data_4YII # _entry.id 4YII # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4YII WWPDB D_1000207530 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4YII _pdbx_database_status.recvd_initial_deposition_date 2015-03-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Brown, N.G.' 1 'Cho, S.E.' 2 'Schulman, B.A.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0353 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal Structure of E2 Complex' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Brown, N.G.' 1 primary 'Cho, S.E.' 2 primary 'Schulman, B.A.' 3 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 100.12 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4YII _cell.details ? _cell.formula_units_Z ? _cell.length_a 133.113 _cell.length_a_esd ? _cell.length_b 33.188 _cell.length_b_esd ? _cell.length_c 51.963 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4YII _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ubiquitin-conjugating enzyme E2 C' 17360.707 1 6.3.2.19 ? 'unp residues 27-179' ? 2 polymer man 'Anaphase-promoting complex subunit 2' 10259.662 1 ? ? 'unp residues 735-822' ? 3 water nat water 18.015 64 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'UbcH10,Ubiquitin carrier protein C,Ubiquitin-protein ligase C' 2 'APC2,Cyclosome subunit 2' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYH PNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP ; ;GSARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYH PNVDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP ; U ? 2 'polypeptide(L)' no no ;GSESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSA GVYRLPKNCS ; ;GSESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSA GVYRLPKNCS ; A ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 ARG n 1 5 GLY n 1 6 PRO n 1 7 VAL n 1 8 GLY n 1 9 LYS n 1 10 ARG n 1 11 LEU n 1 12 GLN n 1 13 GLN n 1 14 GLU n 1 15 LEU n 1 16 MET n 1 17 THR n 1 18 LEU n 1 19 MET n 1 20 MET n 1 21 SER n 1 22 GLY n 1 23 ASP n 1 24 LYS n 1 25 GLY n 1 26 ILE n 1 27 SER n 1 28 ALA n 1 29 PHE n 1 30 PRO n 1 31 GLU n 1 32 SER n 1 33 ASP n 1 34 ASN n 1 35 LEU n 1 36 PHE n 1 37 LYS n 1 38 TRP n 1 39 VAL n 1 40 GLY n 1 41 THR n 1 42 ILE n 1 43 HIS n 1 44 GLY n 1 45 ALA n 1 46 ALA n 1 47 GLY n 1 48 THR n 1 49 VAL n 1 50 TYR n 1 51 GLU n 1 52 ASP n 1 53 LEU n 1 54 ARG n 1 55 TYR n 1 56 LYS n 1 57 LEU n 1 58 SER n 1 59 LEU n 1 60 GLU n 1 61 PHE n 1 62 PRO n 1 63 SER n 1 64 GLY n 1 65 TYR n 1 66 PRO n 1 67 TYR n 1 68 ASN n 1 69 ALA n 1 70 PRO n 1 71 THR n 1 72 VAL n 1 73 LYS n 1 74 PHE n 1 75 LEU n 1 76 THR n 1 77 PRO n 1 78 CYS n 1 79 TYR n 1 80 HIS n 1 81 PRO n 1 82 ASN n 1 83 VAL n 1 84 ASP n 1 85 THR n 1 86 GLN n 1 87 GLY n 1 88 ASN n 1 89 ILE n 1 90 CYS n 1 91 LEU n 1 92 ASP n 1 93 ILE n 1 94 LEU n 1 95 LYS n 1 96 GLU n 1 97 LYS n 1 98 TRP n 1 99 SER n 1 100 ALA n 1 101 LEU n 1 102 TYR n 1 103 ASP n 1 104 VAL n 1 105 ARG n 1 106 THR n 1 107 ILE n 1 108 LEU n 1 109 LEU n 1 110 SER n 1 111 ILE n 1 112 GLN n 1 113 SER n 1 114 LEU n 1 115 LEU n 1 116 GLY n 1 117 GLU n 1 118 PRO n 1 119 ASN n 1 120 ILE n 1 121 ASP n 1 122 SER n 1 123 PRO n 1 124 LEU n 1 125 ASN n 1 126 THR n 1 127 HIS n 1 128 ALA n 1 129 ALA n 1 130 GLU n 1 131 LEU n 1 132 TRP n 1 133 LYS n 1 134 ASN n 1 135 PRO n 1 136 THR n 1 137 ALA n 1 138 PHE n 1 139 LYS n 1 140 LYS n 1 141 TYR n 1 142 LEU n 1 143 GLN n 1 144 GLU n 1 145 THR n 1 146 TYR n 1 147 SER n 1 148 LYS n 1 149 GLN n 1 150 VAL n 1 151 THR n 1 152 SER n 1 153 GLN n 1 154 GLU n 1 155 PRO n 2 1 GLY n 2 2 SER n 2 3 GLU n 2 4 SER n 2 5 ASP n 2 6 SER n 2 7 GLY n 2 8 MET n 2 9 ALA n 2 10 SER n 2 11 GLN n 2 12 ALA n 2 13 ASP n 2 14 GLN n 2 15 LYS n 2 16 GLU n 2 17 GLU n 2 18 GLU n 2 19 LEU n 2 20 LEU n 2 21 LEU n 2 22 PHE n 2 23 TRP n 2 24 THR n 2 25 TYR n 2 26 ILE n 2 27 GLN n 2 28 ALA n 2 29 MET n 2 30 LEU n 2 31 THR n 2 32 ASN n 2 33 LEU n 2 34 GLU n 2 35 SER n 2 36 LEU n 2 37 SER n 2 38 LEU n 2 39 ASP n 2 40 ARG n 2 41 ILE n 2 42 TYR n 2 43 ASN n 2 44 MET n 2 45 LEU n 2 46 ARG n 2 47 MET n 2 48 PHE n 2 49 VAL n 2 50 VAL n 2 51 THR n 2 52 GLY n 2 53 PRO n 2 54 ALA n 2 55 LEU n 2 56 ALA n 2 57 GLU n 2 58 ILE n 2 59 ASP n 2 60 LEU n 2 61 GLN n 2 62 GLU n 2 63 LEU n 2 64 GLN n 2 65 GLY n 2 66 TYR n 2 67 LEU n 2 68 GLN n 2 69 LYS n 2 70 LYS n 2 71 VAL n 2 72 ARG n 2 73 ASP n 2 74 GLN n 2 75 GLN n 2 76 LEU n 2 77 VAL n 2 78 TYR n 2 79 SER n 2 80 ALA n 2 81 GLY n 2 82 VAL n 2 83 TYR n 2 84 ARG n 2 85 LEU n 2 86 PRO n 2 87 LYS n 2 88 ASN n 2 89 CYS n 2 90 SER n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 155 Human ? 'UBE2C, UBCH10' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 90 Human ? 'ANAPC2, APC2, KIAA1406' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP UBE2C_HUMAN O00762 ? 1 ;ARGPVGKRLQQELMTLMMSGDKGISAFPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPN VDTQGNICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSKQVTSQEP ; 27 2 UNP ANC2_HUMAN Q9UJX6 ? 2 ;ESDSGMASQADQKEEELLLFWTYIQAMLTNLESLSLDRIYNMLRMFVVTGPALAEIDLQELQGYLQKKVRDQQLVYSAGV YRLPKNCS ; 735 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4YII U 3 ? 155 ? O00762 27 ? 179 ? 27 179 2 2 4YII A 3 ? 90 ? Q9UJX6 735 ? 822 ? 735 822 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4YII GLY U 1 ? UNP O00762 ? ? 'expression tag' 25 1 1 4YII SER U 2 ? UNP O00762 ? ? 'expression tag' 26 2 2 4YII GLY A 1 ? UNP Q9UJX6 ? ? 'expression tag' 733 3 2 4YII SER A 2 ? UNP Q9UJX6 ? ? 'expression tag' 734 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4YII _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.05 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 39.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3000, MES' _exptl_crystal_grow.pdbx_pH_range 6.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100.0 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-11-20 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.2826 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.2826 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4YII _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.8 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21055 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 2.9 _reflns.pdbx_Rmerge_I_obs 0.05 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 28.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.Rmerge_I_obs 0.347 _reflns_shell.d_res_high 1.8 _reflns_shell.d_res_low 1.86 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_gt ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all 21055 _reflns_shell.number_unique_gt ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_rejects ? _reflns_shell.percent_possible_all 68.2 _reflns_shell.percent_possible_gt ? _reflns_shell.percent_possible_obs ? # _refine.aniso_B[1][1] -5.8068 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 6.1647 _refine.aniso_B[2][2] 11.4234 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -5.6166 _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4YII _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.804 _refine.ls_d_res_low 44.272 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19692 _refine.ls_number_reflns_R_free 967 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.87 _refine.ls_percent_reflns_R_free 4.91 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1985 _refine.ls_R_factor_R_free 0.2454 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1963 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol 50.613 _refine.solvent_model_param_ksol 0.378 _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.37 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model '1LDD, 1I7K' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.83 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.71 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.51 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1694 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 64 _refine_hist.number_atoms_total 1758 _refine_hist.d_res_high 1.804 _refine_hist.d_res_low 44.272 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.013 ? 1747 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.499 ? 2383 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.242 ? 626 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.107 ? 270 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 ? 302 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.8042 1.8993 . . 105 2136 76.00 . . . 0.3045 . 0.2997 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8993 2.0183 . . 160 2646 94.00 . . . 0.2925 . 0.2432 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0183 2.1742 . . 142 2740 97.00 . . . 0.2778 . 0.2113 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1742 2.3930 . . 153 2763 98.00 . . . 0.2476 . 0.2028 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3930 2.7392 . . 130 2808 98.00 . . . 0.2644 . 0.1971 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7392 3.4509 . . 141 2772 97.00 . . . 0.2512 . 0.1955 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.4509 44.2853 . . 136 2860 97.00 . . . 0.2191 . 0.1821 . . . . . . . . . . # _struct.entry_id 4YII _struct.title 'Structure of an APC2-UBCH10 complex reveals distinctive cullin-RING ligase mechanism for Anaphase-promoting complex/Cyclosome' _struct.pdbx_descriptor 'molecule, molecule 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4YII _struct_keywords.text 'ligase-cell cycle complex' _struct_keywords.pdbx_keywords 'ligase/cell cycle' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 5 ? GLY A 22 ? GLY U 29 GLY U 46 1 ? 18 HELX_P HELX_P2 AA2 LEU A 91 ? LYS A 95 ? LEU U 115 LYS U 119 5 ? 5 HELX_P HELX_P3 AA3 ASP A 103 ? GLU A 117 ? ASP U 127 GLU U 141 1 ? 15 HELX_P HELX_P4 AA4 ASN A 125 ? TRP A 132 ? ASN U 149 TRP U 156 1 ? 8 HELX_P HELX_P5 AA5 ASN A 134 ? GLN A 149 ? ASN U 158 GLN U 173 1 ? 16 HELX_P HELX_P6 AA6 GLU B 16 ? GLU B 34 ? GLU A 748 GLU A 766 1 ? 19 HELX_P HELX_P7 AA7 SER B 37 ? VAL B 49 ? SER A 769 VAL A 781 1 ? 13 HELX_P HELX_P8 AA8 ASP B 59 ? ASP B 73 ? ASP A 791 ASP A 805 1 ? 15 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TYR _struct_mon_prot_cis.label_seq_id 65 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TYR _struct_mon_prot_cis.auth_seq_id 89 _struct_mon_prot_cis.auth_asym_id U _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 66 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 90 _struct_mon_prot_cis.pdbx_auth_asym_id_2 U _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -5.33 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ILE A 26 ? PRO A 30 ? ILE U 50 PRO U 54 AA1 2 LYS A 37 ? HIS A 43 ? LYS U 61 HIS U 67 AA1 3 ARG A 54 ? GLU A 60 ? ARG U 78 GLU U 84 AA1 4 THR A 71 ? PHE A 74 ? THR U 95 PHE U 98 AA2 1 VAL B 77 ? SER B 79 ? VAL A 809 SER A 811 AA2 2 VAL B 82 ? ARG B 84 ? VAL A 814 ARG A 816 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N PHE A 29 ? N PHE U 53 O VAL A 39 ? O VAL U 63 AA1 2 3 N ILE A 42 ? N ILE U 66 O TYR A 55 ? O TYR U 79 AA1 3 4 N GLU A 60 ? N GLU U 84 O THR A 71 ? O THR U 95 AA2 1 2 N VAL B 77 ? N VAL A 809 O ARG B 84 ? O ARG A 816 # _atom_sites.entry_id 4YII _atom_sites.fract_transf_matrix[1][1] 0.007512 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.001342 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.030131 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.019549 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 25 ? ? ? U . n A 1 2 SER 2 26 ? ? ? U . n A 1 3 ALA 3 27 ? ? ? U . n A 1 4 ARG 4 28 ? ? ? U . n A 1 5 GLY 5 29 29 GLY GLY U . n A 1 6 PRO 6 30 30 PRO PRO U . n A 1 7 VAL 7 31 31 VAL VAL U . n A 1 8 GLY 8 32 32 GLY GLY U . n A 1 9 LYS 9 33 33 LYS LYS U . n A 1 10 ARG 10 34 34 ARG ARG U . n A 1 11 LEU 11 35 35 LEU LEU U . n A 1 12 GLN 12 36 36 GLN GLN U . n A 1 13 GLN 13 37 37 GLN GLN U . n A 1 14 GLU 14 38 38 GLU GLU U . n A 1 15 LEU 15 39 39 LEU LEU U . n A 1 16 MET 16 40 40 MET MET U . n A 1 17 THR 17 41 41 THR THR U . n A 1 18 LEU 18 42 42 LEU LEU U . n A 1 19 MET 19 43 43 MET MET U . n A 1 20 MET 20 44 44 MET MET U . n A 1 21 SER 21 45 45 SER SER U . n A 1 22 GLY 22 46 46 GLY GLY U . n A 1 23 ASP 23 47 47 ASP ASP U . n A 1 24 LYS 24 48 48 LYS LYS U . n A 1 25 GLY 25 49 49 GLY GLY U . n A 1 26 ILE 26 50 50 ILE ILE U . n A 1 27 SER 27 51 51 SER SER U . n A 1 28 ALA 28 52 52 ALA ALA U . n A 1 29 PHE 29 53 53 PHE PHE U . n A 1 30 PRO 30 54 54 PRO PRO U . n A 1 31 GLU 31 55 55 GLU GLU U . n A 1 32 SER 32 56 56 SER SER U . n A 1 33 ASP 33 57 57 ASP ASP U . n A 1 34 ASN 34 58 58 ASN ASN U . n A 1 35 LEU 35 59 59 LEU LEU U . n A 1 36 PHE 36 60 60 PHE PHE U . n A 1 37 LYS 37 61 61 LYS LYS U . n A 1 38 TRP 38 62 62 TRP TRP U . n A 1 39 VAL 39 63 63 VAL VAL U . n A 1 40 GLY 40 64 64 GLY GLY U . n A 1 41 THR 41 65 65 THR THR U . n A 1 42 ILE 42 66 66 ILE ILE U . n A 1 43 HIS 43 67 67 HIS HIS U . n A 1 44 GLY 44 68 68 GLY GLY U . n A 1 45 ALA 45 69 69 ALA ALA U . n A 1 46 ALA 46 70 70 ALA ALA U . n A 1 47 GLY 47 71 71 GLY GLY U . n A 1 48 THR 48 72 72 THR THR U . n A 1 49 VAL 49 73 73 VAL VAL U . n A 1 50 TYR 50 74 74 TYR TYR U . n A 1 51 GLU 51 75 75 GLU GLU U . n A 1 52 ASP 52 76 76 ASP ASP U . n A 1 53 LEU 53 77 77 LEU LEU U . n A 1 54 ARG 54 78 78 ARG ARG U . n A 1 55 TYR 55 79 79 TYR TYR U . n A 1 56 LYS 56 80 80 LYS LYS U . n A 1 57 LEU 57 81 81 LEU LEU U . n A 1 58 SER 58 82 82 SER SER U . n A 1 59 LEU 59 83 83 LEU LEU U . n A 1 60 GLU 60 84 84 GLU GLU U . n A 1 61 PHE 61 85 85 PHE PHE U . n A 1 62 PRO 62 86 86 PRO PRO U . n A 1 63 SER 63 87 87 SER SER U . n A 1 64 GLY 64 88 88 GLY GLY U . n A 1 65 TYR 65 89 89 TYR TYR U . n A 1 66 PRO 66 90 90 PRO PRO U . n A 1 67 TYR 67 91 91 TYR TYR U . n A 1 68 ASN 68 92 92 ASN ASN U . n A 1 69 ALA 69 93 93 ALA ALA U . n A 1 70 PRO 70 94 94 PRO PRO U . n A 1 71 THR 71 95 95 THR THR U . n A 1 72 VAL 72 96 96 VAL VAL U . n A 1 73 LYS 73 97 97 LYS LYS U . n A 1 74 PHE 74 98 98 PHE PHE U . n A 1 75 LEU 75 99 99 LEU LEU U . n A 1 76 THR 76 100 100 THR THR U . n A 1 77 PRO 77 101 101 PRO PRO U . n A 1 78 CYS 78 102 102 CYS CYS U . n A 1 79 TYR 79 103 103 TYR TYR U . n A 1 80 HIS 80 104 104 HIS HIS U . n A 1 81 PRO 81 105 105 PRO PRO U . n A 1 82 ASN 82 106 106 ASN ASN U . n A 1 83 VAL 83 107 107 VAL VAL U . n A 1 84 ASP 84 108 108 ASP ASP U . n A 1 85 THR 85 109 109 THR THR U . n A 1 86 GLN 86 110 110 GLN GLN U . n A 1 87 GLY 87 111 111 GLY GLY U . n A 1 88 ASN 88 112 112 ASN ASN U . n A 1 89 ILE 89 113 113 ILE ILE U . n A 1 90 CYS 90 114 114 CYS CYS U . n A 1 91 LEU 91 115 115 LEU LEU U . n A 1 92 ASP 92 116 116 ASP ASP U . n A 1 93 ILE 93 117 117 ILE ILE U . n A 1 94 LEU 94 118 118 LEU LEU U . n A 1 95 LYS 95 119 119 LYS LYS U . n A 1 96 GLU 96 120 120 GLU GLU U . n A 1 97 LYS 97 121 121 LYS LYS U . n A 1 98 TRP 98 122 122 TRP TRP U . n A 1 99 SER 99 123 123 SER SER U . n A 1 100 ALA 100 124 124 ALA ALA U . n A 1 101 LEU 101 125 125 LEU LEU U . n A 1 102 TYR 102 126 126 TYR TYR U . n A 1 103 ASP 103 127 127 ASP ASP U . n A 1 104 VAL 104 128 128 VAL VAL U . n A 1 105 ARG 105 129 129 ARG ARG U . n A 1 106 THR 106 130 130 THR THR U . n A 1 107 ILE 107 131 131 ILE ILE U . n A 1 108 LEU 108 132 132 LEU LEU U . n A 1 109 LEU 109 133 133 LEU LEU U . n A 1 110 SER 110 134 134 SER SER U . n A 1 111 ILE 111 135 135 ILE ILE U . n A 1 112 GLN 112 136 136 GLN GLN U . n A 1 113 SER 113 137 137 SER SER U . n A 1 114 LEU 114 138 138 LEU LEU U . n A 1 115 LEU 115 139 139 LEU LEU U . n A 1 116 GLY 116 140 140 GLY GLY U . n A 1 117 GLU 117 141 141 GLU GLU U . n A 1 118 PRO 118 142 142 PRO PRO U . n A 1 119 ASN 119 143 143 ASN ASN U . n A 1 120 ILE 120 144 144 ILE ILE U . n A 1 121 ASP 121 145 145 ASP ASP U . n A 1 122 SER 122 146 146 SER SER U . n A 1 123 PRO 123 147 147 PRO PRO U . n A 1 124 LEU 124 148 148 LEU LEU U . n A 1 125 ASN 125 149 149 ASN ASN U . n A 1 126 THR 126 150 150 THR THR U . n A 1 127 HIS 127 151 151 HIS HIS U . n A 1 128 ALA 128 152 152 ALA ALA U . n A 1 129 ALA 129 153 153 ALA ALA U . n A 1 130 GLU 130 154 154 GLU GLU U . n A 1 131 LEU 131 155 155 LEU LEU U . n A 1 132 TRP 132 156 156 TRP TRP U . n A 1 133 LYS 133 157 157 LYS LYS U . n A 1 134 ASN 134 158 158 ASN ASN U . n A 1 135 PRO 135 159 159 PRO PRO U . n A 1 136 THR 136 160 160 THR THR U . n A 1 137 ALA 137 161 161 ALA ALA U . n A 1 138 PHE 138 162 162 PHE PHE U . n A 1 139 LYS 139 163 163 LYS LYS U . n A 1 140 LYS 140 164 164 LYS LYS U . n A 1 141 TYR 141 165 165 TYR TYR U . n A 1 142 LEU 142 166 166 LEU LEU U . n A 1 143 GLN 143 167 167 GLN GLN U . n A 1 144 GLU 144 168 168 GLU GLU U . n A 1 145 THR 145 169 169 THR THR U . n A 1 146 TYR 146 170 170 TYR TYR U . n A 1 147 SER 147 171 171 SER SER U . n A 1 148 LYS 148 172 172 LYS LYS U . n A 1 149 GLN 149 173 173 GLN GLN U . n A 1 150 VAL 150 174 ? ? ? U . n A 1 151 THR 151 175 ? ? ? U . n A 1 152 SER 152 176 ? ? ? U . n A 1 153 GLN 153 177 ? ? ? U . n A 1 154 GLU 154 178 ? ? ? U . n A 1 155 PRO 155 179 ? ? ? U . n B 2 1 GLY 1 733 ? ? ? A . n B 2 2 SER 2 734 ? ? ? A . n B 2 3 GLU 3 735 ? ? ? A . n B 2 4 SER 4 736 ? ? ? A . n B 2 5 ASP 5 737 ? ? ? A . n B 2 6 SER 6 738 ? ? ? A . n B 2 7 GLY 7 739 ? ? ? A . n B 2 8 MET 8 740 ? ? ? A . n B 2 9 ALA 9 741 ? ? ? A . n B 2 10 SER 10 742 ? ? ? A . n B 2 11 GLN 11 743 ? ? ? A . n B 2 12 ALA 12 744 ? ? ? A . n B 2 13 ASP 13 745 ? ? ? A . n B 2 14 GLN 14 746 ? ? ? A . n B 2 15 LYS 15 747 747 LYS LYS A . n B 2 16 GLU 16 748 748 GLU GLU A . n B 2 17 GLU 17 749 749 GLU GLU A . n B 2 18 GLU 18 750 750 GLU GLU A . n B 2 19 LEU 19 751 751 LEU LEU A . n B 2 20 LEU 20 752 752 LEU LEU A . n B 2 21 LEU 21 753 753 LEU LEU A . n B 2 22 PHE 22 754 754 PHE PHE A . n B 2 23 TRP 23 755 755 TRP TRP A . n B 2 24 THR 24 756 756 THR THR A . n B 2 25 TYR 25 757 757 TYR TYR A . n B 2 26 ILE 26 758 758 ILE ILE A . n B 2 27 GLN 27 759 759 GLN GLN A . n B 2 28 ALA 28 760 760 ALA ALA A . n B 2 29 MET 29 761 761 MET MET A . n B 2 30 LEU 30 762 762 LEU LEU A . n B 2 31 THR 31 763 763 THR THR A . n B 2 32 ASN 32 764 764 ASN ASN A . n B 2 33 LEU 33 765 765 LEU LEU A . n B 2 34 GLU 34 766 766 GLU GLU A . n B 2 35 SER 35 767 767 SER SER A . n B 2 36 LEU 36 768 768 LEU LEU A . n B 2 37 SER 37 769 769 SER SER A . n B 2 38 LEU 38 770 770 LEU LEU A . n B 2 39 ASP 39 771 771 ASP ASP A . n B 2 40 ARG 40 772 772 ARG ARG A . n B 2 41 ILE 41 773 773 ILE ILE A . n B 2 42 TYR 42 774 774 TYR TYR A . n B 2 43 ASN 43 775 775 ASN ASN A . n B 2 44 MET 44 776 776 MET MET A . n B 2 45 LEU 45 777 777 LEU LEU A . n B 2 46 ARG 46 778 778 ARG ARG A . n B 2 47 MET 47 779 779 MET MET A . n B 2 48 PHE 48 780 780 PHE PHE A . n B 2 49 VAL 49 781 781 VAL VAL A . n B 2 50 VAL 50 782 782 VAL VAL A . n B 2 51 THR 51 783 783 THR THR A . n B 2 52 GLY 52 784 784 GLY GLY A . n B 2 53 PRO 53 785 785 PRO PRO A . n B 2 54 ALA 54 786 786 ALA ALA A . n B 2 55 LEU 55 787 787 LEU LEU A . n B 2 56 ALA 56 788 788 ALA ALA A . n B 2 57 GLU 57 789 789 GLU GLU A . n B 2 58 ILE 58 790 790 ILE ILE A . n B 2 59 ASP 59 791 791 ASP ASP A . n B 2 60 LEU 60 792 792 LEU LEU A . n B 2 61 GLN 61 793 793 GLN GLN A . n B 2 62 GLU 62 794 794 GLU GLU A . n B 2 63 LEU 63 795 795 LEU LEU A . n B 2 64 GLN 64 796 796 GLN GLN A . n B 2 65 GLY 65 797 797 GLY GLY A . n B 2 66 TYR 66 798 798 TYR TYR A . n B 2 67 LEU 67 799 799 LEU LEU A . n B 2 68 GLN 68 800 800 GLN GLN A . n B 2 69 LYS 69 801 801 LYS LYS A . n B 2 70 LYS 70 802 802 LYS LYS A . n B 2 71 VAL 71 803 803 VAL VAL A . n B 2 72 ARG 72 804 804 ARG ARG A . n B 2 73 ASP 73 805 805 ASP ASP A . n B 2 74 GLN 74 806 806 GLN GLN A . n B 2 75 GLN 75 807 807 GLN GLN A . n B 2 76 LEU 76 808 808 LEU LEU A . n B 2 77 VAL 77 809 809 VAL VAL A . n B 2 78 TYR 78 810 810 TYR TYR A . n B 2 79 SER 79 811 811 SER SER A . n B 2 80 ALA 80 812 812 ALA ALA A . n B 2 81 GLY 81 813 813 GLY GLY A . n B 2 82 VAL 82 814 814 VAL VAL A . n B 2 83 TYR 83 815 815 TYR TYR A . n B 2 84 ARG 84 816 816 ARG ARG A . n B 2 85 LEU 85 817 817 LEU LEU A . n B 2 86 PRO 86 818 818 PRO PRO A . n B 2 87 LYS 87 819 ? ? ? A . n B 2 88 ASN 88 820 ? ? ? A . n B 2 89 CYS 89 821 ? ? ? A . n B 2 90 SER 90 822 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 201 16 HOH HOH U . C 3 HOH 2 202 30 HOH HOH U . C 3 HOH 3 203 7 HOH HOH U . C 3 HOH 4 204 35 HOH HOH U . C 3 HOH 5 205 24 HOH HOH U . C 3 HOH 6 206 52 HOH HOH U . C 3 HOH 7 207 17 HOH HOH U . C 3 HOH 8 208 38 HOH HOH U . C 3 HOH 9 209 21 HOH HOH U . C 3 HOH 10 210 8 HOH HOH U . C 3 HOH 11 211 34 HOH HOH U . C 3 HOH 12 212 31 HOH HOH U . C 3 HOH 13 213 70 HOH HOH U . C 3 HOH 14 214 27 HOH HOH U . C 3 HOH 15 215 1 HOH HOH U . C 3 HOH 16 216 41 HOH HOH U . C 3 HOH 17 217 39 HOH HOH U . C 3 HOH 18 218 10 HOH HOH U . C 3 HOH 19 219 28 HOH HOH U . C 3 HOH 20 220 33 HOH HOH U . C 3 HOH 21 221 63 HOH HOH U . C 3 HOH 22 222 6 HOH HOH U . C 3 HOH 23 223 2 HOH HOH U . C 3 HOH 24 224 49 HOH HOH U . C 3 HOH 25 225 4 HOH HOH U . C 3 HOH 26 226 32 HOH HOH U . C 3 HOH 27 227 58 HOH HOH U . C 3 HOH 28 228 57 HOH HOH U . C 3 HOH 29 229 48 HOH HOH U . C 3 HOH 30 230 37 HOH HOH U . C 3 HOH 31 231 14 HOH HOH U . C 3 HOH 32 232 44 HOH HOH U . C 3 HOH 33 233 13 HOH HOH U . C 3 HOH 34 234 46 HOH HOH U . C 3 HOH 35 235 36 HOH HOH U . C 3 HOH 36 236 29 HOH HOH U . C 3 HOH 37 237 64 HOH HOH U . C 3 HOH 38 238 45 HOH HOH U . C 3 HOH 39 239 19 HOH HOH U . C 3 HOH 40 240 59 HOH HOH U . D 3 HOH 1 901 50 HOH HOH A . D 3 HOH 2 902 12 HOH HOH A . D 3 HOH 3 903 56 HOH HOH A . D 3 HOH 4 904 43 HOH HOH A . D 3 HOH 5 905 9 HOH HOH A . D 3 HOH 6 906 11 HOH HOH A . D 3 HOH 7 907 15 HOH HOH A . D 3 HOH 8 908 5 HOH HOH A . D 3 HOH 9 909 55 HOH HOH A . D 3 HOH 10 910 20 HOH HOH A . D 3 HOH 11 911 22 HOH HOH A . D 3 HOH 12 912 18 HOH HOH A . D 3 HOH 13 913 3 HOH HOH A . D 3 HOH 14 914 47 HOH HOH A . D 3 HOH 15 915 40 HOH HOH A . D 3 HOH 16 916 26 HOH HOH A . D 3 HOH 17 917 67 HOH HOH A . D 3 HOH 18 918 23 HOH HOH A . D 3 HOH 19 919 25 HOH HOH A . D 3 HOH 20 920 42 HOH HOH A . D 3 HOH 21 921 53 HOH HOH A . D 3 HOH 22 922 65 HOH HOH A . D 3 HOH 23 923 60 HOH HOH A . D 3 HOH 24 924 54 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1380 ? 1 MORE -14 ? 1 'SSA (A^2)' 10900 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2015-04-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.7.1_743)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OD2 _pdbx_validate_close_contact.auth_asym_id_1 U _pdbx_validate_close_contact.auth_comp_id_1 ASP _pdbx_validate_close_contact.auth_seq_id_1 116 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NZ _pdbx_validate_close_contact.auth_asym_id_2 U _pdbx_validate_close_contact.auth_comp_id_2 LYS _pdbx_validate_close_contact.auth_seq_id_2 121 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.11 # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 NE _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 ARG _pdbx_validate_rmsd_angle.auth_seq_id_1 816 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CZ _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 ARG _pdbx_validate_rmsd_angle.auth_seq_id_2 816 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 NH1 _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 ARG _pdbx_validate_rmsd_angle.auth_seq_id_3 816 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 116.95 _pdbx_validate_rmsd_angle.angle_target_value 120.30 _pdbx_validate_rmsd_angle.angle_deviation -3.35 _pdbx_validate_rmsd_angle.angle_standard_deviation 0.50 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE U 53 ? ? -170.69 141.01 2 1 SER U 56 ? ? 49.18 -130.10 3 1 ASP U 76 ? ? 82.82 -2.48 4 1 LYS U 119 ? ? -124.65 -82.20 5 1 GLU A 766 ? ? 70.96 -39.78 6 1 VAL A 781 ? ? -126.88 -57.65 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 U LYS 48 ? CG ? A LYS 24 CG 2 1 Y 1 U LYS 48 ? CD ? A LYS 24 CD 3 1 Y 1 U LYS 48 ? CE ? A LYS 24 CE 4 1 Y 1 U LYS 48 ? NZ ? A LYS 24 NZ 5 1 Y 1 U ASP 57 ? CG ? A ASP 33 CG 6 1 Y 1 U ASP 57 ? OD1 ? A ASP 33 OD1 7 1 Y 1 U ASP 57 ? OD2 ? A ASP 33 OD2 8 1 Y 1 U LYS 119 ? CG ? A LYS 95 CG 9 1 Y 1 U LYS 119 ? CD ? A LYS 95 CD 10 1 Y 1 U LYS 119 ? CE ? A LYS 95 CE 11 1 Y 1 U LYS 119 ? NZ ? A LYS 95 NZ 12 1 Y 1 U ASP 145 ? CG ? A ASP 121 CG 13 1 Y 1 U ASP 145 ? OD1 ? A ASP 121 OD1 14 1 Y 1 U ASP 145 ? OD2 ? A ASP 121 OD2 15 1 Y 1 U SER 146 ? OG ? A SER 122 OG 16 1 Y 1 U LYS 172 ? CG ? A LYS 148 CG 17 1 Y 1 U LYS 172 ? CD ? A LYS 148 CD 18 1 Y 1 U LYS 172 ? CE ? A LYS 148 CE 19 1 Y 1 U LYS 172 ? NZ ? A LYS 148 NZ 20 1 Y 1 A LYS 747 ? CG ? B LYS 15 CG 21 1 Y 1 A LYS 747 ? CD ? B LYS 15 CD 22 1 Y 1 A LYS 747 ? CE ? B LYS 15 CE 23 1 Y 1 A LYS 747 ? NZ ? B LYS 15 NZ 24 1 Y 1 A GLU 749 ? CG ? B GLU 17 CG 25 1 Y 1 A GLU 749 ? CD ? B GLU 17 CD 26 1 Y 1 A GLU 749 ? OE1 ? B GLU 17 OE1 27 1 Y 1 A GLU 749 ? OE2 ? B GLU 17 OE2 28 1 Y 1 A GLU 750 ? CG ? B GLU 18 CG 29 1 Y 1 A GLU 750 ? CD ? B GLU 18 CD 30 1 Y 1 A GLU 750 ? OE1 ? B GLU 18 OE1 31 1 Y 1 A GLU 750 ? OE2 ? B GLU 18 OE2 32 1 Y 1 A LEU 751 ? CG ? B LEU 19 CG 33 1 Y 1 A LEU 751 ? CD1 ? B LEU 19 CD1 34 1 Y 1 A LEU 751 ? CD2 ? B LEU 19 CD2 35 1 Y 1 A GLU 766 ? CG ? B GLU 34 CG 36 1 Y 1 A GLU 766 ? CD ? B GLU 34 CD 37 1 Y 1 A GLU 766 ? OE1 ? B GLU 34 OE1 38 1 Y 1 A GLU 766 ? OE2 ? B GLU 34 OE2 39 1 Y 1 A GLU 789 ? CG ? B GLU 57 CG 40 1 Y 1 A GLU 789 ? CD ? B GLU 57 CD 41 1 Y 1 A GLU 789 ? OE1 ? B GLU 57 OE1 42 1 Y 1 A GLU 789 ? OE2 ? B GLU 57 OE2 43 1 Y 1 A LYS 801 ? CG ? B LYS 69 CG 44 1 Y 1 A LYS 801 ? CD ? B LYS 69 CD 45 1 Y 1 A LYS 801 ? CE ? B LYS 69 CE 46 1 Y 1 A LYS 801 ? NZ ? B LYS 69 NZ 47 1 Y 1 A ARG 804 ? CG ? B ARG 72 CG 48 1 Y 1 A ARG 804 ? CD ? B ARG 72 CD 49 1 Y 1 A ARG 804 ? NE ? B ARG 72 NE 50 1 Y 1 A ARG 804 ? CZ ? B ARG 72 CZ 51 1 Y 1 A ARG 804 ? NH1 ? B ARG 72 NH1 52 1 Y 1 A ARG 804 ? NH2 ? B ARG 72 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 U GLY 25 ? A GLY 1 2 1 Y 1 U SER 26 ? A SER 2 3 1 Y 1 U ALA 27 ? A ALA 3 4 1 Y 1 U ARG 28 ? A ARG 4 5 1 Y 1 U VAL 174 ? A VAL 150 6 1 Y 1 U THR 175 ? A THR 151 7 1 Y 1 U SER 176 ? A SER 152 8 1 Y 1 U GLN 177 ? A GLN 153 9 1 Y 1 U GLU 178 ? A GLU 154 10 1 Y 1 U PRO 179 ? A PRO 155 11 1 Y 1 A GLY 733 ? B GLY 1 12 1 Y 1 A SER 734 ? B SER 2 13 1 Y 1 A GLU 735 ? B GLU 3 14 1 Y 1 A SER 736 ? B SER 4 15 1 Y 1 A ASP 737 ? B ASP 5 16 1 Y 1 A SER 738 ? B SER 6 17 1 Y 1 A GLY 739 ? B GLY 7 18 1 Y 1 A MET 740 ? B MET 8 19 1 Y 1 A ALA 741 ? B ALA 9 20 1 Y 1 A SER 742 ? B SER 10 21 1 Y 1 A GLN 743 ? B GLN 11 22 1 Y 1 A ALA 744 ? B ALA 12 23 1 Y 1 A ASP 745 ? B ASP 13 24 1 Y 1 A GLN 746 ? B GLN 14 25 1 Y 1 A LYS 819 ? B LYS 87 26 1 Y 1 A ASN 820 ? B ASN 88 27 1 Y 1 A CYS 821 ? B CYS 89 28 1 Y 1 A SER 822 ? B SER 90 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #