data_4Y2G # _entry.id 4Y2G # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4Y2G WWPDB D_1000206743 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4Y2G _pdbx_database_status.recvd_initial_deposition_date 2015-02-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wu, Q.' 1 'Blundell, T.L.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mol.Cell _citation.journal_id_ASTM MOCEFL _citation.journal_id_CSD 2168 _citation.journal_id_ISSN 1097-2765 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 61 _citation.language ? _citation.page_first 434 _citation.page_last 448 _citation.title 'Structure of BRCA1-BRCT/Abraxas Complex Reveals Phosphorylation-Dependent BRCT Dimerization at DNA Damage Sites.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.molcel.2015.12.017 _citation.pdbx_database_id_PubMed 26778126 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Wu, Q.' 1 primary 'Paul, A.' 2 primary 'Su, D.' 3 primary 'Mehmood, S.' 4 primary 'Foo, T.K.' 5 primary 'Ochi, T.' 6 primary 'Bunting, E.L.' 7 primary 'Xia, B.' 8 primary 'Robinson, C.V.' 9 primary 'Wang, B.' 10 primary 'Blundell, T.L.' 11 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 4Y2G _cell.details ? _cell.formula_units_Z ? _cell.length_a 63.847 _cell.length_a_esd ? _cell.length_b 63.847 _cell.length_b_esd ? _cell.length_c 93.367 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4Y2G _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Breast cancer type 1 susceptibility protein' 25796.668 1 6.3.2.- ? 'UNP residues 1646-1859' ? 2 polymer syn 'BRCA1-A complex subunit Abraxas' 937.910 1 ? ? 'UNP residues 403-409' ? 3 water nat water 18.015 3 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'RING finger protein 53' 2 'Coiled-coil domain-containing protein 98,Protein FAM175A' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;MSHHHHHHSMVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVS YFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKEL SSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP ; ;MSHHHHHHSMVNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVS YFWVTQSIKERKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKEL SSFTLGTGVHPIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP ; A ? 2 'polypeptide(L)' no yes 'YSR(SEP)PTF' YSRSPTF B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 SER n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 SER n 1 10 MET n 1 11 VAL n 1 12 ASN n 1 13 LYS n 1 14 ARG n 1 15 MET n 1 16 SER n 1 17 MET n 1 18 VAL n 1 19 VAL n 1 20 SER n 1 21 GLY n 1 22 LEU n 1 23 THR n 1 24 PRO n 1 25 GLU n 1 26 GLU n 1 27 PHE n 1 28 MET n 1 29 LEU n 1 30 VAL n 1 31 TYR n 1 32 LYS n 1 33 PHE n 1 34 ALA n 1 35 ARG n 1 36 LYS n 1 37 HIS n 1 38 HIS n 1 39 ILE n 1 40 THR n 1 41 LEU n 1 42 THR n 1 43 ASN n 1 44 LEU n 1 45 ILE n 1 46 THR n 1 47 GLU n 1 48 GLU n 1 49 THR n 1 50 THR n 1 51 HIS n 1 52 VAL n 1 53 VAL n 1 54 MET n 1 55 LYS n 1 56 THR n 1 57 ASP n 1 58 ALA n 1 59 GLU n 1 60 PHE n 1 61 VAL n 1 62 CYS n 1 63 GLU n 1 64 ARG n 1 65 THR n 1 66 LEU n 1 67 LYS n 1 68 TYR n 1 69 PHE n 1 70 LEU n 1 71 GLY n 1 72 ILE n 1 73 ALA n 1 74 GLY n 1 75 GLY n 1 76 LYS n 1 77 TRP n 1 78 VAL n 1 79 VAL n 1 80 SER n 1 81 TYR n 1 82 PHE n 1 83 TRP n 1 84 VAL n 1 85 THR n 1 86 GLN n 1 87 SER n 1 88 ILE n 1 89 LYS n 1 90 GLU n 1 91 ARG n 1 92 LYS n 1 93 MET n 1 94 LEU n 1 95 ASN n 1 96 GLU n 1 97 HIS n 1 98 ASP n 1 99 PHE n 1 100 GLU n 1 101 VAL n 1 102 ARG n 1 103 GLY n 1 104 ASP n 1 105 VAL n 1 106 VAL n 1 107 ASN n 1 108 GLY n 1 109 ARG n 1 110 ASN n 1 111 HIS n 1 112 GLN n 1 113 GLY n 1 114 PRO n 1 115 LYS n 1 116 ARG n 1 117 ALA n 1 118 ARG n 1 119 GLU n 1 120 SER n 1 121 GLN n 1 122 ASP n 1 123 ARG n 1 124 LYS n 1 125 ILE n 1 126 PHE n 1 127 ARG n 1 128 GLY n 1 129 LEU n 1 130 GLU n 1 131 ILE n 1 132 CYS n 1 133 CYS n 1 134 TYR n 1 135 GLY n 1 136 PRO n 1 137 PHE n 1 138 THR n 1 139 ASN n 1 140 MET n 1 141 PRO n 1 142 THR n 1 143 ASP n 1 144 GLN n 1 145 LEU n 1 146 GLU n 1 147 TRP n 1 148 MET n 1 149 VAL n 1 150 GLN n 1 151 LEU n 1 152 CYS n 1 153 GLY n 1 154 ALA n 1 155 SER n 1 156 VAL n 1 157 VAL n 1 158 LYS n 1 159 GLU n 1 160 LEU n 1 161 SER n 1 162 SER n 1 163 PHE n 1 164 THR n 1 165 LEU n 1 166 GLY n 1 167 THR n 1 168 GLY n 1 169 VAL n 1 170 HIS n 1 171 PRO n 1 172 ILE n 1 173 VAL n 1 174 VAL n 1 175 VAL n 1 176 GLN n 1 177 PRO n 1 178 ASP n 1 179 ALA n 1 180 TRP n 1 181 THR n 1 182 GLU n 1 183 ASP n 1 184 ASN n 1 185 GLY n 1 186 PHE n 1 187 HIS n 1 188 ALA n 1 189 ILE n 1 190 GLY n 1 191 GLN n 1 192 MET n 1 193 CYS n 1 194 GLU n 1 195 ALA n 1 196 PRO n 1 197 VAL n 1 198 VAL n 1 199 THR n 1 200 ARG n 1 201 GLU n 1 202 TRP n 1 203 VAL n 1 204 LEU n 1 205 ASP n 1 206 SER n 1 207 VAL n 1 208 ALA n 1 209 LEU n 1 210 TYR n 1 211 GLN n 1 212 CYS n 1 213 GLN n 1 214 GLU n 1 215 LEU n 1 216 ASP n 1 217 THR n 1 218 TYR n 1 219 LEU n 1 220 ILE n 1 221 PRO n 1 222 GLN n 1 223 ILE n 1 224 PRO n 2 1 TYR n 2 2 SER n 2 3 ARG n 2 4 SEP n 2 5 PRO n 2 6 THR n 2 7 PHE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 224 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BRCA1, RNF53' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 11 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP BRCA1_HUMAN P38398 ? 1 ;VNKRMSMVVSGLTPEEFMLVYKFARKHHITLTNLITEETTHVVMKTDAEFVCERTLKYFLGIAGGKWVVSYFWVTQSIKE RKMLNEHDFEVRGDVVNGRNHQGPKRARESQDRKIFRGLEICCYGPFTNMPTDQLEWMVQLCGASVVKELSSFTLGTGVH PIVVVQPDAWTEDNGFHAIGQMCEAPVVTREWVLDSVALYQCQELDTYLIPQIP ; 1646 2 UNP F175A_HUMAN Q6UWZ7 ? 2 YSRSPTF 403 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4Y2G A 11 ? 224 ? P38398 1646 ? 1859 ? 1646 1859 2 2 4Y2G B 1 ? 7 ? Q6UWZ7 403 ? 409 ? 403 409 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4Y2G MET A 1 ? UNP P38398 ? ? 'initiating methionine' 1636 1 1 4Y2G SER A 2 ? UNP P38398 ? ? 'expression tag' 1637 2 1 4Y2G HIS A 3 ? UNP P38398 ? ? 'expression tag' 1638 3 1 4Y2G HIS A 4 ? UNP P38398 ? ? 'expression tag' 1639 4 1 4Y2G HIS A 5 ? UNP P38398 ? ? 'expression tag' 1640 5 1 4Y2G HIS A 6 ? UNP P38398 ? ? 'expression tag' 1641 6 1 4Y2G HIS A 7 ? UNP P38398 ? ? 'expression tag' 1642 7 1 4Y2G HIS A 8 ? UNP P38398 ? ? 'expression tag' 1643 8 1 4Y2G SER A 9 ? UNP P38398 ? ? 'expression tag' 1644 9 1 4Y2G MET A 10 ? UNP P38398 ? ? 'expression tag' 1645 10 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SEP 'L-peptide linking' n PHOSPHOSERINE PHOSPHONOSERINE 'C3 H8 N O6 P' 185.072 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4Y2G _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.05 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 40.14 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Lithium chloride, Tris, PEG 6000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'PSI PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-06-28 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I03' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I03 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4Y2G _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 47.6 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8000 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.051 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 24 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.5 _reflns_shell.d_res_low 2.64 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 5.1 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 99.8 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.498 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4Y2G _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.500 _refine.ls_d_res_low 47.576 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7998 _refine.ls_number_reflns_R_free 796 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.95 _refine.ls_percent_reflns_R_free 9.95 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2185 _refine.ls_R_factor_R_free 0.2521 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2149 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model IT15 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.43 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.31 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1721 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 3 _refine_hist.number_atoms_total 1724 _refine_hist.d_res_high 2.500 _refine_hist.d_res_low 47.576 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1763 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.823 ? 2401 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 13.038 ? 622 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.044 ? 273 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 304 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.5001 2.6567 . . 129 1162 100.00 . . . 0.3740 . 0.3562 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6567 2.8618 . . 128 1179 100.00 . . . 0.3369 . 0.2913 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.8618 3.1498 . . 129 1191 100.00 . . . 0.3267 . 0.3156 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1498 3.6054 . . 133 1185 100.00 . . . 0.2700 . 0.2452 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.6054 4.5419 . . 135 1212 100.00 . . . 0.2194 . 0.2046 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.5419 47.5847 . . 142 1273 100.00 . . . 0.2220 . 0.1641 . . . . . . . . . . # _struct.entry_id 4Y2G _struct.title 'Structure of BRCA1 BRCT domains in complex with Abraxas single phosphorylated peptide' _struct.pdbx_descriptor 'BRCA1 BRCT domains, GLY-GLU-TYR-SEP-ARG-SEP-PRO-THR-PHE' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4Y2G _struct_keywords.text 'DNA damage response, BRCT, phosphopeptide, ligase-peptide complex, antitumor protein' _struct_keywords.pdbx_keywords 'ANTITUMOR PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 THR A 23 ? HIS A 38 ? THR A 1658 HIS A 1673 1 ? 16 HELX_P HELX_P2 AA2 LEU A 66 ? GLY A 74 ? LEU A 1701 GLY A 1709 1 ? 9 HELX_P HELX_P3 AA3 TYR A 81 ? GLU A 90 ? TYR A 1716 GLU A 1725 1 ? 10 HELX_P HELX_P4 AA4 ASN A 95 ? GLU A 100 ? ASN A 1730 GLU A 1735 5 ? 6 HELX_P HELX_P5 AA5 GLN A 112 ? SER A 120 ? GLN A 1747 SER A 1755 1 ? 9 HELX_P HELX_P6 AA6 PRO A 141 ? CYS A 152 ? PRO A 1776 CYS A 1787 1 ? 12 HELX_P HELX_P7 AA7 GLU A 159 ? PHE A 163 ? GLU A 1794 PHE A 1798 5 ? 5 HELX_P HELX_P8 AA8 GLN A 176 ? TRP A 180 ? GLN A 1811 TRP A 1815 5 ? 5 HELX_P HELX_P9 AA9 ASN A 184 ? MET A 192 ? ASN A 1819 MET A 1827 5 ? 9 HELX_P HELX_P10 AB1 ARG A 200 ? TYR A 210 ? ARG A 1835 TYR A 1845 1 ? 11 HELX_P HELX_P11 AB2 GLU A 214 ? LEU A 219 ? GLU A 1849 LEU A 1854 5 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? B ARG 3 C ? ? ? 1_555 B SEP 4 N ? ? B ARG 405 B SEP 406 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale both ? B SEP 4 C ? ? ? 1_555 B PRO 5 N ? ? B SEP 406 B PRO 407 1_555 ? ? ? ? ? ? ? 1.322 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 135 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 1770 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 136 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 1771 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 4.41 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA2 1 2 ? parallel AA3 1 2 ? anti-parallel AA4 1 2 ? parallel AA4 2 3 ? parallel AA4 3 4 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 40 ? LEU A 41 ? THR A 1675 LEU A 1676 AA1 2 SER A 16 ? SER A 20 ? SER A 1651 SER A 1655 AA1 3 HIS A 51 ? MET A 54 ? HIS A 1686 MET A 1689 AA1 4 TRP A 77 ? SER A 80 ? TRP A 1712 SER A 1715 AA2 1 VAL A 61 ? CYS A 62 ? VAL A 1696 CYS A 1697 AA2 2 GLY A 103 ? ASP A 104 ? GLY A 1738 ASP A 1739 AA3 1 ARG A 64 ? THR A 65 ? ARG A 1699 THR A 1700 AA3 2 THR B 6 ? PHE B 7 ? THR B 408 PHE B 409 AA4 1 SER A 155 ? VAL A 156 ? SER A 1790 VAL A 1791 AA4 2 LEU A 129 ? CYS A 133 ? LEU A 1764 CYS A 1768 AA4 3 HIS A 170 ? VAL A 175 ? HIS A 1805 VAL A 1810 AA4 4 VAL A 197 ? THR A 199 ? VAL A 1832 THR A 1834 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O THR A 40 ? O THR A 1675 N MET A 17 ? N MET A 1652 AA1 2 3 N VAL A 18 ? N VAL A 1653 O VAL A 53 ? O VAL A 1688 AA1 3 4 N VAL A 52 ? N VAL A 1687 O TRP A 77 ? O TRP A 1712 AA2 1 2 N CYS A 62 ? N CYS A 1697 O GLY A 103 ? O GLY A 1738 AA3 1 2 N ARG A 64 ? N ARG A 1699 O PHE B 7 ? O PHE B 409 AA4 1 2 O SER A 155 ? O SER A 1790 N LEU A 129 ? N LEU A 1764 AA4 2 3 N CYS A 132 ? N CYS A 1767 O VAL A 174 ? O VAL A 1809 AA4 3 4 N VAL A 173 ? N VAL A 1808 O VAL A 198 ? O VAL A 1833 # _atom_sites.entry_id 4Y2G _atom_sites.fract_transf_matrix[1][1] 0.015662 _atom_sites.fract_transf_matrix[1][2] 0.009043 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018085 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010710 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1636 ? ? ? A . n A 1 2 SER 2 1637 ? ? ? A . n A 1 3 HIS 3 1638 ? ? ? A . n A 1 4 HIS 4 1639 ? ? ? A . n A 1 5 HIS 5 1640 ? ? ? A . n A 1 6 HIS 6 1641 ? ? ? A . n A 1 7 HIS 7 1642 ? ? ? A . n A 1 8 HIS 8 1643 ? ? ? A . n A 1 9 SER 9 1644 ? ? ? A . n A 1 10 MET 10 1645 ? ? ? A . n A 1 11 VAL 11 1646 1646 VAL VAL A . n A 1 12 ASN 12 1647 1647 ASN ASN A . n A 1 13 LYS 13 1648 1648 LYS LYS A . n A 1 14 ARG 14 1649 1649 ARG ARG A . n A 1 15 MET 15 1650 1650 MET MET A . n A 1 16 SER 16 1651 1651 SER SER A . n A 1 17 MET 17 1652 1652 MET MET A . n A 1 18 VAL 18 1653 1653 VAL VAL A . n A 1 19 VAL 19 1654 1654 VAL VAL A . n A 1 20 SER 20 1655 1655 SER SER A . n A 1 21 GLY 21 1656 1656 GLY GLY A . n A 1 22 LEU 22 1657 1657 LEU LEU A . n A 1 23 THR 23 1658 1658 THR THR A . n A 1 24 PRO 24 1659 1659 PRO PRO A . n A 1 25 GLU 25 1660 1660 GLU GLU A . n A 1 26 GLU 26 1661 1661 GLU GLU A . n A 1 27 PHE 27 1662 1662 PHE PHE A . n A 1 28 MET 28 1663 1663 MET MET A . n A 1 29 LEU 29 1664 1664 LEU LEU A . n A 1 30 VAL 30 1665 1665 VAL VAL A . n A 1 31 TYR 31 1666 1666 TYR TYR A . n A 1 32 LYS 32 1667 1667 LYS LYS A . n A 1 33 PHE 33 1668 1668 PHE PHE A . n A 1 34 ALA 34 1669 1669 ALA ALA A . n A 1 35 ARG 35 1670 1670 ARG ARG A . n A 1 36 LYS 36 1671 1671 LYS LYS A . n A 1 37 HIS 37 1672 1672 HIS HIS A . n A 1 38 HIS 38 1673 1673 HIS HIS A . n A 1 39 ILE 39 1674 1674 ILE ILE A . n A 1 40 THR 40 1675 1675 THR THR A . n A 1 41 LEU 41 1676 1676 LEU LEU A . n A 1 42 THR 42 1677 1677 THR THR A . n A 1 43 ASN 43 1678 1678 ASN ASN A . n A 1 44 LEU 44 1679 1679 LEU LEU A . n A 1 45 ILE 45 1680 1680 ILE ILE A . n A 1 46 THR 46 1681 1681 THR THR A . n A 1 47 GLU 47 1682 1682 GLU GLU A . n A 1 48 GLU 48 1683 1683 GLU GLU A . n A 1 49 THR 49 1684 1684 THR THR A . n A 1 50 THR 50 1685 1685 THR THR A . n A 1 51 HIS 51 1686 1686 HIS HIS A . n A 1 52 VAL 52 1687 1687 VAL VAL A . n A 1 53 VAL 53 1688 1688 VAL VAL A . n A 1 54 MET 54 1689 1689 MET MET A . n A 1 55 LYS 55 1690 1690 LYS LYS A . n A 1 56 THR 56 1691 1691 THR THR A . n A 1 57 ASP 57 1692 1692 ASP ASP A . n A 1 58 ALA 58 1693 1693 ALA ALA A . n A 1 59 GLU 59 1694 1694 GLU GLU A . n A 1 60 PHE 60 1695 1695 PHE PHE A . n A 1 61 VAL 61 1696 1696 VAL VAL A . n A 1 62 CYS 62 1697 1697 CYS CYS A . n A 1 63 GLU 63 1698 1698 GLU GLU A . n A 1 64 ARG 64 1699 1699 ARG ARG A . n A 1 65 THR 65 1700 1700 THR THR A . n A 1 66 LEU 66 1701 1701 LEU LEU A . n A 1 67 LYS 67 1702 1702 LYS LYS A . n A 1 68 TYR 68 1703 1703 TYR TYR A . n A 1 69 PHE 69 1704 1704 PHE PHE A . n A 1 70 LEU 70 1705 1705 LEU LEU A . n A 1 71 GLY 71 1706 1706 GLY GLY A . n A 1 72 ILE 72 1707 1707 ILE ILE A . n A 1 73 ALA 73 1708 1708 ALA ALA A . n A 1 74 GLY 74 1709 1709 GLY GLY A . n A 1 75 GLY 75 1710 1710 GLY GLY A . n A 1 76 LYS 76 1711 1711 LYS LYS A . n A 1 77 TRP 77 1712 1712 TRP TRP A . n A 1 78 VAL 78 1713 1713 VAL VAL A . n A 1 79 VAL 79 1714 1714 VAL VAL A . n A 1 80 SER 80 1715 1715 SER SER A . n A 1 81 TYR 81 1716 1716 TYR TYR A . n A 1 82 PHE 82 1717 1717 PHE PHE A . n A 1 83 TRP 83 1718 1718 TRP TRP A . n A 1 84 VAL 84 1719 1719 VAL VAL A . n A 1 85 THR 85 1720 1720 THR THR A . n A 1 86 GLN 86 1721 1721 GLN GLN A . n A 1 87 SER 87 1722 1722 SER SER A . n A 1 88 ILE 88 1723 1723 ILE ILE A . n A 1 89 LYS 89 1724 1724 LYS LYS A . n A 1 90 GLU 90 1725 1725 GLU GLU A . n A 1 91 ARG 91 1726 1726 ARG ARG A . n A 1 92 LYS 92 1727 1727 LYS LYS A . n A 1 93 MET 93 1728 1728 MET MET A . n A 1 94 LEU 94 1729 1729 LEU LEU A . n A 1 95 ASN 95 1730 1730 ASN ASN A . n A 1 96 GLU 96 1731 1731 GLU GLU A . n A 1 97 HIS 97 1732 1732 HIS HIS A . n A 1 98 ASP 98 1733 1733 ASP ASP A . n A 1 99 PHE 99 1734 1734 PHE PHE A . n A 1 100 GLU 100 1735 1735 GLU GLU A . n A 1 101 VAL 101 1736 1736 VAL VAL A . n A 1 102 ARG 102 1737 1737 ARG ARG A . n A 1 103 GLY 103 1738 1738 GLY GLY A . n A 1 104 ASP 104 1739 1739 ASP ASP A . n A 1 105 VAL 105 1740 1740 VAL VAL A . n A 1 106 VAL 106 1741 1741 VAL VAL A . n A 1 107 ASN 107 1742 1742 ASN ASN A . n A 1 108 GLY 108 1743 1743 GLY GLY A . n A 1 109 ARG 109 1744 1744 ARG ARG A . n A 1 110 ASN 110 1745 1745 ASN ASN A . n A 1 111 HIS 111 1746 1746 HIS HIS A . n A 1 112 GLN 112 1747 1747 GLN GLN A . n A 1 113 GLY 113 1748 1748 GLY GLY A . n A 1 114 PRO 114 1749 1749 PRO PRO A . n A 1 115 LYS 115 1750 1750 LYS LYS A . n A 1 116 ARG 116 1751 1751 ARG ARG A . n A 1 117 ALA 117 1752 1752 ALA ALA A . n A 1 118 ARG 118 1753 1753 ARG ARG A . n A 1 119 GLU 119 1754 1754 GLU GLU A . n A 1 120 SER 120 1755 1755 SER SER A . n A 1 121 GLN 121 1756 1756 GLN GLN A . n A 1 122 ASP 122 1757 1757 ASP ASP A . n A 1 123 ARG 123 1758 1758 ARG ARG A . n A 1 124 LYS 124 1759 1759 LYS LYS A . n A 1 125 ILE 125 1760 1760 ILE ILE A . n A 1 126 PHE 126 1761 1761 PHE PHE A . n A 1 127 ARG 127 1762 1762 ARG ARG A . n A 1 128 GLY 128 1763 1763 GLY GLY A . n A 1 129 LEU 129 1764 1764 LEU LEU A . n A 1 130 GLU 130 1765 1765 GLU GLU A . n A 1 131 ILE 131 1766 1766 ILE ILE A . n A 1 132 CYS 132 1767 1767 CYS CYS A . n A 1 133 CYS 133 1768 1768 CYS CYS A . n A 1 134 TYR 134 1769 1769 TYR TYR A . n A 1 135 GLY 135 1770 1770 GLY GLY A . n A 1 136 PRO 136 1771 1771 PRO PRO A . n A 1 137 PHE 137 1772 1772 PHE PHE A . n A 1 138 THR 138 1773 1773 THR THR A . n A 1 139 ASN 139 1774 1774 ASN ASN A . n A 1 140 MET 140 1775 1775 MET MET A . n A 1 141 PRO 141 1776 1776 PRO PRO A . n A 1 142 THR 142 1777 1777 THR THR A . n A 1 143 ASP 143 1778 1778 ASP ASP A . n A 1 144 GLN 144 1779 1779 GLN GLN A . n A 1 145 LEU 145 1780 1780 LEU LEU A . n A 1 146 GLU 146 1781 1781 GLU GLU A . n A 1 147 TRP 147 1782 1782 TRP TRP A . n A 1 148 MET 148 1783 1783 MET MET A . n A 1 149 VAL 149 1784 1784 VAL VAL A . n A 1 150 GLN 150 1785 1785 GLN GLN A . n A 1 151 LEU 151 1786 1786 LEU LEU A . n A 1 152 CYS 152 1787 1787 CYS CYS A . n A 1 153 GLY 153 1788 1788 GLY GLY A . n A 1 154 ALA 154 1789 1789 ALA ALA A . n A 1 155 SER 155 1790 1790 SER SER A . n A 1 156 VAL 156 1791 1791 VAL VAL A . n A 1 157 VAL 157 1792 1792 VAL VAL A . n A 1 158 LYS 158 1793 1793 LYS LYS A . n A 1 159 GLU 159 1794 1794 GLU GLU A . n A 1 160 LEU 160 1795 1795 LEU LEU A . n A 1 161 SER 161 1796 1796 SER SER A . n A 1 162 SER 162 1797 1797 SER SER A . n A 1 163 PHE 163 1798 1798 PHE PHE A . n A 1 164 THR 164 1799 1799 THR THR A . n A 1 165 LEU 165 1800 1800 LEU LEU A . n A 1 166 GLY 166 1801 1801 GLY GLY A . n A 1 167 THR 167 1802 1802 THR THR A . n A 1 168 GLY 168 1803 1803 GLY GLY A . n A 1 169 VAL 169 1804 1804 VAL VAL A . n A 1 170 HIS 170 1805 1805 HIS HIS A . n A 1 171 PRO 171 1806 1806 PRO PRO A . n A 1 172 ILE 172 1807 1807 ILE ILE A . n A 1 173 VAL 173 1808 1808 VAL VAL A . n A 1 174 VAL 174 1809 1809 VAL VAL A . n A 1 175 VAL 175 1810 1810 VAL VAL A . n A 1 176 GLN 176 1811 1811 GLN GLN A . n A 1 177 PRO 177 1812 1812 PRO PRO A . n A 1 178 ASP 178 1813 1813 ASP ASP A . n A 1 179 ALA 179 1814 1814 ALA ALA A . n A 1 180 TRP 180 1815 1815 TRP TRP A . n A 1 181 THR 181 1816 1816 THR THR A . n A 1 182 GLU 182 1817 1817 GLU GLU A . n A 1 183 ASP 183 1818 1818 ASP ASP A . n A 1 184 ASN 184 1819 1819 ASN ASN A . n A 1 185 GLY 185 1820 1820 GLY GLY A . n A 1 186 PHE 186 1821 1821 PHE PHE A . n A 1 187 HIS 187 1822 1822 HIS HIS A . n A 1 188 ALA 188 1823 1823 ALA ALA A . n A 1 189 ILE 189 1824 1824 ILE ILE A . n A 1 190 GLY 190 1825 1825 GLY GLY A . n A 1 191 GLN 191 1826 1826 GLN GLN A . n A 1 192 MET 192 1827 1827 MET MET A . n A 1 193 CYS 193 1828 1828 CYS CYS A . n A 1 194 GLU 194 1829 1829 GLU GLU A . n A 1 195 ALA 195 1830 1830 ALA ALA A . n A 1 196 PRO 196 1831 1831 PRO PRO A . n A 1 197 VAL 197 1832 1832 VAL VAL A . n A 1 198 VAL 198 1833 1833 VAL VAL A . n A 1 199 THR 199 1834 1834 THR THR A . n A 1 200 ARG 200 1835 1835 ARG ARG A . n A 1 201 GLU 201 1836 1836 GLU GLU A . n A 1 202 TRP 202 1837 1837 TRP TRP A . n A 1 203 VAL 203 1838 1838 VAL VAL A . n A 1 204 LEU 204 1839 1839 LEU LEU A . n A 1 205 ASP 205 1840 1840 ASP ASP A . n A 1 206 SER 206 1841 1841 SER SER A . n A 1 207 VAL 207 1842 1842 VAL VAL A . n A 1 208 ALA 208 1843 1843 ALA ALA A . n A 1 209 LEU 209 1844 1844 LEU LEU A . n A 1 210 TYR 210 1845 1845 TYR TYR A . n A 1 211 GLN 211 1846 1846 GLN GLN A . n A 1 212 CYS 212 1847 1847 CYS CYS A . n A 1 213 GLN 213 1848 1848 GLN GLN A . n A 1 214 GLU 214 1849 1849 GLU GLU A . n A 1 215 LEU 215 1850 1850 LEU LEU A . n A 1 216 ASP 216 1851 1851 ASP ASP A . n A 1 217 THR 217 1852 1852 THR THR A . n A 1 218 TYR 218 1853 1853 TYR TYR A . n A 1 219 LEU 219 1854 1854 LEU LEU A . n A 1 220 ILE 220 1855 1855 ILE ILE A . n A 1 221 PRO 221 1856 1856 PRO PRO A . n A 1 222 GLN 222 1857 1857 GLN GLN A . n A 1 223 ILE 223 1858 1858 ILE ILE A . n A 1 224 PRO 224 1859 1859 PRO PRO A . n B 2 1 TYR 1 403 403 TYR TYR B . n B 2 2 SER 2 404 404 SER SER B . n B 2 3 ARG 3 405 405 ARG ARG B . n B 2 4 SEP 4 406 406 SEP SEP B . n B 2 5 PRO 5 407 407 PRO PRO B . n B 2 6 THR 6 408 408 THR THR B . n B 2 7 PHE 7 409 409 PHE PHE B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 1901 1 HOH HOH A . D 3 HOH 1 501 2 HOH HOH B . D 3 HOH 2 502 3 HOH HOH B . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id SEP _pdbx_struct_mod_residue.label_seq_id 4 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id SEP _pdbx_struct_mod_residue.auth_seq_id 406 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id SER _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 760 ? 1 MORE -8 ? 1 'SSA (A^2)' 11180 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-01-27 2 'Structure model' 1 1 2016-02-17 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.8.4_1496)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 1745 ? ? -153.11 36.09 2 1 ASN A 1774 ? ? 66.00 -3.13 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A VAL 1646 ? CG1 ? A VAL 11 CG1 2 1 Y 1 A VAL 1646 ? CG2 ? A VAL 11 CG2 3 1 Y 1 A ASN 1647 ? CG ? A ASN 12 CG 4 1 Y 1 A ASN 1647 ? OD1 ? A ASN 12 OD1 5 1 Y 1 A ASN 1647 ? ND2 ? A ASN 12 ND2 6 1 Y 1 A LYS 1648 ? CG ? A LYS 13 CG 7 1 Y 1 A LYS 1648 ? CD ? A LYS 13 CD 8 1 Y 1 A LYS 1648 ? CE ? A LYS 13 CE 9 1 Y 1 A LYS 1648 ? NZ ? A LYS 13 NZ 10 1 Y 1 A MET 1663 ? CG ? A MET 28 CG 11 1 Y 1 A MET 1663 ? SD ? A MET 28 SD 12 1 Y 1 A MET 1663 ? CE ? A MET 28 CE 13 1 Y 1 A LYS 1667 ? CG ? A LYS 32 CG 14 1 Y 1 A LYS 1667 ? CD ? A LYS 32 CD 15 1 Y 1 A LYS 1667 ? CE ? A LYS 32 CE 16 1 Y 1 A LYS 1667 ? NZ ? A LYS 32 NZ 17 1 Y 1 A GLU 1682 ? CG ? A GLU 47 CG 18 1 Y 1 A GLU 1682 ? CD ? A GLU 47 CD 19 1 Y 1 A GLU 1682 ? OE1 ? A GLU 47 OE1 20 1 Y 1 A GLU 1682 ? OE2 ? A GLU 47 OE2 21 1 Y 1 A LYS 1724 ? CG ? A LYS 89 CG 22 1 Y 1 A LYS 1724 ? CD ? A LYS 89 CD 23 1 Y 1 A LYS 1724 ? CE ? A LYS 89 CE 24 1 Y 1 A LYS 1724 ? NZ ? A LYS 89 NZ 25 1 Y 1 A ARG 1726 ? CG ? A ARG 91 CG 26 1 Y 1 A ARG 1726 ? CD ? A ARG 91 CD 27 1 Y 1 A ARG 1726 ? NE ? A ARG 91 NE 28 1 Y 1 A ARG 1726 ? CZ ? A ARG 91 CZ 29 1 Y 1 A ARG 1726 ? NH1 ? A ARG 91 NH1 30 1 Y 1 A ARG 1726 ? NH2 ? A ARG 91 NH2 31 1 Y 1 A GLU 1794 ? CG ? A GLU 159 CG 32 1 Y 1 A GLU 1794 ? CD ? A GLU 159 CD 33 1 Y 1 A GLU 1794 ? OE1 ? A GLU 159 OE1 34 1 Y 1 A GLU 1794 ? OE2 ? A GLU 159 OE2 35 1 Y 1 A GLU 1817 ? CG ? A GLU 182 CG 36 1 Y 1 A GLU 1817 ? CD ? A GLU 182 CD 37 1 Y 1 A GLU 1817 ? OE1 ? A GLU 182 OE1 38 1 Y 1 A GLU 1817 ? OE2 ? A GLU 182 OE2 39 1 Y 1 A ASP 1818 ? CG ? A ASP 183 CG 40 1 Y 1 A ASP 1818 ? OD1 ? A ASP 183 OD1 41 1 Y 1 A ASP 1818 ? OD2 ? A ASP 183 OD2 42 1 Y 1 A ASN 1819 ? CG ? A ASN 184 CG 43 1 Y 1 A ASN 1819 ? OD1 ? A ASN 184 OD1 44 1 Y 1 A ASN 1819 ? ND2 ? A ASN 184 ND2 45 1 Y 1 A GLN 1826 ? CG ? A GLN 191 CG 46 1 Y 1 A GLN 1826 ? CD ? A GLN 191 CD 47 1 Y 1 A GLN 1826 ? OE1 ? A GLN 191 OE1 48 1 Y 1 A GLN 1826 ? NE2 ? A GLN 191 NE2 49 1 Y 1 A GLU 1829 ? CG ? A GLU 194 CG 50 1 Y 1 A GLU 1829 ? CD ? A GLU 194 CD 51 1 Y 1 A GLU 1829 ? OE1 ? A GLU 194 OE1 52 1 Y 1 A GLU 1829 ? OE2 ? A GLU 194 OE2 53 1 Y 1 A GLN 1846 ? CG ? A GLN 211 CG 54 1 Y 1 A GLN 1846 ? CD ? A GLN 211 CD 55 1 Y 1 A GLN 1846 ? OE1 ? A GLN 211 OE1 56 1 Y 1 A GLN 1846 ? NE2 ? A GLN 211 NE2 57 1 Y 1 B TYR 403 ? CG ? B TYR 1 CG 58 1 Y 1 B TYR 403 ? CD1 ? B TYR 1 CD1 59 1 Y 1 B TYR 403 ? CD2 ? B TYR 1 CD2 60 1 Y 1 B TYR 403 ? CE1 ? B TYR 1 CE1 61 1 Y 1 B TYR 403 ? CE2 ? B TYR 1 CE2 62 1 Y 1 B TYR 403 ? CZ ? B TYR 1 CZ 63 1 Y 1 B TYR 403 ? OH ? B TYR 1 OH # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1636 ? A MET 1 2 1 Y 1 A SER 1637 ? A SER 2 3 1 Y 1 A HIS 1638 ? A HIS 3 4 1 Y 1 A HIS 1639 ? A HIS 4 5 1 Y 1 A HIS 1640 ? A HIS 5 6 1 Y 1 A HIS 1641 ? A HIS 6 7 1 Y 1 A HIS 1642 ? A HIS 7 8 1 Y 1 A HIS 1643 ? A HIS 8 9 1 Y 1 A SER 1644 ? A SER 9 10 1 Y 1 A MET 1645 ? A MET 10 # _pdbx_audit_support.funding_organization 'Wellcome Trust' _pdbx_audit_support.country 'United Kingdom' _pdbx_audit_support.grant_number 093167/Z/10/Z _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #