data_4YCR # _entry.id 4YCR # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.329 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4YCR WWPDB D_1000207228 # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'It is the same protein solved with the InSitu method and a detergent molecule in the channel cavity which 3M71 does not have.' _pdbx_database_related.db_id 3M71 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4YCR _pdbx_database_status.recvd_initial_deposition_date 2015-02-20 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Axford, D.' 1 'Hu, N.J.' 2 'Foadi, J.' 3 'Choudhury, H.G.' 4 'Iwata, S.' 5 'Beis, K.' 6 'Evans, G.' 7 'Alguel, Y.' 8 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_id_ASTM ABCRE6 _citation.journal_id_CSD ? _citation.journal_id_ISSN 1399-0047 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 71 _citation.language ? _citation.page_first 1228 _citation.page_last 1237 _citation.title 'Structure determination of an integral membrane protein at room temperature from crystals in situ.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S139900471500423X _citation.pdbx_database_id_PubMed 26057664 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Axford, D.' 1 ? primary 'Foadi, J.' 2 ? primary 'Hu, N.J.' 3 ? primary 'Choudhury, H.G.' 4 ? primary 'Iwata, S.' 5 ? primary 'Beis, K.' 6 ? primary 'Evans, G.' 7 ? primary 'Alguel, Y.' 8 ? # _cell.length_a 98.605 _cell.length_b 98.605 _cell.length_c 136.378 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4YCR _cell.Z_PDB 9 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'H 3' _symmetry.entry_id 4YCR _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 146 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tellurite resistance protein TehA homolog' 33467.375 1 ? ? ? ? 2 non-polymer syn 'octyl beta-D-glucopyranoside' 292.369 2 ? ? ? ? 3 water nat water 18.015 71 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;PLPTGYFGIPLGLAALSLAWFHLENLFPAARMVSDVLGIVASAVWILFILMYAYKLRYYFEEVRAEYHSPVRFSFIALIP ITTMLVGDILYRWNPLIAEVLIWIGTIGQLLFSTLRVSELWQGGVFEQKSTHPSFYLPAVAANFTSASSLALLGYHDLGY LFFGAGMIAWIIFEPVLLQHLRISSLEPQFRATMGIVLAPAFVCVSAYLSINHGEVDTLAKILWGYGFLQLFFLLRLFPW IVEKGLNIGLWAFSFGLASMANSATAFYHGNVLQGVSIFAFVFSNVMIGLLVLMTIYKL ; _entity_poly.pdbx_seq_one_letter_code_can ;PLPTGYFGIPLGLAALSLAWFHLENLFPAARMVSDVLGIVASAVWILFILMYAYKLRYYFEEVRAEYHSPVRFSFIALIP ITTMLVGDILYRWNPLIAEVLIWIGTIGQLLFSTLRVSELWQGGVFEQKSTHPSFYLPAVAANFTSASSLALLGYHDLGY LFFGAGMIAWIIFEPVLLQHLRISSLEPQFRATMGIVLAPAFVCVSAYLSINHGEVDTLAKILWGYGFLQLFFLLRLFPW IVEKGLNIGLWAFSFGLASMANSATAFYHGNVLQGVSIFAFVFSNVMIGLLVLMTIYKL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 LEU n 1 3 PRO n 1 4 THR n 1 5 GLY n 1 6 TYR n 1 7 PHE n 1 8 GLY n 1 9 ILE n 1 10 PRO n 1 11 LEU n 1 12 GLY n 1 13 LEU n 1 14 ALA n 1 15 ALA n 1 16 LEU n 1 17 SER n 1 18 LEU n 1 19 ALA n 1 20 TRP n 1 21 PHE n 1 22 HIS n 1 23 LEU n 1 24 GLU n 1 25 ASN n 1 26 LEU n 1 27 PHE n 1 28 PRO n 1 29 ALA n 1 30 ALA n 1 31 ARG n 1 32 MET n 1 33 VAL n 1 34 SER n 1 35 ASP n 1 36 VAL n 1 37 LEU n 1 38 GLY n 1 39 ILE n 1 40 VAL n 1 41 ALA n 1 42 SER n 1 43 ALA n 1 44 VAL n 1 45 TRP n 1 46 ILE n 1 47 LEU n 1 48 PHE n 1 49 ILE n 1 50 LEU n 1 51 MET n 1 52 TYR n 1 53 ALA n 1 54 TYR n 1 55 LYS n 1 56 LEU n 1 57 ARG n 1 58 TYR n 1 59 TYR n 1 60 PHE n 1 61 GLU n 1 62 GLU n 1 63 VAL n 1 64 ARG n 1 65 ALA n 1 66 GLU n 1 67 TYR n 1 68 HIS n 1 69 SER n 1 70 PRO n 1 71 VAL n 1 72 ARG n 1 73 PHE n 1 74 SER n 1 75 PHE n 1 76 ILE n 1 77 ALA n 1 78 LEU n 1 79 ILE n 1 80 PRO n 1 81 ILE n 1 82 THR n 1 83 THR n 1 84 MET n 1 85 LEU n 1 86 VAL n 1 87 GLY n 1 88 ASP n 1 89 ILE n 1 90 LEU n 1 91 TYR n 1 92 ARG n 1 93 TRP n 1 94 ASN n 1 95 PRO n 1 96 LEU n 1 97 ILE n 1 98 ALA n 1 99 GLU n 1 100 VAL n 1 101 LEU n 1 102 ILE n 1 103 TRP n 1 104 ILE n 1 105 GLY n 1 106 THR n 1 107 ILE n 1 108 GLY n 1 109 GLN n 1 110 LEU n 1 111 LEU n 1 112 PHE n 1 113 SER n 1 114 THR n 1 115 LEU n 1 116 ARG n 1 117 VAL n 1 118 SER n 1 119 GLU n 1 120 LEU n 1 121 TRP n 1 122 GLN n 1 123 GLY n 1 124 GLY n 1 125 VAL n 1 126 PHE n 1 127 GLU n 1 128 GLN n 1 129 LYS n 1 130 SER n 1 131 THR n 1 132 HIS n 1 133 PRO n 1 134 SER n 1 135 PHE n 1 136 TYR n 1 137 LEU n 1 138 PRO n 1 139 ALA n 1 140 VAL n 1 141 ALA n 1 142 ALA n 1 143 ASN n 1 144 PHE n 1 145 THR n 1 146 SER n 1 147 ALA n 1 148 SER n 1 149 SER n 1 150 LEU n 1 151 ALA n 1 152 LEU n 1 153 LEU n 1 154 GLY n 1 155 TYR n 1 156 HIS n 1 157 ASP n 1 158 LEU n 1 159 GLY n 1 160 TYR n 1 161 LEU n 1 162 PHE n 1 163 PHE n 1 164 GLY n 1 165 ALA n 1 166 GLY n 1 167 MET n 1 168 ILE n 1 169 ALA n 1 170 TRP n 1 171 ILE n 1 172 ILE n 1 173 PHE n 1 174 GLU n 1 175 PRO n 1 176 VAL n 1 177 LEU n 1 178 LEU n 1 179 GLN n 1 180 HIS n 1 181 LEU n 1 182 ARG n 1 183 ILE n 1 184 SER n 1 185 SER n 1 186 LEU n 1 187 GLU n 1 188 PRO n 1 189 GLN n 1 190 PHE n 1 191 ARG n 1 192 ALA n 1 193 THR n 1 194 MET n 1 195 GLY n 1 196 ILE n 1 197 VAL n 1 198 LEU n 1 199 ALA n 1 200 PRO n 1 201 ALA n 1 202 PHE n 1 203 VAL n 1 204 CYS n 1 205 VAL n 1 206 SER n 1 207 ALA n 1 208 TYR n 1 209 LEU n 1 210 SER n 1 211 ILE n 1 212 ASN n 1 213 HIS n 1 214 GLY n 1 215 GLU n 1 216 VAL n 1 217 ASP n 1 218 THR n 1 219 LEU n 1 220 ALA n 1 221 LYS n 1 222 ILE n 1 223 LEU n 1 224 TRP n 1 225 GLY n 1 226 TYR n 1 227 GLY n 1 228 PHE n 1 229 LEU n 1 230 GLN n 1 231 LEU n 1 232 PHE n 1 233 PHE n 1 234 LEU n 1 235 LEU n 1 236 ARG n 1 237 LEU n 1 238 PHE n 1 239 PRO n 1 240 TRP n 1 241 ILE n 1 242 VAL n 1 243 GLU n 1 244 LYS n 1 245 GLY n 1 246 LEU n 1 247 ASN n 1 248 ILE n 1 249 GLY n 1 250 LEU n 1 251 TRP n 1 252 ALA n 1 253 PHE n 1 254 SER n 1 255 PHE n 1 256 GLY n 1 257 LEU n 1 258 ALA n 1 259 SER n 1 260 MET n 1 261 ALA n 1 262 ASN n 1 263 SER n 1 264 ALA n 1 265 THR n 1 266 ALA n 1 267 PHE n 1 268 TYR n 1 269 HIS n 1 270 GLY n 1 271 ASN n 1 272 VAL n 1 273 LEU n 1 274 GLN n 1 275 GLY n 1 276 VAL n 1 277 SER n 1 278 ILE n 1 279 PHE n 1 280 ALA n 1 281 PHE n 1 282 VAL n 1 283 PHE n 1 284 SER n 1 285 ASN n 1 286 VAL n 1 287 MET n 1 288 ILE n 1 289 GLY n 1 290 LEU n 1 291 LEU n 1 292 VAL n 1 293 LEU n 1 294 MET n 1 295 THR n 1 296 ILE n 1 297 TYR n 1 298 LYS n 1 299 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 299 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'tehA, HI_0511' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 51907 / DSM 11121 / KW20 / Rd' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 71421 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TEHA_HAEIN _struct_ref.pdbx_db_accession P44741 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;PLPTGYFGIPLGLAALSLAWFHLENLFPAARMVSDVLGIVASAVWILFILMYAYKLRYYFEEVRAEYHSPVRFSFIALIP ITTMLVGDILYRWNPLIAEVLIWIGTIGQLLFSTLRVSELWQGGVFEQKSTHPSFYLPAVAANFTSASSLALLGYHDLGY LFFGAGMIAWIIFEPVLLQHLRISSLEPQFRATMGIVLAPAFVCVSAYLSINHGEVDTLAKILWGYGFLQLFFLLRLFPW IVEKGLNIGLWAFSFGLASMANSATAFYHGNVLQGVSIFAFVFSNVMIGLLVLMTIYKL ; _struct_ref.pdbx_align_begin 22 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4YCR _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 299 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P44741 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 320 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 8 _struct_ref_seq.pdbx_auth_seq_align_end 306 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BOG D-saccharide n 'octyl beta-D-glucopyranoside' ? 'C14 H28 O6' 292.369 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4YCR _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.81 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 67.74 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'of 0.1M NaCl, 120 mM Tris pH 9.4, and 20 % v/v PEG 400' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 293 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-05-02 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_synchrotron_site Diamond # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4YCR _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.30 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 20429 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 92.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.096 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.3 _reflns_shell.d_res_low 2.38 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.7 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 90.5 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.513 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.6 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.entry_id 4YCR _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 2.3000 _refine.ls_d_res_low 36.1880 _refine.pdbx_ls_sigma_F 1.990 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 92.9100 _refine.ls_number_reflns_obs 20429 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1581 _refine.ls_R_factor_R_work 0.1559 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2010 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.9400 _refine.ls_number_reflns_R_free 1010 _refine.ls_number_reflns_R_work 19419 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 29.4975 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.2300 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 125.220 _refine.B_iso_min 7.470 _refine.pdbx_overall_phase_error 19.4300 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.3000 _refine_hist.d_res_low 36.1880 _refine_hist.pdbx_number_atoms_ligand 40 _refine_hist.number_atoms_solvent 71 _refine_hist.number_atoms_total 2486 _refine_hist.pdbx_number_residues_total 299 _refine_hist.pdbx_B_iso_mean_ligand 50.30 _refine_hist.pdbx_B_iso_mean_solvent 34.68 _refine_hist.pdbx_number_atoms_protein 2375 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 2539 0.010 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 3473 1.364 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 401 0.040 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 415 0.009 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 876 14.253 ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_obs 2.3001 2.4214 7 91.0000 2723 . 0.2049 0.2600 . 154 . 2877 . 'X-RAY DIFFRACTION' . 2.4214 2.5730 7 94.0000 2790 . 0.1684 0.2075 . 144 . 2934 . 'X-RAY DIFFRACTION' . 2.5730 2.7716 7 95.0000 2832 . 0.1634 0.2349 . 146 . 2978 . 'X-RAY DIFFRACTION' . 2.7716 3.0504 7 94.0000 2825 . 0.1501 0.1992 . 144 . 2969 . 'X-RAY DIFFRACTION' . 3.0504 3.4915 7 93.0000 2785 . 0.1436 0.1980 . 145 . 2930 . 'X-RAY DIFFRACTION' . 3.4915 4.3977 7 93.0000 2775 . 0.1410 0.1923 . 139 . 2914 . 'X-RAY DIFFRACTION' . 4.3977 36.1926 7 90.0000 2689 . 0.1580 0.1797 . 138 . 2827 . 'X-RAY DIFFRACTION' . # _struct.entry_id 4YCR _struct.title 'Structure determination of an integral membrane protein at room temperature from crystals in situ' _struct.pdbx_descriptor 'Tellurite resistance protein TehA homolog from Haemophilus influenzae' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4YCR _struct_keywords.text 'In situ data collection, membrane protein, multiple datasets, synchrotron beamline' _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 PRO A 3 ? TYR A 6 ? PRO A 10 TYR A 13 5 ? 4 HELX_P HELX_P2 AA2 PHE A 7 ? HIS A 22 ? PHE A 14 HIS A 29 1 ? 16 HELX_P HELX_P3 AA3 PRO A 28 ? TYR A 59 ? PRO A 35 TYR A 66 1 ? 32 HELX_P HELX_P4 AA4 TYR A 59 ? SER A 69 ? TYR A 66 SER A 76 1 ? 11 HELX_P HELX_P5 AA5 VAL A 71 ? ILE A 76 ? VAL A 78 ILE A 83 5 ? 6 HELX_P HELX_P6 AA6 ALA A 77 ? ARG A 92 ? ALA A 84 ARG A 99 1 ? 16 HELX_P HELX_P7 AA7 ASN A 94 ? GLN A 122 ? ASN A 101 GLN A 129 1 ? 29 HELX_P HELX_P8 AA8 GLU A 127 ? THR A 131 ? GLU A 134 THR A 138 5 ? 5 HELX_P HELX_P9 AA9 HIS A 132 ? SER A 134 ? HIS A 139 SER A 141 5 ? 3 HELX_P HELX_P10 AB1 PHE A 135 ? VAL A 140 ? PHE A 142 VAL A 147 1 ? 6 HELX_P HELX_P11 AB2 VAL A 140 ? LEU A 153 ? VAL A 147 LEU A 160 1 ? 14 HELX_P HELX_P12 AB3 TYR A 155 ? SER A 184 ? TYR A 162 SER A 191 1 ? 30 HELX_P HELX_P13 AB4 GLU A 187 ? VAL A 197 ? GLU A 194 VAL A 204 5 ? 11 HELX_P HELX_P14 AB5 LEU A 198 ? ASN A 212 ? LEU A 205 ASN A 219 1 ? 15 HELX_P HELX_P15 AB6 ASP A 217 ? VAL A 242 ? ASP A 224 VAL A 249 1 ? 26 HELX_P HELX_P16 AB7 ASN A 247 ? GLY A 249 ? ASN A 254 GLY A 256 5 ? 3 HELX_P HELX_P17 AB8 LEU A 250 ? GLY A 270 ? LEU A 257 GLY A 277 1 ? 21 HELX_P HELX_P18 AB9 LEU A 273 ? LEU A 299 ? LEU A 280 LEU A 306 1 ? 27 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 4YCR _atom_sites.fract_transf_matrix[1][1] 0.010142 _atom_sites.fract_transf_matrix[1][2] 0.005855 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011710 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007333 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 8 8 PRO PRO A . n A 1 2 LEU 2 9 9 LEU LEU A . n A 1 3 PRO 3 10 10 PRO PRO A . n A 1 4 THR 4 11 11 THR THR A . n A 1 5 GLY 5 12 12 GLY GLY A . n A 1 6 TYR 6 13 13 TYR TYR A . n A 1 7 PHE 7 14 14 PHE PHE A . n A 1 8 GLY 8 15 15 GLY GLY A . n A 1 9 ILE 9 16 16 ILE ILE A . n A 1 10 PRO 10 17 17 PRO PRO A . n A 1 11 LEU 11 18 18 LEU LEU A . n A 1 12 GLY 12 19 19 GLY GLY A . n A 1 13 LEU 13 20 20 LEU LEU A . n A 1 14 ALA 14 21 21 ALA ALA A . n A 1 15 ALA 15 22 22 ALA ALA A . n A 1 16 LEU 16 23 23 LEU LEU A . n A 1 17 SER 17 24 24 SER SER A . n A 1 18 LEU 18 25 25 LEU LEU A . n A 1 19 ALA 19 26 26 ALA ALA A . n A 1 20 TRP 20 27 27 TRP TRP A . n A 1 21 PHE 21 28 28 PHE PHE A . n A 1 22 HIS 22 29 29 HIS HIS A . n A 1 23 LEU 23 30 30 LEU LEU A . n A 1 24 GLU 24 31 31 GLU GLU A . n A 1 25 ASN 25 32 32 ASN ASN A . n A 1 26 LEU 26 33 33 LEU LEU A . n A 1 27 PHE 27 34 34 PHE PHE A . n A 1 28 PRO 28 35 35 PRO PRO A . n A 1 29 ALA 29 36 36 ALA ALA A . n A 1 30 ALA 30 37 37 ALA ALA A . n A 1 31 ARG 31 38 38 ARG ARG A . n A 1 32 MET 32 39 39 MET MET A . n A 1 33 VAL 33 40 40 VAL VAL A . n A 1 34 SER 34 41 41 SER SER A . n A 1 35 ASP 35 42 42 ASP ASP A . n A 1 36 VAL 36 43 43 VAL VAL A . n A 1 37 LEU 37 44 44 LEU LEU A . n A 1 38 GLY 38 45 45 GLY GLY A . n A 1 39 ILE 39 46 46 ILE ILE A . n A 1 40 VAL 40 47 47 VAL VAL A . n A 1 41 ALA 41 48 48 ALA ALA A . n A 1 42 SER 42 49 49 SER SER A . n A 1 43 ALA 43 50 50 ALA ALA A . n A 1 44 VAL 44 51 51 VAL VAL A . n A 1 45 TRP 45 52 52 TRP TRP A . n A 1 46 ILE 46 53 53 ILE ILE A . n A 1 47 LEU 47 54 54 LEU LEU A . n A 1 48 PHE 48 55 55 PHE PHE A . n A 1 49 ILE 49 56 56 ILE ILE A . n A 1 50 LEU 50 57 57 LEU LEU A . n A 1 51 MET 51 58 58 MET MET A . n A 1 52 TYR 52 59 59 TYR TYR A . n A 1 53 ALA 53 60 60 ALA ALA A . n A 1 54 TYR 54 61 61 TYR TYR A . n A 1 55 LYS 55 62 62 LYS LYS A . n A 1 56 LEU 56 63 63 LEU LEU A . n A 1 57 ARG 57 64 64 ARG ARG A . n A 1 58 TYR 58 65 65 TYR TYR A . n A 1 59 TYR 59 66 66 TYR TYR A . n A 1 60 PHE 60 67 67 PHE PHE A . n A 1 61 GLU 61 68 68 GLU GLU A . n A 1 62 GLU 62 69 69 GLU GLU A . n A 1 63 VAL 63 70 70 VAL VAL A . n A 1 64 ARG 64 71 71 ARG ARG A . n A 1 65 ALA 65 72 72 ALA ALA A . n A 1 66 GLU 66 73 73 GLU GLU A . n A 1 67 TYR 67 74 74 TYR TYR A . n A 1 68 HIS 68 75 75 HIS HIS A . n A 1 69 SER 69 76 76 SER SER A . n A 1 70 PRO 70 77 77 PRO PRO A . n A 1 71 VAL 71 78 78 VAL VAL A . n A 1 72 ARG 72 79 79 ARG ARG A . n A 1 73 PHE 73 80 80 PHE PHE A . n A 1 74 SER 74 81 81 SER SER A . n A 1 75 PHE 75 82 82 PHE PHE A . n A 1 76 ILE 76 83 83 ILE ILE A . n A 1 77 ALA 77 84 84 ALA ALA A . n A 1 78 LEU 78 85 85 LEU LEU A . n A 1 79 ILE 79 86 86 ILE ILE A . n A 1 80 PRO 80 87 87 PRO PRO A . n A 1 81 ILE 81 88 88 ILE ILE A . n A 1 82 THR 82 89 89 THR THR A . n A 1 83 THR 83 90 90 THR THR A . n A 1 84 MET 84 91 91 MET MET A . n A 1 85 LEU 85 92 92 LEU LEU A . n A 1 86 VAL 86 93 93 VAL VAL A . n A 1 87 GLY 87 94 94 GLY GLY A . n A 1 88 ASP 88 95 95 ASP ASP A . n A 1 89 ILE 89 96 96 ILE ILE A . n A 1 90 LEU 90 97 97 LEU LEU A . n A 1 91 TYR 91 98 98 TYR TYR A . n A 1 92 ARG 92 99 99 ARG ARG A . n A 1 93 TRP 93 100 100 TRP TRP A . n A 1 94 ASN 94 101 101 ASN ASN A . n A 1 95 PRO 95 102 102 PRO PRO A . n A 1 96 LEU 96 103 103 LEU LEU A . n A 1 97 ILE 97 104 104 ILE ILE A . n A 1 98 ALA 98 105 105 ALA ALA A . n A 1 99 GLU 99 106 106 GLU GLU A . n A 1 100 VAL 100 107 107 VAL VAL A . n A 1 101 LEU 101 108 108 LEU LEU A . n A 1 102 ILE 102 109 109 ILE ILE A . n A 1 103 TRP 103 110 110 TRP TRP A . n A 1 104 ILE 104 111 111 ILE ILE A . n A 1 105 GLY 105 112 112 GLY GLY A . n A 1 106 THR 106 113 113 THR THR A . n A 1 107 ILE 107 114 114 ILE ILE A . n A 1 108 GLY 108 115 115 GLY GLY A . n A 1 109 GLN 109 116 116 GLN GLN A . n A 1 110 LEU 110 117 117 LEU LEU A . n A 1 111 LEU 111 118 118 LEU LEU A . n A 1 112 PHE 112 119 119 PHE PHE A . n A 1 113 SER 113 120 120 SER SER A . n A 1 114 THR 114 121 121 THR THR A . n A 1 115 LEU 115 122 122 LEU LEU A . n A 1 116 ARG 116 123 123 ARG ARG A . n A 1 117 VAL 117 124 124 VAL VAL A . n A 1 118 SER 118 125 125 SER SER A . n A 1 119 GLU 119 126 126 GLU GLU A . n A 1 120 LEU 120 127 127 LEU LEU A . n A 1 121 TRP 121 128 128 TRP TRP A . n A 1 122 GLN 122 129 129 GLN GLN A . n A 1 123 GLY 123 130 130 GLY GLY A . n A 1 124 GLY 124 131 131 GLY GLY A . n A 1 125 VAL 125 132 132 VAL VAL A . n A 1 126 PHE 126 133 133 PHE PHE A . n A 1 127 GLU 127 134 134 GLU GLU A . n A 1 128 GLN 128 135 135 GLN GLN A . n A 1 129 LYS 129 136 136 LYS LYS A . n A 1 130 SER 130 137 137 SER SER A . n A 1 131 THR 131 138 138 THR THR A . n A 1 132 HIS 132 139 139 HIS HIS A . n A 1 133 PRO 133 140 140 PRO PRO A . n A 1 134 SER 134 141 141 SER SER A . n A 1 135 PHE 135 142 142 PHE PHE A . n A 1 136 TYR 136 143 143 TYR TYR A . n A 1 137 LEU 137 144 144 LEU LEU A . n A 1 138 PRO 138 145 145 PRO PRO A . n A 1 139 ALA 139 146 146 ALA ALA A . n A 1 140 VAL 140 147 147 VAL VAL A . n A 1 141 ALA 141 148 148 ALA ALA A . n A 1 142 ALA 142 149 149 ALA ALA A . n A 1 143 ASN 143 150 150 ASN ASN A . n A 1 144 PHE 144 151 151 PHE PHE A . n A 1 145 THR 145 152 152 THR THR A . n A 1 146 SER 146 153 153 SER SER A . n A 1 147 ALA 147 154 154 ALA ALA A . n A 1 148 SER 148 155 155 SER SER A . n A 1 149 SER 149 156 156 SER SER A . n A 1 150 LEU 150 157 157 LEU LEU A . n A 1 151 ALA 151 158 158 ALA ALA A . n A 1 152 LEU 152 159 159 LEU LEU A . n A 1 153 LEU 153 160 160 LEU LEU A . n A 1 154 GLY 154 161 161 GLY GLY A . n A 1 155 TYR 155 162 162 TYR TYR A . n A 1 156 HIS 156 163 163 HIS HIS A . n A 1 157 ASP 157 164 164 ASP ASP A . n A 1 158 LEU 158 165 165 LEU LEU A . n A 1 159 GLY 159 166 166 GLY GLY A . n A 1 160 TYR 160 167 167 TYR TYR A . n A 1 161 LEU 161 168 168 LEU LEU A . n A 1 162 PHE 162 169 169 PHE PHE A . n A 1 163 PHE 163 170 170 PHE PHE A . n A 1 164 GLY 164 171 171 GLY GLY A . n A 1 165 ALA 165 172 172 ALA ALA A . n A 1 166 GLY 166 173 173 GLY GLY A . n A 1 167 MET 167 174 174 MET MET A . n A 1 168 ILE 168 175 175 ILE ILE A . n A 1 169 ALA 169 176 176 ALA ALA A . n A 1 170 TRP 170 177 177 TRP TRP A . n A 1 171 ILE 171 178 178 ILE ILE A . n A 1 172 ILE 172 179 179 ILE ILE A . n A 1 173 PHE 173 180 180 PHE PHE A . n A 1 174 GLU 174 181 181 GLU GLU A . n A 1 175 PRO 175 182 182 PRO PRO A . n A 1 176 VAL 176 183 183 VAL VAL A . n A 1 177 LEU 177 184 184 LEU LEU A . n A 1 178 LEU 178 185 185 LEU LEU A . n A 1 179 GLN 179 186 186 GLN GLN A . n A 1 180 HIS 180 187 187 HIS HIS A . n A 1 181 LEU 181 188 188 LEU LEU A . n A 1 182 ARG 182 189 189 ARG ARG A . n A 1 183 ILE 183 190 190 ILE ILE A . n A 1 184 SER 184 191 191 SER SER A . n A 1 185 SER 185 192 192 SER SER A . n A 1 186 LEU 186 193 193 LEU LEU A . n A 1 187 GLU 187 194 194 GLU GLU A . n A 1 188 PRO 188 195 195 PRO PRO A . n A 1 189 GLN 189 196 196 GLN GLN A . n A 1 190 PHE 190 197 197 PHE PHE A . n A 1 191 ARG 191 198 198 ARG ARG A . n A 1 192 ALA 192 199 199 ALA ALA A . n A 1 193 THR 193 200 200 THR THR A . n A 1 194 MET 194 201 201 MET MET A . n A 1 195 GLY 195 202 202 GLY GLY A . n A 1 196 ILE 196 203 203 ILE ILE A . n A 1 197 VAL 197 204 204 VAL VAL A . n A 1 198 LEU 198 205 205 LEU LEU A . n A 1 199 ALA 199 206 206 ALA ALA A . n A 1 200 PRO 200 207 207 PRO PRO A . n A 1 201 ALA 201 208 208 ALA ALA A . n A 1 202 PHE 202 209 209 PHE PHE A . n A 1 203 VAL 203 210 210 VAL VAL A . n A 1 204 CYS 204 211 211 CYS CYS A . n A 1 205 VAL 205 212 212 VAL VAL A . n A 1 206 SER 206 213 213 SER SER A . n A 1 207 ALA 207 214 214 ALA ALA A . n A 1 208 TYR 208 215 215 TYR TYR A . n A 1 209 LEU 209 216 216 LEU LEU A . n A 1 210 SER 210 217 217 SER SER A . n A 1 211 ILE 211 218 218 ILE ILE A . n A 1 212 ASN 212 219 219 ASN ASN A . n A 1 213 HIS 213 220 220 HIS HIS A . n A 1 214 GLY 214 221 221 GLY GLY A . n A 1 215 GLU 215 222 222 GLU GLU A . n A 1 216 VAL 216 223 223 VAL VAL A . n A 1 217 ASP 217 224 224 ASP ASP A . n A 1 218 THR 218 225 225 THR THR A . n A 1 219 LEU 219 226 226 LEU LEU A . n A 1 220 ALA 220 227 227 ALA ALA A . n A 1 221 LYS 221 228 228 LYS LYS A . n A 1 222 ILE 222 229 229 ILE ILE A . n A 1 223 LEU 223 230 230 LEU LEU A . n A 1 224 TRP 224 231 231 TRP TRP A . n A 1 225 GLY 225 232 232 GLY GLY A . n A 1 226 TYR 226 233 233 TYR TYR A . n A 1 227 GLY 227 234 234 GLY GLY A . n A 1 228 PHE 228 235 235 PHE PHE A . n A 1 229 LEU 229 236 236 LEU LEU A . n A 1 230 GLN 230 237 237 GLN GLN A . n A 1 231 LEU 231 238 238 LEU LEU A . n A 1 232 PHE 232 239 239 PHE PHE A . n A 1 233 PHE 233 240 240 PHE PHE A . n A 1 234 LEU 234 241 241 LEU LEU A . n A 1 235 LEU 235 242 242 LEU LEU A . n A 1 236 ARG 236 243 243 ARG ARG A . n A 1 237 LEU 237 244 244 LEU LEU A . n A 1 238 PHE 238 245 245 PHE PHE A . n A 1 239 PRO 239 246 246 PRO PRO A . n A 1 240 TRP 240 247 247 TRP TRP A . n A 1 241 ILE 241 248 248 ILE ILE A . n A 1 242 VAL 242 249 249 VAL VAL A . n A 1 243 GLU 243 250 250 GLU GLU A . n A 1 244 LYS 244 251 251 LYS LYS A . n A 1 245 GLY 245 252 252 GLY GLY A . n A 1 246 LEU 246 253 253 LEU LEU A . n A 1 247 ASN 247 254 254 ASN ASN A . n A 1 248 ILE 248 255 255 ILE ILE A . n A 1 249 GLY 249 256 256 GLY GLY A . n A 1 250 LEU 250 257 257 LEU LEU A . n A 1 251 TRP 251 258 258 TRP TRP A . n A 1 252 ALA 252 259 259 ALA ALA A . n A 1 253 PHE 253 260 260 PHE PHE A . n A 1 254 SER 254 261 261 SER SER A . n A 1 255 PHE 255 262 262 PHE PHE A . n A 1 256 GLY 256 263 263 GLY GLY A . n A 1 257 LEU 257 264 264 LEU LEU A . n A 1 258 ALA 258 265 265 ALA ALA A . n A 1 259 SER 259 266 266 SER SER A . n A 1 260 MET 260 267 267 MET MET A . n A 1 261 ALA 261 268 268 ALA ALA A . n A 1 262 ASN 262 269 269 ASN ASN A . n A 1 263 SER 263 270 270 SER SER A . n A 1 264 ALA 264 271 271 ALA ALA A . n A 1 265 THR 265 272 272 THR THR A . n A 1 266 ALA 266 273 273 ALA ALA A . n A 1 267 PHE 267 274 274 PHE PHE A . n A 1 268 TYR 268 275 275 TYR TYR A . n A 1 269 HIS 269 276 276 HIS HIS A . n A 1 270 GLY 270 277 277 GLY GLY A . n A 1 271 ASN 271 278 278 ASN ASN A . n A 1 272 VAL 272 279 279 VAL VAL A . n A 1 273 LEU 273 280 280 LEU LEU A . n A 1 274 GLN 274 281 281 GLN GLN A . n A 1 275 GLY 275 282 282 GLY GLY A . n A 1 276 VAL 276 283 283 VAL VAL A . n A 1 277 SER 277 284 284 SER SER A . n A 1 278 ILE 278 285 285 ILE ILE A . n A 1 279 PHE 279 286 286 PHE PHE A . n A 1 280 ALA 280 287 287 ALA ALA A . n A 1 281 PHE 281 288 288 PHE PHE A . n A 1 282 VAL 282 289 289 VAL VAL A . n A 1 283 PHE 283 290 290 PHE PHE A . n A 1 284 SER 284 291 291 SER SER A . n A 1 285 ASN 285 292 292 ASN ASN A . n A 1 286 VAL 286 293 293 VAL VAL A . n A 1 287 MET 287 294 294 MET MET A . n A 1 288 ILE 288 295 295 ILE ILE A . n A 1 289 GLY 289 296 296 GLY GLY A . n A 1 290 LEU 290 297 297 LEU LEU A . n A 1 291 LEU 291 298 298 LEU LEU A . n A 1 292 VAL 292 299 299 VAL VAL A . n A 1 293 LEU 293 300 300 LEU LEU A . n A 1 294 MET 294 301 301 MET MET A . n A 1 295 THR 295 302 302 THR THR A . n A 1 296 ILE 296 303 303 ILE ILE A . n A 1 297 TYR 297 304 304 TYR TYR A . n A 1 298 LYS 298 305 305 LYS LYS A . n A 1 299 LEU 299 306 306 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BOG 1 401 316 BOG BOG A . C 2 BOG 1 402 317 BOG BOG A . D 3 HOH 1 501 54 HOH HOH A . D 3 HOH 2 502 28 HOH HOH A . D 3 HOH 3 503 47 HOH HOH A . D 3 HOH 4 504 68 HOH HOH A . D 3 HOH 5 505 13 HOH HOH A . D 3 HOH 6 506 27 HOH HOH A . D 3 HOH 7 507 9 HOH HOH A . D 3 HOH 8 508 61 HOH HOH A . D 3 HOH 9 509 63 HOH HOH A . D 3 HOH 10 510 21 HOH HOH A . D 3 HOH 11 511 14 HOH HOH A . D 3 HOH 12 512 2 HOH HOH A . D 3 HOH 13 513 20 HOH HOH A . D 3 HOH 14 514 37 HOH HOH A . D 3 HOH 15 515 16 HOH HOH A . D 3 HOH 16 516 3 HOH HOH A . D 3 HOH 17 517 29 HOH HOH A . D 3 HOH 18 518 22 HOH HOH A . D 3 HOH 19 519 18 HOH HOH A . D 3 HOH 20 520 52 HOH HOH A . D 3 HOH 21 521 12 HOH HOH A . D 3 HOH 22 522 89 HOH HOH A . D 3 HOH 23 523 35 HOH HOH A . D 3 HOH 24 524 49 HOH HOH A . D 3 HOH 25 525 67 HOH HOH A . D 3 HOH 26 526 1 HOH HOH A . D 3 HOH 27 527 4 HOH HOH A . D 3 HOH 28 528 5 HOH HOH A . D 3 HOH 29 529 6 HOH HOH A . D 3 HOH 30 530 7 HOH HOH A . D 3 HOH 31 531 8 HOH HOH A . D 3 HOH 32 532 10 HOH HOH A . D 3 HOH 33 533 11 HOH HOH A . D 3 HOH 34 534 15 HOH HOH A . D 3 HOH 35 535 17 HOH HOH A . D 3 HOH 36 536 19 HOH HOH A . D 3 HOH 37 537 23 HOH HOH A . D 3 HOH 38 538 24 HOH HOH A . D 3 HOH 39 539 25 HOH HOH A . D 3 HOH 40 540 26 HOH HOH A . D 3 HOH 41 541 30 HOH HOH A . D 3 HOH 42 542 31 HOH HOH A . D 3 HOH 43 543 32 HOH HOH A . D 3 HOH 44 544 33 HOH HOH A . D 3 HOH 45 545 34 HOH HOH A . D 3 HOH 46 546 36 HOH HOH A . D 3 HOH 47 547 38 HOH HOH A . D 3 HOH 48 548 40 HOH HOH A . D 3 HOH 49 549 41 HOH HOH A . D 3 HOH 50 550 44 HOH HOH A . D 3 HOH 51 551 46 HOH HOH A . D 3 HOH 52 552 53 HOH HOH A . D 3 HOH 53 553 55 HOH HOH A . D 3 HOH 54 554 56 HOH HOH A . D 3 HOH 55 555 57 HOH HOH A . D 3 HOH 56 556 58 HOH HOH A . D 3 HOH 57 557 59 HOH HOH A . D 3 HOH 58 558 60 HOH HOH A . D 3 HOH 59 559 62 HOH HOH A . D 3 HOH 60 560 64 HOH HOH A . D 3 HOH 61 561 65 HOH HOH A . D 3 HOH 62 562 66 HOH HOH A . D 3 HOH 63 563 69 HOH HOH A . D 3 HOH 64 564 71 HOH HOH A . D 3 HOH 65 565 72 HOH HOH A . D 3 HOH 66 566 75 HOH HOH A . D 3 HOH 67 567 76 HOH HOH A . D 3 HOH 68 568 77 HOH HOH A . D 3 HOH 69 569 78 HOH HOH A . D 3 HOH 70 570 84 HOH HOH A . D 3 HOH 71 571 90 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 11230 ? 1 MORE -60 ? 1 'SSA (A^2)' 33820 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_675 -y+1,x-y+2,z -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 170.7888698803 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_465 -x+y-1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 -147.9075000000 -0.8660254038 -0.5000000000 0.0000000000 85.3944349402 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 525 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-06-03 2 'Structure model' 1 1 2015-06-17 3 'Structure model' 1 2 2020-07-29 # loop_ _pdbx_audit_revision_details.ordinal _pdbx_audit_revision_details.revision_ordinal _pdbx_audit_revision_details.data_content_type _pdbx_audit_revision_details.provider _pdbx_audit_revision_details.type _pdbx_audit_revision_details.description _pdbx_audit_revision_details.details 1 1 'Structure model' repository 'Initial release' ? ? 2 3 'Structure model' repository Remediation 'Carbohydrate remediation' ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp 2 3 'Structure model' entity 3 3 'Structure model' pdbx_chem_comp_identifier 4 3 'Structure model' pdbx_entity_nonpoly 5 3 'Structure model' struct_site 6 3 'Structure model' struct_site_gen # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_chem_comp.mon_nstd_flag' 2 3 'Structure model' '_chem_comp.name' 3 3 'Structure model' '_chem_comp.type' 4 3 'Structure model' '_entity.pdbx_description' 5 3 'Structure model' '_pdbx_entity_nonpoly.name' # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 6 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 O2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 BOG _pdbx_validate_close_contact.auth_seq_id_1 402 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 501 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.96 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA A ILE 190 ? ? C A ILE 190 ? ? N A SER 191 ? ? 131.13 117.20 13.93 2.20 Y 2 1 O A ILE 190 ? ? C A ILE 190 ? ? N A SER 191 ? ? 108.35 122.70 -14.35 1.60 Y 3 1 C A ILE 190 ? ? N A SER 191 ? ? CA A SER 191 ? ? 137.56 121.70 15.86 2.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 34 ? ? -159.27 86.71 2 1 VAL A 147 ? ? -121.95 -59.67 3 1 SER A 192 ? ? 58.34 -133.73 4 1 ASP A 224 ? ? -116.19 -162.44 # _pdbx_chem_comp_identifier.comp_id BOG _pdbx_chem_comp_identifier.type 'IUPAC CARBOHYDRATE SYMBOL' _pdbx_chem_comp_identifier.program PDB-CARE _pdbx_chem_comp_identifier.program_version 1.0 _pdbx_chem_comp_identifier.identifier b-octylglucoside # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'octyl beta-D-glucopyranoside' BOG 3 water HOH #