data_4YM4 # _entry.id 4YM4 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4YM4 pdb_00004ym4 10.2210/pdb4ym4/pdb WWPDB D_1000207641 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-10-21 2 'Structure model' 1 1 2015-10-28 3 'Structure model' 1 2 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' citation 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_entry_details 6 3 'Structure model' pdbx_modification_feature 7 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4YM4 _pdbx_database_status.recvd_initial_deposition_date 2015-03-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Weng, J.H.' 1 'Wei, T.Y.W.' 2 'Hsieh, Y.C.' 3 'Huang, C.C.F.' 4 'Wu, P.Y.G.' 5 'Chen, E.S.W.' 6 'Huang, K.F.' 7 'Chen, C.J.' 8 'Tsai, M.D.' 9 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 54 _citation.language ? _citation.page_first 6219 _citation.page_last 6229 _citation.title 'Uncovering the Mechanism of Forkhead-Associated Domain-Mediated TIFA Oligomerization That Plays a Central Role in Immune Responses.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.5b00500 _citation.pdbx_database_id_PubMed 26389808 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Weng, J.H.' 1 ? primary 'Hsieh, Y.C.' 2 ? primary 'Huang, C.C.' 3 ? primary 'Wei, T.Y.' 4 ? primary 'Lim, L.H.' 5 ? primary 'Chen, Y.H.' 6 ? primary 'Ho, M.R.' 7 ? primary 'Wang, I.' 8 ? primary 'Huang, K.F.' 9 ? primary 'Chen, C.J.' 10 ? primary 'Tsai, M.D.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TRAF-interacting protein with FHA domain-containing protein A' 16848.533 1 ? ? 'UNP RESIDUES 10-150' ? 2 polymer syn 'TRAF-interacting protein with FHA domain-containing protein A' 1455.349 1 ? ? 'UNP RESIDUES 1-12' ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Putative MAPK-activating protein PM14,Putative NF-kappa-B-activating protein 20,TRAF2-binding protein' 2 'Thr9 phosphorylated N-terminal peptide' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;EETVTCLQ(MSE)TVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSF EIKN(MSE)SKKTNLIVDSRELGYLNK(MSE)DLPYRC(MSE)VRFGEYQFL(MSE)EKEDGESLEFFETQFILSPRSLL Q ; ;EETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKN MSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQFILSPRSLLQ ; A ? 2 'polypeptide(L)' no yes 'MTSFEDAD(TPO)EET' MTSFEDADTEET B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLU n 1 3 THR n 1 4 VAL n 1 5 THR n 1 6 CYS n 1 7 LEU n 1 8 GLN n 1 9 MSE n 1 10 THR n 1 11 VAL n 1 12 TYR n 1 13 HIS n 1 14 PRO n 1 15 GLY n 1 16 GLN n 1 17 LEU n 1 18 GLN n 1 19 CYS n 1 20 GLY n 1 21 ILE n 1 22 PHE n 1 23 GLN n 1 24 SER n 1 25 ILE n 1 26 SER n 1 27 PHE n 1 28 ASN n 1 29 ARG n 1 30 GLU n 1 31 LYS n 1 32 LEU n 1 33 PRO n 1 34 SER n 1 35 SER n 1 36 GLU n 1 37 VAL n 1 38 VAL n 1 39 LYS n 1 40 PHE n 1 41 GLY n 1 42 ARG n 1 43 ASN n 1 44 SER n 1 45 ASN n 1 46 ILE n 1 47 CYS n 1 48 HIS n 1 49 TYR n 1 50 THR n 1 51 PHE n 1 52 GLN n 1 53 ASP n 1 54 LYS n 1 55 GLN n 1 56 VAL n 1 57 SER n 1 58 ARG n 1 59 VAL n 1 60 GLN n 1 61 PHE n 1 62 SER n 1 63 LEU n 1 64 GLN n 1 65 LEU n 1 66 PHE n 1 67 LYS n 1 68 LYS n 1 69 PHE n 1 70 ASN n 1 71 SER n 1 72 SER n 1 73 VAL n 1 74 LEU n 1 75 SER n 1 76 PHE n 1 77 GLU n 1 78 ILE n 1 79 LYS n 1 80 ASN n 1 81 MSE n 1 82 SER n 1 83 LYS n 1 84 LYS n 1 85 THR n 1 86 ASN n 1 87 LEU n 1 88 ILE n 1 89 VAL n 1 90 ASP n 1 91 SER n 1 92 ARG n 1 93 GLU n 1 94 LEU n 1 95 GLY n 1 96 TYR n 1 97 LEU n 1 98 ASN n 1 99 LYS n 1 100 MSE n 1 101 ASP n 1 102 LEU n 1 103 PRO n 1 104 TYR n 1 105 ARG n 1 106 CYS n 1 107 MSE n 1 108 VAL n 1 109 ARG n 1 110 PHE n 1 111 GLY n 1 112 GLU n 1 113 TYR n 1 114 GLN n 1 115 PHE n 1 116 LEU n 1 117 MSE n 1 118 GLU n 1 119 LYS n 1 120 GLU n 1 121 ASP n 1 122 GLY n 1 123 GLU n 1 124 SER n 1 125 LEU n 1 126 GLU n 1 127 PHE n 1 128 PHE n 1 129 GLU n 1 130 THR n 1 131 GLN n 1 132 PHE n 1 133 ILE n 1 134 LEU n 1 135 SER n 1 136 PRO n 1 137 ARG n 1 138 SER n 1 139 LEU n 1 140 LEU n 1 141 GLN n 2 1 MET n 2 2 THR n 2 3 SER n 2 4 PHE n 2 5 GLU n 2 6 ASP n 2 7 ALA n 2 8 ASP n 2 9 TPO n 2 10 GLU n 2 11 GLU n 2 12 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 141 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TIFA, T2BP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET43.1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 12 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 10 10 GLU GLU A . n A 1 2 GLU 2 11 11 GLU GLU A . n A 1 3 THR 3 12 12 THR THR A . n A 1 4 VAL 4 13 13 VAL VAL A . n A 1 5 THR 5 14 14 THR THR A . n A 1 6 CYS 6 15 15 CYS CYS A . n A 1 7 LEU 7 16 16 LEU LEU A . n A 1 8 GLN 8 17 17 GLN GLN A . n A 1 9 MSE 9 18 18 MSE MSE A . n A 1 10 THR 10 19 19 THR THR A . n A 1 11 VAL 11 20 20 VAL VAL A . n A 1 12 TYR 12 21 21 TYR TYR A . n A 1 13 HIS 13 22 22 HIS HIS A . n A 1 14 PRO 14 23 23 PRO PRO A . n A 1 15 GLY 15 24 24 GLY GLY A . n A 1 16 GLN 16 25 25 GLN GLN A . n A 1 17 LEU 17 26 26 LEU LEU A . n A 1 18 GLN 18 27 27 GLN GLN A . n A 1 19 CYS 19 28 28 CYS CYS A . n A 1 20 GLY 20 29 29 GLY GLY A . n A 1 21 ILE 21 30 30 ILE ILE A . n A 1 22 PHE 22 31 31 PHE PHE A . n A 1 23 GLN 23 32 32 GLN GLN A . n A 1 24 SER 24 33 33 SER SER A . n A 1 25 ILE 25 34 34 ILE ILE A . n A 1 26 SER 26 35 35 SER SER A . n A 1 27 PHE 27 36 36 PHE PHE A . n A 1 28 ASN 28 37 37 ASN ASN A . n A 1 29 ARG 29 38 38 ARG ARG A . n A 1 30 GLU 30 39 39 GLU GLU A . n A 1 31 LYS 31 40 40 LYS LYS A . n A 1 32 LEU 32 41 41 LEU LEU A . n A 1 33 PRO 33 42 42 PRO PRO A . n A 1 34 SER 34 43 43 SER SER A . n A 1 35 SER 35 44 44 SER SER A . n A 1 36 GLU 36 45 45 GLU GLU A . n A 1 37 VAL 37 46 46 VAL VAL A . n A 1 38 VAL 38 47 47 VAL VAL A . n A 1 39 LYS 39 48 48 LYS LYS A . n A 1 40 PHE 40 49 49 PHE PHE A . n A 1 41 GLY 41 50 50 GLY GLY A . n A 1 42 ARG 42 51 51 ARG ARG A . n A 1 43 ASN 43 52 52 ASN ASN A . n A 1 44 SER 44 53 53 SER SER A . n A 1 45 ASN 45 54 54 ASN ASN A . n A 1 46 ILE 46 55 55 ILE ILE A . n A 1 47 CYS 47 56 56 CYS CYS A . n A 1 48 HIS 48 57 57 HIS HIS A . n A 1 49 TYR 49 58 58 TYR TYR A . n A 1 50 THR 50 59 59 THR THR A . n A 1 51 PHE 51 60 60 PHE PHE A . n A 1 52 GLN 52 61 61 GLN GLN A . n A 1 53 ASP 53 62 62 ASP ASP A . n A 1 54 LYS 54 63 63 LYS LYS A . n A 1 55 GLN 55 64 64 GLN GLN A . n A 1 56 VAL 56 65 65 VAL VAL A . n A 1 57 SER 57 66 66 SER SER A . n A 1 58 ARG 58 67 67 ARG ARG A . n A 1 59 VAL 59 68 68 VAL VAL A . n A 1 60 GLN 60 69 69 GLN GLN A . n A 1 61 PHE 61 70 70 PHE PHE A . n A 1 62 SER 62 71 71 SER SER A . n A 1 63 LEU 63 72 72 LEU LEU A . n A 1 64 GLN 64 73 73 GLN GLN A . n A 1 65 LEU 65 74 74 LEU LEU A . n A 1 66 PHE 66 75 75 PHE PHE A . n A 1 67 LYS 67 76 76 LYS LYS A . n A 1 68 LYS 68 77 77 LYS LYS A . n A 1 69 PHE 69 78 78 PHE PHE A . n A 1 70 ASN 70 79 79 ASN ASN A . n A 1 71 SER 71 80 80 SER SER A . n A 1 72 SER 72 81 81 SER SER A . n A 1 73 VAL 73 82 82 VAL VAL A . n A 1 74 LEU 74 83 83 LEU LEU A . n A 1 75 SER 75 84 84 SER SER A . n A 1 76 PHE 76 85 85 PHE PHE A . n A 1 77 GLU 77 86 86 GLU GLU A . n A 1 78 ILE 78 87 87 ILE ILE A . n A 1 79 LYS 79 88 88 LYS LYS A . n A 1 80 ASN 80 89 89 ASN ASN A . n A 1 81 MSE 81 90 90 MSE MSE A . n A 1 82 SER 82 91 91 SER SER A . n A 1 83 LYS 83 92 92 LYS LYS A . n A 1 84 LYS 84 93 93 LYS LYS A . n A 1 85 THR 85 94 94 THR THR A . n A 1 86 ASN 86 95 95 ASN ASN A . n A 1 87 LEU 87 96 96 LEU LEU A . n A 1 88 ILE 88 97 97 ILE ILE A . n A 1 89 VAL 89 98 98 VAL VAL A . n A 1 90 ASP 90 99 99 ASP ASP A . n A 1 91 SER 91 100 100 SER SER A . n A 1 92 ARG 92 101 101 ARG ARG A . n A 1 93 GLU 93 102 102 GLU GLU A . n A 1 94 LEU 94 103 103 LEU LEU A . n A 1 95 GLY 95 104 104 GLY GLY A . n A 1 96 TYR 96 105 105 TYR TYR A . n A 1 97 LEU 97 106 106 LEU LEU A . n A 1 98 ASN 98 107 107 ASN ASN A . n A 1 99 LYS 99 108 108 LYS LYS A . n A 1 100 MSE 100 109 109 MSE MSE A . n A 1 101 ASP 101 110 110 ASP ASP A . n A 1 102 LEU 102 111 111 LEU LEU A . n A 1 103 PRO 103 112 112 PRO PRO A . n A 1 104 TYR 104 113 113 TYR TYR A . n A 1 105 ARG 105 114 114 ARG ARG A . n A 1 106 CYS 106 115 115 CYS CYS A . n A 1 107 MSE 107 116 116 MSE MSE A . n A 1 108 VAL 108 117 117 VAL VAL A . n A 1 109 ARG 109 118 118 ARG ARG A . n A 1 110 PHE 110 119 119 PHE PHE A . n A 1 111 GLY 111 120 120 GLY GLY A . n A 1 112 GLU 112 121 121 GLU GLU A . n A 1 113 TYR 113 122 122 TYR TYR A . n A 1 114 GLN 114 123 123 GLN GLN A . n A 1 115 PHE 115 124 124 PHE PHE A . n A 1 116 LEU 116 125 125 LEU LEU A . n A 1 117 MSE 117 126 126 MSE MSE A . n A 1 118 GLU 118 127 127 GLU GLU A . n A 1 119 LYS 119 128 128 LYS LYS A . n A 1 120 GLU 120 129 129 GLU GLU A . n A 1 121 ASP 121 130 130 ASP ASP A . n A 1 122 GLY 122 131 131 GLY GLY A . n A 1 123 GLU 123 132 132 GLU GLU A . n A 1 124 SER 124 133 133 SER SER A . n A 1 125 LEU 125 134 134 LEU LEU A . n A 1 126 GLU 126 135 135 GLU GLU A . n A 1 127 PHE 127 136 136 PHE PHE A . n A 1 128 PHE 128 137 137 PHE PHE A . n A 1 129 GLU 129 138 138 GLU GLU A . n A 1 130 THR 130 139 139 THR THR A . n A 1 131 GLN 131 140 140 GLN GLN A . n A 1 132 PHE 132 141 141 PHE PHE A . n A 1 133 ILE 133 142 142 ILE ILE A . n A 1 134 LEU 134 143 143 LEU LEU A . n A 1 135 SER 135 144 144 SER SER A . n A 1 136 PRO 136 145 145 PRO PRO A . n A 1 137 ARG 137 146 146 ARG ARG A . n A 1 138 SER 138 147 147 SER SER A . n A 1 139 LEU 139 148 148 LEU LEU A . n A 1 140 LEU 140 149 149 LEU LEU A . n A 1 141 GLN 141 150 150 GLN GLN A . n B 2 1 MET 1 1 1 MET MET B . n B 2 2 THR 2 2 2 THR THR B . n B 2 3 SER 3 3 3 SER SER B . n B 2 4 PHE 4 4 4 PHE PHE B . n B 2 5 GLU 5 5 5 GLU GLU B . n B 2 6 ASP 6 6 6 ASP ASP B . n B 2 7 ALA 7 7 7 ALA ALA B . n B 2 8 ASP 8 8 8 ASP ASP B . n B 2 9 TPO 9 9 9 TPO TPO B . n B 2 10 GLU 10 10 10 GLU GLU B . n B 2 11 GLU 11 11 11 GLU GLU B . n B 2 12 THR 12 12 12 THR THR B . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 63 ? CG ? A LYS 54 CG 2 1 Y 1 A LYS 63 ? CD ? A LYS 54 CD 3 1 Y 1 A LYS 63 ? CE ? A LYS 54 CE 4 1 Y 1 A LYS 63 ? NZ ? A LYS 54 NZ 5 1 Y 1 A LYS 93 ? CG ? A LYS 84 CG 6 1 Y 1 A LYS 93 ? CD ? A LYS 84 CD 7 1 Y 1 A LYS 93 ? CE ? A LYS 84 CE 8 1 Y 1 A LYS 93 ? NZ ? A LYS 84 NZ 9 1 Y 1 A GLU 129 ? CG ? A GLU 120 CG 10 1 Y 1 A GLU 129 ? CD ? A GLU 120 CD 11 1 Y 1 A GLU 129 ? OE1 ? A GLU 120 OE1 12 1 Y 1 A GLU 129 ? OE2 ? A GLU 120 OE2 13 1 Y 1 A GLU 132 ? CG ? A GLU 123 CG 14 1 Y 1 A GLU 132 ? CD ? A GLU 123 CD 15 1 Y 1 A GLU 132 ? OE1 ? A GLU 123 OE1 16 1 Y 1 A GLU 132 ? OE2 ? A GLU 123 OE2 17 1 Y 1 A GLN 150 ? CG ? A GLN 141 CG 18 1 Y 1 A GLN 150 ? CD ? A GLN 141 CD 19 1 Y 1 A GLN 150 ? OE1 ? A GLN 141 OE1 20 1 Y 1 A GLN 150 ? NE2 ? A GLN 141 NE2 21 1 Y 1 B THR 12 ? OG1 ? B THR 12 OG1 22 1 Y 1 B THR 12 ? CG2 ? B THR 12 CG2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.7.0032 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 5 # _cell.length_a 113.205 _cell.length_b 113.205 _cell.length_c 113.205 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 4YM4 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'P 42 3 2' _symmetry.entry_id 4YM4 _symmetry.Int_Tables_number 208 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4YM4 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.30 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.76 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '2.1 M DL-malic acid pH7.0' _exptl_crystal_grow.pdbx_pH_range 6.5-7.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-10-26 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSRRC BEAMLINE BL13B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL13B1 _diffrn_source.pdbx_synchrotron_site NSRRC # _reflns.d_resolution_high 3.100 _reflns.d_resolution_low 20.000 _reflns.pdbx_number_measured_all 107113 _reflns.number_obs 4922 _reflns.pdbx_Rmerge_I_obs 0.161 _reflns.pdbx_netI_over_av_sigmaI 23.556 _reflns.pdbx_netI_over_sigmaI 6.300 _reflns.pdbx_chi_squared 0.947 _reflns.pdbx_redundancy 21.800 _reflns.percent_possible_obs 100.000 _reflns.pdbx_Rrim_I_all 0.164 _reflns.pdbx_Rpim_I_all 0.035 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4YM4 _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.number_all ? _reflns.pdbx_Rsym_value ? _reflns.B_iso_Wilson_estimate ? # loop_ _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_ordinal _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.pdbx_rejects _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.meanI_over_sigI_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_CC_half 1 1 3.100 3.210 ? ? ? 0 0.885 ? ? 0.955 19.200 ? ? ? 471 ? ? ? ? 100.000 0.909 0.206 0.904 1 2 3.210 3.340 ? ? ? 0 0.671 ? ? 0.954 22.100 ? ? ? 478 ? ? ? ? 100.000 0.687 0.145 0.939 1 3 3.340 3.490 ? ? ? 0 0.450 ? ? 0.923 23.100 ? ? ? 474 ? ? ? ? 100.000 0.461 0.095 0.995 1 4 3.490 3.670 ? ? ? 0 0.325 ? ? 0.948 23.100 ? ? ? 478 ? ? ? ? 100.000 0.332 0.069 0.984 1 5 3.670 3.900 ? ? ? 0 0.214 ? ? 0.985 23.100 ? ? ? 480 ? ? ? ? 100.000 0.219 0.045 0.994 1 6 3.900 4.200 ? ? ? 0 0.152 ? ? 0.955 22.800 ? ? ? 479 ? ? ? ? 100.000 0.155 0.032 0.995 1 7 4.200 4.620 ? ? ? 0 0.097 ? ? 0.952 22.500 ? ? ? 488 ? ? ? ? 100.000 0.099 0.021 0.997 1 8 4.620 5.270 ? ? ? 0 0.079 ? ? 0.917 22.200 ? ? ? 500 ? ? ? ? 100.000 0.081 0.017 0.998 1 9 5.270 6.610 ? ? ? 0 0.099 ? ? 1.111 21.300 ? ? ? 513 ? ? ? ? 100.000 0.102 0.022 0.998 1 10 6.610 20.000 ? ? ? 0 0.040 ? ? 0.769 18.800 ? ? ? 561 ? ? ? ? 100.000 0.041 0.009 0.999 # _refine.entry_id 4YM4 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 3.1200 _refine.ls_d_res_low 20.0000 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.3700 _refine.ls_number_reflns_obs 4543 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details RANDOM _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2145 _refine.ls_R_factor_R_work 0.2134 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2386 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.7000 _refine.ls_number_reflns_R_free 226 _refine.ls_number_reflns_R_work ? _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 44.6320 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] 0.0000 _refine.aniso_B[2][2] 0.0000 _refine.aniso_B[3][3] 0.0000 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9260 _refine.correlation_coeff_Fo_to_Fc_free 0.8880 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R 0.3540 _refine.pdbx_overall_ESU_R_Free 0.3960 _refine.overall_SU_ML 0.0000 _refine.overall_SU_B 0.0040 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set ? _refine.B_iso_max 186.460 _refine.B_iso_min 16.050 _refine.pdbx_overall_phase_error ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 3.1200 _refine_hist.d_res_low 20.0000 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1240 _refine_hist.pdbx_number_residues_total 153 _refine_hist.pdbx_number_atoms_protein 1240 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # _refine_ls_shell.d_res_high 3.1210 _refine_ls_shell.d_res_low 3.2020 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.number_reflns_R_work 324 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.3160 _refine_ls_shell.R_factor_R_free 0.3210 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 17 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 341 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.R_factor_obs ? # _struct.entry_id 4YM4 _struct.title 'Truncated Human TIFA in complex with its Thr9 phosphorylated N-terminal peptide 1-15' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4YM4 _struct_keywords.text 'Complex, FHA domian, adaptor, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.db_code _struct_ref.db_name _struct_ref.details _struct_ref.entity_id _struct_ref.id _struct_ref.seq_align _struct_ref.seq_dif _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_align_end TIFA_HUMAN UNP ? 1 1 ? ? Q96CG3 ? ;EETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKN MSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQFILSPRSLLQ ; 10 ? TIFA_HUMAN UNP ? 2 2 ? ? Q96CG3 ? MTSFEDADTEET 1 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4YM4 A 1 ? 141 ? Q96CG3 10 ? 150 ? 10 150 2 2 4YM4 B 1 ? 12 ? Q96CG3 1 ? 12 ? 1 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 950 ? 1 MORE -3 ? 1 'SSA (A^2)' 8490 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id GLY _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 20 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id ILE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 25 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id GLY _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 29 _struct_conf.end_auth_comp_id ILE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 34 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLN 8 C ? ? ? 1_555 A MSE 9 N ? ? A GLN 17 A MSE 18 1_555 ? ? ? ? ? ? ? 1.308 ? ? covale2 covale both ? A MSE 9 C ? ? ? 1_555 A THR 10 N ? ? A MSE 18 A THR 19 1_555 ? ? ? ? ? ? ? 1.312 ? ? covale3 covale both ? A ASN 80 C ? ? ? 1_555 A MSE 81 N ? ? A ASN 89 A MSE 90 1_555 ? ? ? ? ? ? ? 1.311 ? ? covale4 covale both ? A MSE 81 C ? ? ? 1_555 A SER 82 N ? ? A MSE 90 A SER 91 1_555 ? ? ? ? ? ? ? 1.310 ? ? covale5 covale both ? A LYS 99 C ? ? ? 1_555 A MSE 100 N ? ? A LYS 108 A MSE 109 1_555 ? ? ? ? ? ? ? 1.323 ? ? covale6 covale both ? A MSE 100 C ? ? ? 1_555 A ASP 101 N ? ? A MSE 109 A ASP 110 1_555 ? ? ? ? ? ? ? 1.315 ? ? covale7 covale both ? A CYS 106 C ? ? ? 1_555 A MSE 107 N ? ? A CYS 115 A MSE 116 1_555 ? ? ? ? ? ? ? 1.322 ? ? covale8 covale both ? A MSE 107 C ? ? ? 1_555 A VAL 108 N ? ? A MSE 116 A VAL 117 1_555 ? ? ? ? ? ? ? 1.311 ? ? covale9 covale both ? A LEU 116 C ? ? ? 1_555 A MSE 117 N ? ? A LEU 125 A MSE 126 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale10 covale both ? A MSE 117 C ? ? ? 1_555 A GLU 118 N ? ? A MSE 126 A GLU 127 1_555 ? ? ? ? ? ? ? 1.311 ? ? covale11 covale both ? B ASP 8 C ? ? ? 1_555 B TPO 9 N ? ? B ASP 8 B TPO 9 1_555 ? ? ? ? ? ? ? 1.318 ? ? covale12 covale both ? B TPO 9 C ? ? ? 1_555 B GLU 10 N ? ? B TPO 9 B GLU 10 1_555 ? ? ? ? ? ? ? 1.310 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 9 ? . . . . MSE A 18 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 81 ? . . . . MSE A 90 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 100 ? . . . . MSE A 109 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 107 ? . . . . MSE A 116 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 117 ? . . . . MSE A 126 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 6 TPO B 9 ? . . . . TPO B 9 ? 1_555 . . . . . . . THR 1 TPO Phosphorylation 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 30 ? PRO A 33 ? GLU A 39 PRO A 42 AA1 2 PHE A 127 ? LEU A 134 ? PHE A 136 LEU A 143 AA1 3 THR A 5 ? TYR A 12 ? THR A 14 TYR A 21 AA1 4 TYR A 113 ? GLU A 120 ? TYR A 122 GLU A 129 AA1 5 ARG A 105 ? PHE A 110 ? ARG A 114 PHE A 119 AA1 6 LEU A 87 ? VAL A 89 ? LEU A 96 VAL A 98 AA1 7 ARG A 92 ? LEU A 94 ? ARG A 101 LEU A 103 AA2 1 TYR A 49 ? THR A 50 ? TYR A 58 THR A 59 AA2 2 VAL A 38 ? GLY A 41 ? VAL A 47 GLY A 50 AA2 3 VAL A 59 ? LYS A 67 ? VAL A 68 LYS A 76 AA2 4 LEU A 74 ? ASN A 80 ? LEU A 83 ASN A 89 AA2 5 LYS A 99 ? ASP A 101 ? LYS A 108 ASP A 110 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 32 ? N LEU A 41 O PHE A 128 ? O PHE A 137 AA1 2 3 O ILE A 133 ? O ILE A 142 N VAL A 11 ? N VAL A 20 AA1 3 4 N THR A 10 ? N THR A 19 O LEU A 116 ? O LEU A 125 AA1 4 5 O PHE A 115 ? O PHE A 124 N VAL A 108 ? N VAL A 117 AA1 5 6 O ARG A 109 ? O ARG A 118 N ILE A 88 ? N ILE A 97 AA1 6 7 N LEU A 87 ? N LEU A 96 O LEU A 94 ? O LEU A 103 AA2 1 2 O TYR A 49 ? O TYR A 58 N GLY A 41 ? N GLY A 50 AA2 2 3 N PHE A 40 ? N PHE A 49 O GLN A 60 ? O GLN A 69 AA2 3 4 N PHE A 66 ? N PHE A 75 O SER A 75 ? O SER A 84 AA2 4 5 N ILE A 78 ? N ILE A 87 O MSE A 100 ? O MSE A 109 # _pdbx_entry_details.entry_id 4YM4 _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 SG A CYS 15 ? ? NH2 A ARG 38 ? ? 1.19 2 1 OG A SER 53 ? ? OE1 B GLU 5 ? ? 1.21 3 1 NH1 A ARG 67 ? ? O1P B TPO 9 ? ? 1.95 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLN A 27 ? ? -95.76 -75.29 2 1 MSE A 90 ? ? -147.82 26.12 3 1 LYS A 93 ? ? -58.66 -72.86 4 1 SER A 100 ? ? 80.78 0.90 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 9 A MSE 18 ? MET 'modified residue' 2 A MSE 81 A MSE 90 ? MET 'modified residue' 3 A MSE 100 A MSE 109 ? MET 'modified residue' 4 A MSE 107 A MSE 116 ? MET 'modified residue' 5 A MSE 117 A MSE 126 ? MET 'modified residue' 6 B TPO 9 B TPO 9 ? THR 'modified residue' # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 MSE N N N N 247 MSE CA C N S 248 MSE C C N N 249 MSE O O N N 250 MSE OXT O N N 251 MSE CB C N N 252 MSE CG C N N 253 MSE SE SE N N 254 MSE CE C N N 255 MSE H H N N 256 MSE H2 H N N 257 MSE HA H N N 258 MSE HXT H N N 259 MSE HB2 H N N 260 MSE HB3 H N N 261 MSE HG2 H N N 262 MSE HG3 H N N 263 MSE HE1 H N N 264 MSE HE2 H N N 265 MSE HE3 H N N 266 PHE N N N N 267 PHE CA C N S 268 PHE C C N N 269 PHE O O N N 270 PHE CB C N N 271 PHE CG C Y N 272 PHE CD1 C Y N 273 PHE CD2 C Y N 274 PHE CE1 C Y N 275 PHE CE2 C Y N 276 PHE CZ C Y N 277 PHE OXT O N N 278 PHE H H N N 279 PHE H2 H N N 280 PHE HA H N N 281 PHE HB2 H N N 282 PHE HB3 H N N 283 PHE HD1 H N N 284 PHE HD2 H N N 285 PHE HE1 H N N 286 PHE HE2 H N N 287 PHE HZ H N N 288 PHE HXT H N N 289 PRO N N N N 290 PRO CA C N S 291 PRO C C N N 292 PRO O O N N 293 PRO CB C N N 294 PRO CG C N N 295 PRO CD C N N 296 PRO OXT O N N 297 PRO H H N N 298 PRO HA H N N 299 PRO HB2 H N N 300 PRO HB3 H N N 301 PRO HG2 H N N 302 PRO HG3 H N N 303 PRO HD2 H N N 304 PRO HD3 H N N 305 PRO HXT H N N 306 SER N N N N 307 SER CA C N S 308 SER C C N N 309 SER O O N N 310 SER CB C N N 311 SER OG O N N 312 SER OXT O N N 313 SER H H N N 314 SER H2 H N N 315 SER HA H N N 316 SER HB2 H N N 317 SER HB3 H N N 318 SER HG H N N 319 SER HXT H N N 320 THR N N N N 321 THR CA C N S 322 THR C C N N 323 THR O O N N 324 THR CB C N R 325 THR OG1 O N N 326 THR CG2 C N N 327 THR OXT O N N 328 THR H H N N 329 THR H2 H N N 330 THR HA H N N 331 THR HB H N N 332 THR HG1 H N N 333 THR HG21 H N N 334 THR HG22 H N N 335 THR HG23 H N N 336 THR HXT H N N 337 TPO N N N N 338 TPO CA C N S 339 TPO CB C N R 340 TPO CG2 C N N 341 TPO OG1 O N N 342 TPO P P N N 343 TPO O1P O N N 344 TPO O2P O N N 345 TPO O3P O N N 346 TPO C C N N 347 TPO O O N N 348 TPO OXT O N N 349 TPO H H N N 350 TPO H2 H N N 351 TPO HA H N N 352 TPO HB H N N 353 TPO HG21 H N N 354 TPO HG22 H N N 355 TPO HG23 H N N 356 TPO HOP2 H N N 357 TPO HOP3 H N N 358 TPO HXT H N N 359 TYR N N N N 360 TYR CA C N S 361 TYR C C N N 362 TYR O O N N 363 TYR CB C N N 364 TYR CG C Y N 365 TYR CD1 C Y N 366 TYR CD2 C Y N 367 TYR CE1 C Y N 368 TYR CE2 C Y N 369 TYR CZ C Y N 370 TYR OH O N N 371 TYR OXT O N N 372 TYR H H N N 373 TYR H2 H N N 374 TYR HA H N N 375 TYR HB2 H N N 376 TYR HB3 H N N 377 TYR HD1 H N N 378 TYR HD2 H N N 379 TYR HE1 H N N 380 TYR HE2 H N N 381 TYR HH H N N 382 TYR HXT H N N 383 VAL N N N N 384 VAL CA C N S 385 VAL C C N N 386 VAL O O N N 387 VAL CB C N N 388 VAL CG1 C N N 389 VAL CG2 C N N 390 VAL OXT O N N 391 VAL H H N N 392 VAL H2 H N N 393 VAL HA H N N 394 VAL HB H N N 395 VAL HG11 H N N 396 VAL HG12 H N N 397 VAL HG13 H N N 398 VAL HG21 H N N 399 VAL HG22 H N N 400 VAL HG23 H N N 401 VAL HXT H N N 402 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 MSE N CA sing N N 235 MSE N H sing N N 236 MSE N H2 sing N N 237 MSE CA C sing N N 238 MSE CA CB sing N N 239 MSE CA HA sing N N 240 MSE C O doub N N 241 MSE C OXT sing N N 242 MSE OXT HXT sing N N 243 MSE CB CG sing N N 244 MSE CB HB2 sing N N 245 MSE CB HB3 sing N N 246 MSE CG SE sing N N 247 MSE CG HG2 sing N N 248 MSE CG HG3 sing N N 249 MSE SE CE sing N N 250 MSE CE HE1 sing N N 251 MSE CE HE2 sing N N 252 MSE CE HE3 sing N N 253 PHE N CA sing N N 254 PHE N H sing N N 255 PHE N H2 sing N N 256 PHE CA C sing N N 257 PHE CA CB sing N N 258 PHE CA HA sing N N 259 PHE C O doub N N 260 PHE C OXT sing N N 261 PHE CB CG sing N N 262 PHE CB HB2 sing N N 263 PHE CB HB3 sing N N 264 PHE CG CD1 doub Y N 265 PHE CG CD2 sing Y N 266 PHE CD1 CE1 sing Y N 267 PHE CD1 HD1 sing N N 268 PHE CD2 CE2 doub Y N 269 PHE CD2 HD2 sing N N 270 PHE CE1 CZ doub Y N 271 PHE CE1 HE1 sing N N 272 PHE CE2 CZ sing Y N 273 PHE CE2 HE2 sing N N 274 PHE CZ HZ sing N N 275 PHE OXT HXT sing N N 276 PRO N CA sing N N 277 PRO N CD sing N N 278 PRO N H sing N N 279 PRO CA C sing N N 280 PRO CA CB sing N N 281 PRO CA HA sing N N 282 PRO C O doub N N 283 PRO C OXT sing N N 284 PRO CB CG sing N N 285 PRO CB HB2 sing N N 286 PRO CB HB3 sing N N 287 PRO CG CD sing N N 288 PRO CG HG2 sing N N 289 PRO CG HG3 sing N N 290 PRO CD HD2 sing N N 291 PRO CD HD3 sing N N 292 PRO OXT HXT sing N N 293 SER N CA sing N N 294 SER N H sing N N 295 SER N H2 sing N N 296 SER CA C sing N N 297 SER CA CB sing N N 298 SER CA HA sing N N 299 SER C O doub N N 300 SER C OXT sing N N 301 SER CB OG sing N N 302 SER CB HB2 sing N N 303 SER CB HB3 sing N N 304 SER OG HG sing N N 305 SER OXT HXT sing N N 306 THR N CA sing N N 307 THR N H sing N N 308 THR N H2 sing N N 309 THR CA C sing N N 310 THR CA CB sing N N 311 THR CA HA sing N N 312 THR C O doub N N 313 THR C OXT sing N N 314 THR CB OG1 sing N N 315 THR CB CG2 sing N N 316 THR CB HB sing N N 317 THR OG1 HG1 sing N N 318 THR CG2 HG21 sing N N 319 THR CG2 HG22 sing N N 320 THR CG2 HG23 sing N N 321 THR OXT HXT sing N N 322 TPO N CA sing N N 323 TPO N H sing N N 324 TPO N H2 sing N N 325 TPO CA CB sing N N 326 TPO CA C sing N N 327 TPO CA HA sing N N 328 TPO CB CG2 sing N N 329 TPO CB OG1 sing N N 330 TPO CB HB sing N N 331 TPO CG2 HG21 sing N N 332 TPO CG2 HG22 sing N N 333 TPO CG2 HG23 sing N N 334 TPO OG1 P sing N N 335 TPO P O1P doub N N 336 TPO P O2P sing N N 337 TPO P O3P sing N N 338 TPO O2P HOP2 sing N N 339 TPO O3P HOP3 sing N N 340 TPO C O doub N N 341 TPO C OXT sing N N 342 TPO OXT HXT sing N N 343 TYR N CA sing N N 344 TYR N H sing N N 345 TYR N H2 sing N N 346 TYR CA C sing N N 347 TYR CA CB sing N N 348 TYR CA HA sing N N 349 TYR C O doub N N 350 TYR C OXT sing N N 351 TYR CB CG sing N N 352 TYR CB HB2 sing N N 353 TYR CB HB3 sing N N 354 TYR CG CD1 doub Y N 355 TYR CG CD2 sing Y N 356 TYR CD1 CE1 sing Y N 357 TYR CD1 HD1 sing N N 358 TYR CD2 CE2 doub Y N 359 TYR CD2 HD2 sing N N 360 TYR CE1 CZ doub Y N 361 TYR CE1 HE1 sing N N 362 TYR CE2 CZ sing Y N 363 TYR CE2 HE2 sing N N 364 TYR CZ OH sing N N 365 TYR OH HH sing N N 366 TYR OXT HXT sing N N 367 VAL N CA sing N N 368 VAL N H sing N N 369 VAL N H2 sing N N 370 VAL CA C sing N N 371 VAL CA CB sing N N 372 VAL CA HA sing N N 373 VAL C O doub N N 374 VAL C OXT sing N N 375 VAL CB CG1 sing N N 376 VAL CB CG2 sing N N 377 VAL CB HB sing N N 378 VAL CG1 HG11 sing N N 379 VAL CG1 HG12 sing N N 380 VAL CG1 HG13 sing N N 381 VAL CG2 HG21 sing N N 382 VAL CG2 HG22 sing N N 383 VAL CG2 HG23 sing N N 384 VAL OXT HXT sing N N 385 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Academia Sinica' Taiwan ? 1 'National Health Research Institutes' Taiwan ? 2 # _atom_sites.entry_id 4YM4 _atom_sites.fract_transf_matrix[1][1] 0.008834 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008834 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008834 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O P S SE # loop_