B . F 3 HOH 6 306 14 HOH HOH B . F 3 HOH 7 307 30 HOH HOH B . F 3 HOH 8 308 21 HOH HOH B . F 3 HOH 9 309 17 HOH HOH B . F 3 HOH 10 310 8 HOH HOH B . F 3 HOH 11 311 20 HOH HOH B . F 3 HOH 12 312 11 HOH HOH B . F 3 HOH 13 313 9 HOH HOH B . F 3 HOH 14 314 2 HOH HOH B . F 3 HOH 15 315 37 HOH HOH B . F 3 HOH 16 316 28 HOH HOH B . F 3 HOH 17 317 15 HOH HOH B . F 3 HOH 18 318 41 HOH HOH B . F 3 HOH 19 319 13 HOH HOH B . F 3 HOH 20 320 40 HOH HOH B . F 3 HOH 21 321 24 HOH HOH B . F 3 HOH 22 322 33 HOH HOH B . F 3 HOH 23 323 38 HOH HOH B . F 3 HOH 24 324 39 HOH HOH B . F 3 HOH 25 325 5 HOH HOH B . F 3 HOH 26 326 35 HOH HOH B . F 3 HOH 27 327 6 HOH HOH B . F 3 HOH 28 328 44 HOH HOH B . F 3 HOH 29 329 31 HOH HOH B . F 3 HOH 30 330 32 HOH HOH B . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A CSO 62 A CSO 42 ? CYS 'modified residue' 2 A CSO 80 A CSO 60 ? CYS 'modified residue' 3 A CSO 108 A CSO 88 ? CYS 'modified residue' 4 A CSO 150 A CSO 130 ? CYS 'modified residue' 5 B CSO 62 B CSO 42 ? CYS 'modified residue' 6 B CSO 80 B CSO 60 ? CYS 'modified residue' 7 B CSO 108 B CSO 88 ? CYS 'modified residue' 8 B CSO 150 B CSO 130 ? CYS 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-04-06 2 'Structure model' 2 0 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 2 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Atomic model' 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' atom_site 2 2 'Structure model' chem_comp 3 2 'Structure model' entity 4 2 'Structure model' pdbx_branch_scheme 5 2 'Structure model' pdbx_chem_comp_identifier 6 2 'Structure model' pdbx_entity_branch 7 2 'Structure model' pdbx_entity_branch_descriptor 8 2 'Structure model' pdbx_entity_branch_link 9 2 'Structure model' pdbx_entity_branch_list 10 2 'Structure model' pdbx_entity_nonpoly 11 2 'Structure model' pdbx_nonpoly_scheme 12 2 'Structure model' pdbx_struct_assembly_gen 13 2 'Structure model' pdbx_struct_oper_list 14 2 'Structure model' struct_asym 15 2 'Structure model' struct_conn 16 2 'Structure model' struct_site 17 2 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_atom_site.B_iso_or_equiv' 2 2 'Structure model' '_atom_site.Cartn_x' 3 2 'Structure model' '_atom_site.Cartn_y' 4 2 'Structure model' '_atom_site.Cartn_z' 5 2 'Structure model' '_atom_site.auth_asym_id' 6 2 'Structure model' '_atom_site.auth_atom_id' 7 2 'Structure model' '_atom_site.auth_comp_id' 8 2 'Structure model' '_atom_site.auth_seq_id' 9 2 'Structure model' '_atom_site.label_asym_id' 10 2 'Structure model' '_atom_site.label_atom_id' 11 2 'Structure model' '_atom_site.label_comp_id' 12 2 'Structure model' '_atom_site.label_entity_id' 13 2 'Structure model' '_atom_site.type_symbol' 14 2 'Structure model' '_chem_comp.mon_nstd_flag' 15 2 'Structure model' '_chem_comp.name' 16 2 'Structure model' '_chem_comp.type' 17 2 'Structure model' '_pdbx_struct_assembly_gen.asym_id_list' 18 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 19 2 'Structure model' '_struct_conn.pdbx_dist_value' 20 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 21 2 'Structure model' '_struct_conn.pdbx_value_order' 22 2 'Structure model' '_struct_conn.ptnr1_auth_asym_id' 23 2 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 24 2 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 25 2 'Structure model' '_struct_conn.ptnr1_label_asym_id' 26 2 'Structure model' '_struct_conn.ptnr1_label_atom_id' 27 2 'Structure model' '_struct_conn.ptnr1_label_comp_id' 28 2 'Structure model' '_struct_conn.ptnr2_auth_asym_id' 29 2 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 30 2 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 31 2 'Structure model' '_struct_conn.ptnr2_label_asym_id' 32 2 'Structure model' '_struct_conn.ptnr2_label_atom_id' 33 2 'Structure model' '_struct_conn.ptnr2_label_comp_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 7.6967 -17.4159 -18.0171 0.1871 0.1495 0.2759 0.0040 -0.0586 -0.0133 4.9983 6.5291 6.3817 -5.6782 0.2934 -1.0691 0.1658 0.0348 -0.0816 0.1233 0.1038 0.1447 -0.1308 0.3200 -0.1025 'X-RAY DIFFRACTION' 2 ? refined 14.7047 -11.0420 -3.9611 0.1747 0.1536 0.1758 0.0075 0.0150 0.0559 4.7493 4.4339 7.4902 2.4682 5.6292 1.7540 0.2237 -0.0536 -0.1550 -0.4248 -0.1361 -0.2813 0.3791 0.0052 -0.0192 'X-RAY DIFFRACTION' 3 ? refined 16.6921 -3.9231 -16.5695 0.3066 0.1221 0.0932 -0.0217 0.0822 -0.0180 1.5054 1.9756 3.3658 -0.0776 -0.9762 -0.6932 -0.0054 0.0743 -0.0266 -0.1327 0.0575 -0.3660 0.1469 -0.7037 0.3211 'X-RAY DIFFRACTION' 4 ? refined 7.8499 -3.8069 -9.3544 0.2196 0.2137 0.2333 0.0584 0.0992 0.0005 1.9723 3.5490 2.4498 0.7382 -0.3016 -0.5457 0.0086 0.0583 -0.0422 -0.1697 0.0617 0.5020 0.4602 -0.4882 -0.2390 'X-RAY DIFFRACTION' 5 ? refined 5.2643 -4.6262 -16.4671 0.3362 0.2753 0.2196 0.1075 -0.0093 -0.0173 3.5364 3.1637 0.5879 0.3691 -1.0224 -1.0612 0.0207 0.1050 -0.1619 -0.2576 0.4384 0.5580 0.3176 -0.2461 -0.5136 'X-RAY DIFFRACTION' 6 ? refined 17.4124 -13.3182 -13.4481 0.2196 0.1944 0.2224 0.1077 -0.0870 0.0113 4.1341 2.2404 2.3043 1.6737 2.5838 1.9999 0.0302 0.1140 0.0480 -0.3840 0.0435 -0.3142 0.3821 0.0783 0.2832 'X-RAY DIFFRACTION' 7 ? refined 9.8925 -17.5316 -6.7973 0.1701 0.1902 0.2440 0.0300 0.0390 0.0593 7.5782 2.8972 1.6755 4.6460 2.9449 1.9525 -0.0271 -0.2426 0.2923 -0.1752 0.0519 -0.1882 0.3454 0.1803 -0.1771 'X-RAY DIFFRACTION' 8 ? refined 17.1631 -26.3167 -10.6880 0.2685 0.1681 0.1999 -0.0706 -0.0329 -0.0010 7.6999 8.1036 4.5758 -4.4411 2.8495 -5.9376 0.0386 -0.0416 -0.0724 -0.0729 0.1509 -0.2094 0.2101 -0.0571 0.3334 'X-RAY DIFFRACTION' 9 ? refined 1.1547 -31.4308 -11.7442 0.1742 0.2520 0.4661 0.0574 -0.0707 -0.0266 3.5697 2.4205 2.0820 0.8086 0.9858 0.9932 0.1186 -0.0887 0.1247 -0.2919 0.0866 0.8043 -0.4662 -0.1217 -0.7607 'X-RAY DIFFRACTION' 10 ? refined 13.3868 -36.1185 -16.0674 0.1239 0.1617 0.1031 0.0194 0.0012 0.0357 2.2169 2.9560 2.9391 0.1647 -0.3920 -0.1691 -0.0604 0.0741 -0.0626 0.3473 0.2239 0.1109 -0.5029 0.1827 -0.0393 'X-RAY DIFFRACTION' 11 ? refined 3.3526 -44.9340 -16.6939 0.1157 0.2230 0.4343 -0.0791 -0.0307 -0.0651 5.9476 0.4993 2.7011 0.6737 0.2237 -0.8557 -0.1093 0.1844 0.0460 0.5912 -0.4709 0.7396 -0.3966 0.2713 -0.7716 'X-RAY DIFFRACTION' 12 ? refined 18.6427 -42.6076 -19.9984 0.3039 0.1508 -0.1286 0.0546 0.5831 0.0792 0.1785 0.2059 0.9898 0.1213 -0.3255 -0.1446 0.1734 0.1053 0.1172 0.0984 0.0812 -0.0585 -0.1428 -0.0874 -0.0702 'X-RAY DIFFRACTION' 13 ? refined 1.7954 -43.4715 -9.8030 0.3267 0.2303 0.4666 -0.0834 0.0571 -0.0858 3.3179 3.2167 4.0408 -0.4963 0.4851 0.1976 -0.2562 -0.1004 0.4104 -0.3974 -0.2875 0.9990 0.3006 0.3046 -0.6023 'X-RAY DIFFRACTION' 14 ? refined 11.7777 -35.9930 -3.9234 0.1475 0.2656 0.1336 0.0029 0.0549 0.0716 4.4489 1.9036 2.3355 0.7826 1.2548 0.8041 0.0551 -0.0094 -0.0939 -0.3144 -0.1503 0.3275 0.4476 -0.0178 -0.2141 'X-RAY DIFFRACTION' 15 ? refined 8.4839 -41.3984 -2.7418 0.2327 0.2485 0.2625 -0.0128 0.1259 -0.0437 0.6904 0.8813 2.5961 -0.4493 -0.7095 0.6945 0.1369 0.1073 -0.0417 -0.6656 0.2288 0.5676 0.4904 0.0116 -0.0006 'X-RAY DIFFRACTION' 16 ? refined 23.7869 -35.5166 -10.3022 0.1129 0.2234 0.3726 0.0951 0.0153 0.0406 1.3732 3.0523 1.0258 -1.7531 0.0509 -0.9746 -0.2251 -0.2800 0.0226 -0.0629 0.0275 -0.7138 0.0676 -0.0074 0.4082 'X-RAY DIFFRACTION' 17 ? refined 9.0355 -30.6451 -17.6172 0.1413 0.2987 0.3296 0.0550 -0.0637 0.0231 3.1183 2.6929 0.6104 2.8467 0.1493 0.3581 0.2608 0.0485 -0.1600 0.3681 -0.1348 0.5345 -0.3285 0.1055 -0.6377 'X-RAY DIFFRACTION' 18 ? refined 6.3398 -25.2510 -8.8967 0.1619 0.2757 0.0877 -0.0505 0.0368 -0.0154 8.0844 7.9438 6.0577 0.5208 -1.1181 0.2204 0.4709 0.2975 -0.5839 0.0951 -0.2043 0.2759 0.1560 0.2014 -0.1599 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 2 A 15 ;chain 'A' and (resid 2 through 15 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 16 A 29 ;chain 'A' and (resid 16 through 29 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 30 A 71 ;chain 'A' and (resid 30 through 71 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 72 A 99 ;chain 'A' and (resid 72 through 99 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 100 A 118 ;chain 'A' and (resid 100 through 118 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 119 A 125 ;chain 'A' and (resid 119 through 125 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 126 A 134 ;chain 'A' and (resid 126 through 134 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 B 2 B 15 ;chain 'B' and (resid 2 through 15 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 B 16 B 29 ;chain 'B' and (resid 16 through 29 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 10 10 B 30 B 48 ;chain 'B' and (resid 30 through 48 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 11 11 B 49 B 61 ;chain 'B' and (resid 49 through 61 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 12 12 B 62 B 71 ;chain 'B' and (resid 62 through 71 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 13 13 B 72 B 82 ;chain 'B' and (resid 72 through 82 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 14 14 B 83 B 100 ;chain 'B' and (resid 83 through 100 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 15 15 B 101 B 109 ;chain 'B' and (resid 101 through 109 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 16 16 B 110 B 118 ;chain 'B' and (resid 110 through 118 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 17 17 B 119 B 125 ;chain 'B' and (resid 119 through 125 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 18 18 B 126 B 134 ;chain 'B' and (resid 126 through 134 ) ; ? ? ? ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? Blu-Ice ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.4_1496 5 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O B ALA 116 ? ? O B HOH 301 ? ? 1.84 2 1 OE2 B GLU 86 ? ? O B HOH 302 ? ? 1.99 3 1 O B HOH 304 ? ? O B HOH 307 ? ? 2.03 4 1 O B HOH 322 ? ? O B HOH 328 ? ? 2.07 5 1 OD B CSO 60 ? ? O B HOH 303 ? ? 2.15 6 1 O A HOH 302 ? ? O A HOH 306 ? ? 2.18 7 1 O B GLN 80 ? ? OG B SER 83 ? ? 2.19 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 NH2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 ARG _pdbx_validate_symm_contact.auth_seq_id_1 20 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 OD2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 ASP _pdbx_validate_symm_contact.auth_seq_id_2 26 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_445 _pdbx_validate_symm_contact.dist 2.13 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 56 ? ? 38.56 50.55 2 1 ASN B 50 ? ? -154.98 89.54 3 1 ASN B 56 ? ? 39.47 50.94 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -19 ? A MET 1 2 1 Y 1 A GLY -18 ? A GLY 2 3 1 Y 1 A SER -17 ? A SER 3 4 1 Y 1 A SER -16 ? A SER 4 5 1 Y 1 A HIS -15 ? A HIS 5 6 1 Y 1 A HIS -14 ? A HIS 6 7 1 Y 1 A HIS -13 ? A HIS 7 8 1 Y 1 A HIS -12 ? A HIS 8 9 1 Y 1 A HIS -11 ? A HIS 9 10 1 Y 1 A HIS -10 ? A HIS 10 11 1 Y 1 A SER -9 ? A SER 11 12 1 Y 1 A SER -8 ? A SER 12 13 1 Y 1 A GLY -7 ? A GLY 13 14 1 Y 1 A LEU -6 ? A LEU 14 15 1 Y 1 A VAL -5 ? A VAL 15 16 1 Y 1 A PRO -4 ? A PRO 16 17 1 Y 1 A ARG -3 ? A ARG 17 18 1 Y 1 A GLY -2 ? A GLY 18 19 1 Y 1 A SER -1 ? A SER 19 20 1 Y 1 A HIS 0 ? A HIS 20 21 1 Y 1 A MET 1 ? A MET 21 22 1 Y 1 B MET -19 ? B MET 1 23 1 Y 1 B GLY -18 ? B GLY 2 24 1 Y 1 B SER -17 ? B SER 3 25 1 Y 1 B SER -16 ? B SER 4 26 1 Y 1 B HIS -15 ? B HIS 5 27 1 Y 1 B HIS -14 ? B HIS 6 28 1 Y 1 B HIS -13 ? B HIS 7 29 1 Y 1 B HIS -12 ? B HIS 8 30 1 Y 1 B HIS -11 ? B HIS 9 31 1 Y 1 B HIS -10 ? B HIS 10 32 1 Y 1 B SER -9 ? B SER 11 33 1 Y 1 B SER -8 ? B SER 12 34 1 Y 1 B GLY -7 ? B GLY 13 35 1 Y 1 B LEU -6 ? B LEU 14 36 1 Y 1 B VAL -5 ? B VAL 15 37 1 Y 1 B PRO -4 ? B PRO 16 38 1 Y 1 B ARG -3 ? B ARG 17 39 1 Y 1 B GLY -2 ? B GLY 18 40 1 Y 1 B SER -1 ? B SER 19 41 1 Y 1 B HIS 0 ? B HIS 20 42 1 Y 1 B MET 1 ? B MET 21 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Academia Sinica' Taiwan AS-022316 1 'Ministry of Science and Technology' Taiwan 103-2113-M-001-023-MY3 2 'Ministry of Science and Technology' Taiwan 102-2113-M-001-001-MY3 3 'Ministry of Science and Technology' Taiwan 102-2923-M-001-001-MY3 4 # loop_ _pdbx_branch_scheme.asym_id _pdbx_branch_scheme.entity_id _pdbx_branch_scheme.mon_id _pdbx_branch_scheme.num _pdbx_branch_scheme.pdb_asym_id _pdbx_branch_scheme.pdb_mon_id _pdbx_branch_scheme.pdb_seq_num _pdbx_branch_scheme.auth_asym_id _pdbx_branch_scheme.auth_mon_id _pdbx_branch_scheme.auth_seq_num _pdbx_branch_scheme.hetero C 2 6S2 1 C 6S2 1 C 6S2 1 n C 2 GAL 2 C GAL 2 C 6S2 1 n D 2 6S2 1 D 6S2 1 D 6S2 1 n D 2 GAL 2 D GAL 2 D 6S2 1 n # loop_ _pdbx_chem_comp_identifier.comp_id _pdbx_chem_comp_identifier.type _pdbx_chem_comp_identifier.program _pdbx_chem_comp_identifier.program_version _pdbx_chem_comp_identifier.identifier 6S2 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 'DGlcpNAc[1Me,6S]b' 6S2 'COMMON NAME' GMML 1.0 1-methyl-N-acetyl-6-sulfo-b-D-glucopyranose GAL 'CONDENSED IUPAC CARBOHYDRATE SYMBOL' GMML 1.0 DGalpb GAL 'COMMON NAME' GMML 1.0 b-D-galactopyranose GAL 'IUPAC CARBOHYDRATE SYMBOL' PDB-CARE 1.0 b-D-Galp GAL 'SNFG CARBOHYDRATE SYMBOL' GMML 1.0 Gal # _pdbx_entity_branch.entity_id 2 _pdbx_entity_branch.type oligosaccharide # loop_ _pdbx_entity_branch_descriptor.ordinal _pdbx_entity_branch_descriptor.entity_id _pdbx_entity_branch_descriptor.descriptor _pdbx_entity_branch_descriptor.type _pdbx_entity_branch_descriptor.program _pdbx_entity_branch_descriptor.program_version 1 2 'DGalpb1-4DGlcpNAc[1Me,6S]b1-OME' 'Glycam Condensed Sequence' GMML 1.0 2 2 'WURCS=2.0/2,2,1/[a2122h-1b_1-5_1*OC_2*NCC/3=O_6*OSO/3=O/3=O][a2112h-1b_1-5]/1-2/a4-b1' WURCS PDB2Glycan 1.1.0 3 2 '[][methyl]{[(1+1)][b-D-GlcpNAc6SO3]{[(4+1)][b-D-Galp]{}}}' LINUCS PDB-CARE ? # _pdbx_entity_branch_link.link_id 1 _pdbx_entity_branch_link.entity_id 2 _pdbx_entity_branch_link.entity_branch_list_num_1 2 _pdbx_entity_branch_link.comp_id_1 GAL _pdbx_entity_branch_link.atom_id_1 C1 _pdbx_entity_branch_link.leaving_atom_id_1 O1 _pdbx_entity_branch_link.entity_branch_list_num_2 1 _pdbx_entity_branch_link.comp_id_2 6S2 _pdbx_entity_branch_link.atom_id_2 O4 _pdbx_entity_branch_link.leaving_atom_id_2 HO4 _pdbx_entity_branch_link.value_order sing _pdbx_entity_branch_link.details ? # loop_ _pdbx_entity_branch_list.entity_id _pdbx_entity_branch_list.comp_id _pdbx_entity_branch_list.num _pdbx_entity_branch_list.hetero 2 6S2 1 n 2 GAL 2 n # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #