data_4YMY # _entry.id 4YMY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4YMY pdb_00004ymy 10.2210/pdb4ymy/pdb WWPDB D_1000207727 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4YMY _pdbx_database_status.recvd_initial_deposition_date 2015-03-08 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Mizohata, E.' 1 'Himiyama, T.' 2 'Tachikawa, K.' 3 'Oohora, K.' 4 'Onoda, A.' 5 'Hayashi, T.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acs Catalysis' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2155-5435 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 5 _citation.language ? _citation.page_first 7519 _citation.page_last 7522 _citation.title 'A Highly Active Biohybrid Catalyst for Olefin Metathesis in Water: Impact of a Hydrophobic Cavity in a beta-Barrel Protein' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acscatal.5b01792 _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sauer, D.F.' 1 ? primary 'Himiyama, T.' 2 ? primary 'Tachikawa, K.' 3 ? primary 'Fukumoto, K.' 4 ? primary 'Onoda, A.' 5 ? primary 'Mizohata, E.' 6 ? primary 'Inoue, T.' 7 ? primary 'Bocola, M.' 8 ? primary 'Schwaneberg, U.' 9 ? primary 'Hayashi, T.' 10 ? primary 'Okuda, J.' 11 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4YMY _cell.details ? _cell.formula_units_Z ? _cell.length_a 59.654 _cell.length_a_esd ? _cell.length_b 79.285 _cell.length_b_esd ? _cell.length_c 36.409 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4YMY _symmetry.cell_setting ? _symmetry.Int_Tables_number 18 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'UPF0678 fatty acid-binding protein-like protein At1g79260' 19354.908 1 ? M75A/H76L/Q96C/M148L/H158A 'UNP residues 2-166' ? 2 non-polymer syn GLYCEROL 92.094 4 ? ? ? ? 3 water nat water 18.015 195 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MWSHPQFEKNQLQQLQNPGESPPVHPFVAPLSYLLGTWRGQGEGEYPTIPSFRYGEEIRFSHSGKPVIAYTQKTWKLESG APALAESGYFRPRPDGSIEVVIACSTGLVEVQKGTYNVDEQSIKLKSDLVGNASKVKEISREFELVDGKLSYVVRLSTTT NPLQPALKAILDKL ; _entity_poly.pdbx_seq_one_letter_code_can ;MWSHPQFEKNQLQQLQNPGESPPVHPFVAPLSYLLGTWRGQGEGEYPTIPSFRYGEEIRFSHSGKPVIAYTQKTWKLESG APALAESGYFRPRPDGSIEVVIACSTGLVEVQKGTYNVDEQSIKLKSDLVGNASKVKEISREFELVDGKLSYVVRLSTTT NPLQPALKAILDKL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 TRP n 1 3 SER n 1 4 HIS n 1 5 PRO n 1 6 GLN n 1 7 PHE n 1 8 GLU n 1 9 LYS n 1 10 ASN n 1 11 GLN n 1 12 LEU n 1 13 GLN n 1 14 GLN n 1 15 LEU n 1 16 GLN n 1 17 ASN n 1 18 PRO n 1 19 GLY n 1 20 GLU n 1 21 SER n 1 22 PRO n 1 23 PRO n 1 24 VAL n 1 25 HIS n 1 26 PRO n 1 27 PHE n 1 28 VAL n 1 29 ALA n 1 30 PRO n 1 31 LEU n 1 32 SER n 1 33 TYR n 1 34 LEU n 1 35 LEU n 1 36 GLY n 1 37 THR n 1 38 TRP n 1 39 ARG n 1 40 GLY n 1 41 GLN n 1 42 GLY n 1 43 GLU n 1 44 GLY n 1 45 GLU n 1 46 TYR n 1 47 PRO n 1 48 THR n 1 49 ILE n 1 50 PRO n 1 51 SER n 1 52 PHE n 1 53 ARG n 1 54 TYR n 1 55 GLY n 1 56 GLU n 1 57 GLU n 1 58 ILE n 1 59 ARG n 1 60 PHE n 1 61 SER n 1 62 HIS n 1 63 SER n 1 64 GLY n 1 65 LYS n 1 66 PRO n 1 67 VAL n 1 68 ILE n 1 69 ALA n 1 70 TYR n 1 71 THR n 1 72 GLN n 1 73 LYS n 1 74 THR n 1 75 TRP n 1 76 LYS n 1 77 LEU n 1 78 GLU n 1 79 SER n 1 80 GLY n 1 81 ALA n 1 82 PRO n 1 83 ALA n 1 84 LEU n 1 85 ALA n 1 86 GLU n 1 87 SER n 1 88 GLY n 1 89 TYR n 1 90 PHE n 1 91 ARG n 1 92 PRO n 1 93 ARG n 1 94 PRO n 1 95 ASP n 1 96 GLY n 1 97 SER n 1 98 ILE n 1 99 GLU n 1 100 VAL n 1 101 VAL n 1 102 ILE n 1 103 ALA n 1 104 CYS n 1 105 SER n 1 106 THR n 1 107 GLY n 1 108 LEU n 1 109 VAL n 1 110 GLU n 1 111 VAL n 1 112 GLN n 1 113 LYS n 1 114 GLY n 1 115 THR n 1 116 TYR n 1 117 ASN n 1 118 VAL n 1 119 ASP n 1 120 GLU n 1 121 GLN n 1 122 SER n 1 123 ILE n 1 124 LYS n 1 125 LEU n 1 126 LYS n 1 127 SER n 1 128 ASP n 1 129 LEU n 1 130 VAL n 1 131 GLY n 1 132 ASN n 1 133 ALA n 1 134 SER n 1 135 LYS n 1 136 VAL n 1 137 LYS n 1 138 GLU n 1 139 ILE n 1 140 SER n 1 141 ARG n 1 142 GLU n 1 143 PHE n 1 144 GLU n 1 145 LEU n 1 146 VAL n 1 147 ASP n 1 148 GLY n 1 149 LYS n 1 150 LEU n 1 151 SER n 1 152 TYR n 1 153 VAL n 1 154 VAL n 1 155 ARG n 1 156 LEU n 1 157 SER n 1 158 THR n 1 159 THR n 1 160 THR n 1 161 ASN n 1 162 PRO n 1 163 LEU n 1 164 GLN n 1 165 PRO n 1 166 ALA n 1 167 LEU n 1 168 LYS n 1 169 ALA n 1 170 ILE n 1 171 LEU n 1 172 ASP n 1 173 LYS n 1 174 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 174 _entity_src_gen.gene_src_common_name 'Mouse-ear cress' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'At1g79260, YUP8H12R.14' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Arabidopsis thaliana' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3702 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21Start(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'pET42b(+)' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Y1926_ARATH _struct_ref.pdbx_db_accession O64527 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NQLQQLQNPGESPPVHPFVAPLSYLLGTWRGQGEGEYPTIPSFRYGEEIRFSHSGKPVIAYTQKTWKLESGAPMHAESGY FRPRPDGSIEVVIAQSTGLVEVQKGTYNVDEQSIKLKSDLVGNASKVKEISREFELVDGKLSYVVRMSTTTNPLQPHLKA ILDKL ; _struct_ref.pdbx_align_begin 2 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4YMY _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 10 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 174 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O64527 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 166 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 166 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4YMY MET A 1 ? UNP O64527 ? ? 'initiating methionine' -7 1 1 4YMY TRP A 2 ? UNP O64527 ? ? 'expression tag' -6 2 1 4YMY SER A 3 ? UNP O64527 ? ? 'expression tag' -5 3 1 4YMY HIS A 4 ? UNP O64527 ? ? 'expression tag' -4 4 1 4YMY PRO A 5 ? UNP O64527 ? ? 'expression tag' -3 5 1 4YMY GLN A 6 ? UNP O64527 ? ? 'expression tag' -2 6 1 4YMY PHE A 7 ? UNP O64527 ? ? 'expression tag' -1 7 1 4YMY GLU A 8 ? UNP O64527 ? ? 'expression tag' 0 8 1 4YMY LYS A 9 ? UNP O64527 ? ? 'expression tag' 1 9 1 4YMY ALA A 83 ? UNP O64527 MET 75 'engineered mutation' 75 10 1 4YMY LEU A 84 ? UNP O64527 HIS 76 'engineered mutation' 76 11 1 4YMY CYS A 104 ? UNP O64527 GLN 96 'engineered mutation' 96 12 1 4YMY LEU A 156 ? UNP O64527 MET 148 'engineered mutation' 148 13 1 4YMY ALA A 166 ? UNP O64527 HIS 158 'engineered mutation' 158 14 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4YMY _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.22 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.70 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.3 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'Tris-HCl buffer, polyethylene glycol 2000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-05-18 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.90000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL44XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.90000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL44XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4YMY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.00 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 92122 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.051 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 42.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.00 _reflns_shell.d_res_low 1.04 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 95.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -0.15 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] 0.09 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 0.05 _refine.B_iso_max ? _refine.B_iso_mean 18.747 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.982 _refine.correlation_coeff_Fo_to_Fc_free 0.978 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4YMY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.00 _refine.ls_d_res_low 47.67 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 87472 _refine.ls_number_reflns_R_free 4620 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.17 _refine.ls_percent_reflns_R_free 5.0 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.12375 _refine.ls_R_factor_R_free 0.13593 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.12312 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'BABINET MODEL WITH MASK' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 2A13 _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.018 _refine.pdbx_overall_ESU_R_Free 0.018 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 0.458 _refine.overall_SU_ML 0.011 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1190 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 24 _refine_hist.number_atoms_solvent 195 _refine_hist.number_atoms_total 1409 _refine_hist.d_res_high 1.00 _refine_hist.d_res_low 47.67 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.023 0.020 1321 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 1292 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.020 2.001 1803 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.773 3.000 3017 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.884 5.000 176 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 33.096 23.585 53 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 10.747 15.000 236 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.272 15.000 9 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.139 0.200 205 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.012 0.021 1459 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.012 0.020 278 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.313 1.391 635 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.314 1.391 634 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 1.701 2.102 798 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 1.700 2.102 799 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.280 1.898 686 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.276 1.898 686 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.121 2.658 994 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 4.762 13.462 1496 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 4.206 12.517 1418 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? 5.833 3.000 2613 ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? 35.242 5.000 77 ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? 11.124 5.000 2694 ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.001 _refine_ls_shell.d_res_low 1.027 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 333 _refine_ls_shell.number_reflns_R_work 6099 _refine_ls_shell.percent_reflns_obs 93.53 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.246 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.222 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 4YMY _struct.title 'Crystal structure of mutant nitrobindin M75A/H76L/Q96C/M148L/H158A (NB11) from Arabidopsis thaliana' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4YMY _struct_keywords.text 'beta-barrel, intracellular transport, hydrophobic ligand, Cytoplasm, TRANSPORT PROTEIN' _struct_keywords.pdbx_keywords 'TRANSPORT PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? E N N 2 ? F N N 3 ? # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id VAL _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 28 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id LEU _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 35 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id VAL _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 20 _struct_conf.end_auth_comp_id LEU _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 27 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 11 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA1 7 8 ? anti-parallel AA1 8 9 ? anti-parallel AA1 9 10 ? anti-parallel AA1 10 11 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLY A 36 ? TYR A 46 ? GLY A 28 TYR A 38 AA1 2 ILE A 49 ? SER A 61 ? ILE A 41 SER A 53 AA1 3 ILE A 68 ? TRP A 75 ? ILE A 60 TRP A 67 AA1 4 PRO A 82 ? PRO A 92 ? PRO A 74 PRO A 84 AA1 5 SER A 97 ? CYS A 104 ? SER A 89 CYS A 96 AA1 6 VAL A 109 ? ASN A 117 ? VAL A 101 ASN A 109 AA1 7 SER A 122 ? GLY A 131 ? SER A 114 GLY A 123 AA1 8 VAL A 136 ? VAL A 146 ? VAL A 128 VAL A 138 AA1 9 LYS A 149 ? THR A 158 ? LYS A 141 THR A 150 AA1 10 GLN A 164 ? LYS A 173 ? GLN A 156 LYS A 165 AA1 11 GLY A 36 ? TYR A 46 ? GLY A 28 TYR A 38 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N TYR A 46 ? N TYR A 38 O ILE A 49 ? O ILE A 41 AA1 2 3 N ARG A 59 ? N ARG A 51 O THR A 71 ? O THR A 63 AA1 3 4 N ILE A 68 ? N ILE A 60 O PHE A 90 ? O PHE A 82 AA1 4 5 N ARG A 91 ? N ARG A 83 O GLU A 99 ? O GLU A 91 AA1 5 6 N VAL A 100 ? N VAL A 92 O GLN A 112 ? O GLN A 104 AA1 6 7 N VAL A 111 ? N VAL A 103 O ASP A 128 ? O ASP A 120 AA1 7 8 N ILE A 123 ? N ILE A 115 O PHE A 143 ? O PHE A 135 AA1 8 9 N VAL A 146 ? N VAL A 138 O LYS A 149 ? O LYS A 141 AA1 9 10 N VAL A 154 ? N VAL A 146 O ALA A 166 ? O ALA A 158 AA1 10 11 O ASP A 172 ? O ASP A 164 N ARG A 39 ? N ARG A 31 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A GOL 201 ? 10 'binding site for residue GOL A 201' AC2 Software A GOL 202 ? 10 'binding site for residue GOL A 202' AC3 Software A GOL 203 ? 6 'binding site for residue GOL A 203' AC4 Software A GOL 204 ? 5 'binding site for residue GOL A 204' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 ARG A 39 ? ARG A 31 . ? 1_555 ? 2 AC1 10 GLY A 40 ? GLY A 32 . ? 1_555 ? 3 AC1 10 GLN A 41 ? GLN A 33 . ? 1_555 ? 4 AC1 10 TRP A 75 ? TRP A 67 . ? 1_555 ? 5 AC1 10 LEU A 77 ? LEU A 69 . ? 1_555 ? 6 AC1 10 THR A 159 ? THR A 151 . ? 1_556 ? 7 AC1 10 THR A 160 ? THR A 152 . ? 1_556 ? 8 AC1 10 HOH F . ? HOH A 305 . ? 1_555 ? 9 AC1 10 HOH F . ? HOH A 308 . ? 1_555 ? 10 AC1 10 HOH F . ? HOH A 334 . ? 1_556 ? 11 AC2 10 HIS A 62 ? HIS A 54 . ? 1_555 ? 12 AC2 10 SER A 63 ? SER A 55 . ? 1_555 ? 13 AC2 10 ALA A 69 ? ALA A 61 . ? 1_555 ? 14 AC2 10 ALA A 85 ? ALA A 77 . ? 2_575 ? 15 AC2 10 HOH F . ? HOH A 311 . ? 1_555 ? 16 AC2 10 HOH F . ? HOH A 333 . ? 2_575 ? 17 AC2 10 HOH F . ? HOH A 336 . ? 1_555 ? 18 AC2 10 HOH F . ? HOH A 371 . ? 2_575 ? 19 AC2 10 HOH F . ? HOH A 382 . ? 1_555 ? 20 AC2 10 HOH F . ? HOH A 425 . ? 1_555 ? 21 AC3 6 GLU A 57 ? GLU A 49 . ? 1_555 ? 22 AC3 6 THR A 71 ? THR A 63 . ? 1_555 ? 23 AC3 6 GLN A 72 ? GLN A 64 . ? 1_555 ? 24 AC3 6 LYS A 73 ? LYS A 65 . ? 1_555 ? 25 AC3 6 HOH F . ? HOH A 322 . ? 1_555 ? 26 AC3 6 HOH F . ? HOH A 422 . ? 1_555 ? 27 AC4 5 ARG A 93 ? ARG A 85 . ? 4_566 ? 28 AC4 5 ASP A 147 ? ASP A 139 . ? 1_555 ? 29 AC4 5 LYS A 149 ? LYS A 141 . ? 1_555 ? 30 AC4 5 HOH F . ? HOH A 392 . ? 1_555 ? 31 AC4 5 HOH F . ? HOH A 446 . ? 1_555 ? # _atom_sites.entry_id 4YMY _atom_sites.fract_transf_matrix[1][1] 0.016763 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012613 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.027466 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -7 ? ? ? A . n A 1 2 TRP 2 -6 ? ? ? A . n A 1 3 SER 3 -5 ? ? ? A . n A 1 4 HIS 4 -4 ? ? ? A . n A 1 5 PRO 5 -3 ? ? ? A . n A 1 6 GLN 6 -2 ? ? ? A . n A 1 7 PHE 7 -1 ? ? ? A . n A 1 8 GLU 8 0 ? ? ? A . n A 1 9 LYS 9 1 ? ? ? A . n A 1 10 ASN 10 2 ? ? ? A . n A 1 11 GLN 11 3 ? ? ? A . n A 1 12 LEU 12 4 ? ? ? A . n A 1 13 GLN 13 5 ? ? ? A . n A 1 14 GLN 14 6 ? ? ? A . n A 1 15 LEU 15 7 ? ? ? A . n A 1 16 GLN 16 8 ? ? ? A . n A 1 17 ASN 17 9 ? ? ? A . n A 1 18 PRO 18 10 ? ? ? A . n A 1 19 GLY 19 11 ? ? ? A . n A 1 20 GLU 20 12 ? ? ? A . n A 1 21 SER 21 13 ? ? ? A . n A 1 22 PRO 22 14 14 PRO PRO A . n A 1 23 PRO 23 15 15 PRO PRO A . n A 1 24 VAL 24 16 16 VAL VAL A . n A 1 25 HIS 25 17 17 HIS HIS A . n A 1 26 PRO 26 18 18 PRO PRO A . n A 1 27 PHE 27 19 19 PHE PHE A . n A 1 28 VAL 28 20 20 VAL VAL A . n A 1 29 ALA 29 21 21 ALA ALA A . n A 1 30 PRO 30 22 22 PRO PRO A . n A 1 31 LEU 31 23 23 LEU LEU A . n A 1 32 SER 32 24 24 SER SER A . n A 1 33 TYR 33 25 25 TYR TYR A . n A 1 34 LEU 34 26 26 LEU LEU A . n A 1 35 LEU 35 27 27 LEU LEU A . n A 1 36 GLY 36 28 28 GLY GLY A . n A 1 37 THR 37 29 29 THR THR A . n A 1 38 TRP 38 30 30 TRP TRP A . n A 1 39 ARG 39 31 31 ARG ARG A . n A 1 40 GLY 40 32 32 GLY GLY A . n A 1 41 GLN 41 33 33 GLN GLN A . n A 1 42 GLY 42 34 34 GLY GLY A . n A 1 43 GLU 43 35 35 GLU GLU A . n A 1 44 GLY 44 36 36 GLY GLY A . n A 1 45 GLU 45 37 37 GLU GLU A . n A 1 46 TYR 46 38 38 TYR TYR A . n A 1 47 PRO 47 39 39 PRO PRO A . n A 1 48 THR 48 40 40 THR THR A . n A 1 49 ILE 49 41 41 ILE ILE A . n A 1 50 PRO 50 42 42 PRO PRO A . n A 1 51 SER 51 43 43 SER SER A . n A 1 52 PHE 52 44 44 PHE PHE A . n A 1 53 ARG 53 45 45 ARG ARG A . n A 1 54 TYR 54 46 46 TYR TYR A . n A 1 55 GLY 55 47 47 GLY GLY A . n A 1 56 GLU 56 48 48 GLU GLU A . n A 1 57 GLU 57 49 49 GLU GLU A . n A 1 58 ILE 58 50 50 ILE ILE A . n A 1 59 ARG 59 51 51 ARG ARG A . n A 1 60 PHE 60 52 52 PHE PHE A . n A 1 61 SER 61 53 53 SER SER A . n A 1 62 HIS 62 54 54 HIS HIS A . n A 1 63 SER 63 55 55 SER SER A . n A 1 64 GLY 64 56 56 GLY GLY A . n A 1 65 LYS 65 57 57 LYS LYS A . n A 1 66 PRO 66 58 58 PRO PRO A . n A 1 67 VAL 67 59 59 VAL VAL A . n A 1 68 ILE 68 60 60 ILE ILE A . n A 1 69 ALA 69 61 61 ALA ALA A . n A 1 70 TYR 70 62 62 TYR TYR A . n A 1 71 THR 71 63 63 THR THR A . n A 1 72 GLN 72 64 64 GLN GLN A . n A 1 73 LYS 73 65 65 LYS LYS A . n A 1 74 THR 74 66 66 THR THR A . n A 1 75 TRP 75 67 67 TRP TRP A . n A 1 76 LYS 76 68 68 LYS LYS A . n A 1 77 LEU 77 69 69 LEU LEU A . n A 1 78 GLU 78 70 70 GLU GLU A . n A 1 79 SER 79 71 71 SER SER A . n A 1 80 GLY 80 72 72 GLY GLY A . n A 1 81 ALA 81 73 73 ALA ALA A . n A 1 82 PRO 82 74 74 PRO PRO A . n A 1 83 ALA 83 75 75 ALA ALA A . n A 1 84 LEU 84 76 76 LEU LEU A . n A 1 85 ALA 85 77 77 ALA ALA A . n A 1 86 GLU 86 78 78 GLU GLU A . n A 1 87 SER 87 79 79 SER SER A . n A 1 88 GLY 88 80 80 GLY GLY A . n A 1 89 TYR 89 81 81 TYR TYR A . n A 1 90 PHE 90 82 82 PHE PHE A . n A 1 91 ARG 91 83 83 ARG ARG A . n A 1 92 PRO 92 84 84 PRO PRO A . n A 1 93 ARG 93 85 85 ARG ARG A . n A 1 94 PRO 94 86 86 PRO PRO A . n A 1 95 ASP 95 87 87 ASP ASP A . n A 1 96 GLY 96 88 88 GLY GLY A . n A 1 97 SER 97 89 89 SER SER A . n A 1 98 ILE 98 90 90 ILE ILE A . n A 1 99 GLU 99 91 91 GLU GLU A . n A 1 100 VAL 100 92 92 VAL VAL A . n A 1 101 VAL 101 93 93 VAL VAL A . n A 1 102 ILE 102 94 94 ILE ILE A . n A 1 103 ALA 103 95 95 ALA ALA A . n A 1 104 CYS 104 96 96 CYS CYS A . n A 1 105 SER 105 97 97 SER SER A . n A 1 106 THR 106 98 98 THR THR A . n A 1 107 GLY 107 99 99 GLY GLY A . n A 1 108 LEU 108 100 100 LEU LEU A . n A 1 109 VAL 109 101 101 VAL VAL A . n A 1 110 GLU 110 102 102 GLU GLU A . n A 1 111 VAL 111 103 103 VAL VAL A . n A 1 112 GLN 112 104 104 GLN GLN A . n A 1 113 LYS 113 105 105 LYS LYS A . n A 1 114 GLY 114 106 106 GLY GLY A . n A 1 115 THR 115 107 107 THR THR A . n A 1 116 TYR 116 108 108 TYR TYR A . n A 1 117 ASN 117 109 109 ASN ASN A . n A 1 118 VAL 118 110 110 VAL VAL A . n A 1 119 ASP 119 111 111 ASP ASP A . n A 1 120 GLU 120 112 112 GLU GLU A . n A 1 121 GLN 121 113 113 GLN GLN A . n A 1 122 SER 122 114 114 SER SER A . n A 1 123 ILE 123 115 115 ILE ILE A . n A 1 124 LYS 124 116 116 LYS LYS A . n A 1 125 LEU 125 117 117 LEU LEU A . n A 1 126 LYS 126 118 118 LYS LYS A . n A 1 127 SER 127 119 119 SER SER A . n A 1 128 ASP 128 120 120 ASP ASP A . n A 1 129 LEU 129 121 121 LEU LEU A . n A 1 130 VAL 130 122 122 VAL VAL A . n A 1 131 GLY 131 123 123 GLY GLY A . n A 1 132 ASN 132 124 124 ASN ASN A . n A 1 133 ALA 133 125 125 ALA ALA A . n A 1 134 SER 134 126 126 SER SER A . n A 1 135 LYS 135 127 127 LYS LYS A . n A 1 136 VAL 136 128 128 VAL VAL A . n A 1 137 LYS 137 129 129 LYS LYS A . n A 1 138 GLU 138 130 130 GLU GLU A . n A 1 139 ILE 139 131 131 ILE ILE A . n A 1 140 SER 140 132 132 SER SER A . n A 1 141 ARG 141 133 133 ARG ARG A . n A 1 142 GLU 142 134 134 GLU GLU A . n A 1 143 PHE 143 135 135 PHE PHE A . n A 1 144 GLU 144 136 136 GLU GLU A . n A 1 145 LEU 145 137 137 LEU LEU A . n A 1 146 VAL 146 138 138 VAL VAL A . n A 1 147 ASP 147 139 139 ASP ASP A . n A 1 148 GLY 148 140 140 GLY GLY A . n A 1 149 LYS 149 141 141 LYS LYS A . n A 1 150 LEU 150 142 142 LEU LEU A . n A 1 151 SER 151 143 143 SER SER A . n A 1 152 TYR 152 144 144 TYR TYR A . n A 1 153 VAL 153 145 145 VAL VAL A . n A 1 154 VAL 154 146 146 VAL VAL A . n A 1 155 ARG 155 147 147 ARG ARG A . n A 1 156 LEU 156 148 148 LEU LEU A . n A 1 157 SER 157 149 149 SER SER A . n A 1 158 THR 158 150 150 THR THR A . n A 1 159 THR 159 151 151 THR THR A . n A 1 160 THR 160 152 152 THR THR A . n A 1 161 ASN 161 153 153 ASN ASN A . n A 1 162 PRO 162 154 154 PRO PRO A . n A 1 163 LEU 163 155 155 LEU LEU A . n A 1 164 GLN 164 156 156 GLN GLN A . n A 1 165 PRO 165 157 157 PRO PRO A . n A 1 166 ALA 166 158 158 ALA ALA A . n A 1 167 LEU 167 159 159 LEU LEU A . n A 1 168 LYS 168 160 160 LYS LYS A . n A 1 169 ALA 169 161 161 ALA ALA A . n A 1 170 ILE 170 162 162 ILE ILE A . n A 1 171 LEU 171 163 163 LEU LEU A . n A 1 172 ASP 172 164 164 ASP ASP A . n A 1 173 LYS 173 165 165 LYS LYS A . n A 1 174 LEU 174 166 166 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 GOL 1 201 1 GOL GOL A . C 2 GOL 1 202 2 GOL GOL A . D 2 GOL 1 203 3 GOL GOL A . E 2 GOL 1 204 4 GOL GOL A . F 3 HOH 1 301 71 HOH HOH A . F 3 HOH 2 302 20 HOH HOH A . F 3 HOH 3 303 57 HOH HOH A . F 3 HOH 4 304 84 HOH HOH A . F 3 HOH 5 305 105 HOH HOH A . F 3 HOH 6 306 65 HOH HOH A . F 3 HOH 7 307 40 HOH HOH A . F 3 HOH 8 308 108 HOH HOH A . F 3 HOH 9 309 70 HOH HOH A . F 3 HOH 10 310 77 HOH HOH A . F 3 HOH 11 311 38 HOH HOH A . F 3 HOH 12 312 50 HOH HOH A . F 3 HOH 13 313 56 HOH HOH A . F 3 HOH 14 314 73 HOH HOH A . F 3 HOH 15 315 137 HOH HOH A . F 3 HOH 16 316 30 HOH HOH A . F 3 HOH 17 317 172 HOH HOH A . F 3 HOH 18 318 61 HOH HOH A . F 3 HOH 19 319 7 HOH HOH A . F 3 HOH 20 320 92 HOH HOH A . F 3 HOH 21 321 52 HOH HOH A . F 3 HOH 22 322 27 HOH HOH A . F 3 HOH 23 323 185 HOH HOH A . F 3 HOH 24 324 26 HOH HOH A . F 3 HOH 25 325 23 HOH HOH A . F 3 HOH 26 326 88 HOH HOH A . F 3 HOH 27 327 161 HOH HOH A . F 3 HOH 28 328 68 HOH HOH A . F 3 HOH 29 329 22 HOH HOH A . F 3 HOH 30 330 36 HOH HOH A . F 3 HOH 31 331 54 HOH HOH A . F 3 HOH 32 332 46 HOH HOH A . F 3 HOH 33 333 72 HOH HOH A . F 3 HOH 34 334 21 HOH HOH A . F 3 HOH 35 335 64 HOH HOH A . F 3 HOH 36 336 66 HOH HOH A . F 3 HOH 37 337 163 HOH HOH A . F 3 HOH 38 338 140 HOH HOH A . F 3 HOH 39 339 13 HOH HOH A . F 3 HOH 40 340 154 HOH HOH A . F 3 HOH 41 341 29 HOH HOH A . F 3 HOH 42 342 128 HOH HOH A . F 3 HOH 43 343 41 HOH HOH A . F 3 HOH 44 344 80 HOH HOH A . F 3 HOH 45 345 45 HOH HOH A . F 3 HOH 46 346 78 HOH HOH A . F 3 HOH 47 347 19 HOH HOH A . F 3 HOH 48 348 125 HOH HOH A . F 3 HOH 49 349 62 HOH HOH A . F 3 HOH 50 350 85 HOH HOH A . F 3 HOH 51 351 25 HOH HOH A . F 3 HOH 52 352 120 HOH HOH A . F 3 HOH 53 353 160 HOH HOH A . F 3 HOH 54 354 195 HOH HOH A . F 3 HOH 55 355 145 HOH HOH A . F 3 HOH 56 356 124 HOH HOH A . F 3 HOH 57 357 173 HOH HOH A . F 3 HOH 58 358 133 HOH HOH A . F 3 HOH 59 359 116 HOH HOH A . F 3 HOH 60 360 127 HOH HOH A . F 3 HOH 61 361 112 HOH HOH A . F 3 HOH 62 362 103 HOH HOH A . F 3 HOH 63 363 131 HOH HOH A . F 3 HOH 64 364 122 HOH HOH A . F 3 HOH 65 365 142 HOH HOH A . F 3 HOH 66 366 156 HOH HOH A . F 3 HOH 67 367 100 HOH HOH A . F 3 HOH 68 368 109 HOH HOH A . F 3 HOH 69 369 117 HOH HOH A . F 3 HOH 70 370 99 HOH HOH A . F 3 HOH 71 371 106 HOH HOH A . F 3 HOH 72 372 157 HOH HOH A . F 3 HOH 73 373 104 HOH HOH A . F 3 HOH 74 374 51 HOH HOH A . F 3 HOH 75 375 144 HOH HOH A . F 3 HOH 76 376 102 HOH HOH A . F 3 HOH 77 377 134 HOH HOH A . F 3 HOH 78 378 178 HOH HOH A . F 3 HOH 79 379 135 HOH HOH A . F 3 HOH 80 380 115 HOH HOH A . F 3 HOH 81 381 101 HOH HOH A . F 3 HOH 82 382 1 HOH HOH A . F 3 HOH 83 383 2 HOH HOH A . F 3 HOH 84 384 3 HOH HOH A . F 3 HOH 85 385 4 HOH HOH A . F 3 HOH 86 386 5 HOH HOH A . F 3 HOH 87 387 6 HOH HOH A . F 3 HOH 88 388 8 HOH HOH A . F 3 HOH 89 389 9 HOH HOH A . F 3 HOH 90 390 10 HOH HOH A . F 3 HOH 91 391 11 HOH HOH A . F 3 HOH 92 392 12 HOH HOH A . F 3 HOH 93 393 14 HOH HOH A . F 3 HOH 94 394 15 HOH HOH A . F 3 HOH 95 395 16 HOH HOH A . F 3 HOH 96 396 17 HOH HOH A . F 3 HOH 97 397 18 HOH HOH A . F 3 HOH 98 398 24 HOH HOH A . F 3 HOH 99 399 28 HOH HOH A . F 3 HOH 100 400 31 HOH HOH A . F 3 HOH 101 401 32 HOH HOH A . F 3 HOH 102 402 33 HOH HOH A . F 3 HOH 103 403 34 HOH HOH A . F 3 HOH 104 404 35 HOH HOH A . F 3 HOH 105 405 37 HOH HOH A . F 3 HOH 106 406 39 HOH HOH A . F 3 HOH 107 407 42 HOH HOH A . F 3 HOH 108 408 43 HOH HOH A . F 3 HOH 109 409 44 HOH HOH A . F 3 HOH 110 410 47 HOH HOH A . F 3 HOH 111 411 48 HOH HOH A . F 3 HOH 112 412 49 HOH HOH A . F 3 HOH 113 413 53 HOH HOH A . F 3 HOH 114 414 55 HOH HOH A . F 3 HOH 115 415 58 HOH HOH A . F 3 HOH 116 416 59 HOH HOH A . F 3 HOH 117 417 60 HOH HOH A . F 3 HOH 118 418 63 HOH HOH A . F 3 HOH 119 419 67 HOH HOH A . F 3 HOH 120 420 69 HOH HOH A . F 3 HOH 121 421 74 HOH HOH A . F 3 HOH 122 422 75 HOH HOH A . F 3 HOH 123 423 76 HOH HOH A . F 3 HOH 124 424 79 HOH HOH A . F 3 HOH 125 425 81 HOH HOH A . F 3 HOH 126 426 82 HOH HOH A . F 3 HOH 127 427 83 HOH HOH A . F 3 HOH 128 428 86 HOH HOH A . F 3 HOH 129 429 87 HOH HOH A . F 3 HOH 130 430 89 HOH HOH A . F 3 HOH 131 431 90 HOH HOH A . F 3 HOH 132 432 91 HOH HOH A . F 3 HOH 133 433 93 HOH HOH A . F 3 HOH 134 434 94 HOH HOH A . F 3 HOH 135 435 95 HOH HOH A . F 3 HOH 136 436 96 HOH HOH A . F 3 HOH 137 437 97 HOH HOH A . F 3 HOH 138 438 98 HOH HOH A . F 3 HOH 139 439 107 HOH HOH A . F 3 HOH 140 440 110 HOH HOH A . F 3 HOH 141 441 111 HOH HOH A . F 3 HOH 142 442 113 HOH HOH A . F 3 HOH 143 443 114 HOH HOH A . F 3 HOH 144 444 118 HOH HOH A . F 3 HOH 145 445 119 HOH HOH A . F 3 HOH 146 446 121 HOH HOH A . F 3 HOH 147 447 123 HOH HOH A . F 3 HOH 148 448 126 HOH HOH A . F 3 HOH 149 449 129 HOH HOH A . F 3 HOH 150 450 130 HOH HOH A . F 3 HOH 151 451 132 HOH HOH A . F 3 HOH 152 452 136 HOH HOH A . F 3 HOH 153 453 138 HOH HOH A . F 3 HOH 154 454 139 HOH HOH A . F 3 HOH 155 455 141 HOH HOH A . F 3 HOH 156 456 143 HOH HOH A . F 3 HOH 157 457 146 HOH HOH A . F 3 HOH 158 458 147 HOH HOH A . F 3 HOH 159 459 148 HOH HOH A . F 3 HOH 160 460 149 HOH HOH A . F 3 HOH 161 461 150 HOH HOH A . F 3 HOH 162 462 151 HOH HOH A . F 3 HOH 163 463 152 HOH HOH A . F 3 HOH 164 464 153 HOH HOH A . F 3 HOH 165 465 155 HOH HOH A . F 3 HOH 166 466 158 HOH HOH A . F 3 HOH 167 467 159 HOH HOH A . F 3 HOH 168 468 162 HOH HOH A . F 3 HOH 169 469 164 HOH HOH A . F 3 HOH 170 470 165 HOH HOH A . F 3 HOH 171 471 166 HOH HOH A . F 3 HOH 172 472 167 HOH HOH A . F 3 HOH 173 473 168 HOH HOH A . F 3 HOH 174 474 169 HOH HOH A . F 3 HOH 175 475 170 HOH HOH A . F 3 HOH 176 476 171 HOH HOH A . F 3 HOH 177 477 174 HOH HOH A . F 3 HOH 178 478 175 HOH HOH A . F 3 HOH 179 479 176 HOH HOH A . F 3 HOH 180 480 177 HOH HOH A . F 3 HOH 181 481 179 HOH HOH A . F 3 HOH 182 482 180 HOH HOH A . F 3 HOH 183 483 181 HOH HOH A . F 3 HOH 184 484 182 HOH HOH A . F 3 HOH 185 485 183 HOH HOH A . F 3 HOH 186 486 184 HOH HOH A . F 3 HOH 187 487 186 HOH HOH A . F 3 HOH 188 488 187 HOH HOH A . F 3 HOH 189 489 188 HOH HOH A . F 3 HOH 190 490 189 HOH HOH A . F 3 HOH 191 491 190 HOH HOH A . F 3 HOH 192 492 191 HOH HOH A . F 3 HOH 193 493 192 HOH HOH A . F 3 HOH 194 494 193 HOH HOH A . F 3 HOH 195 495 194 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3740 ? 1 MORE -14 ? 1 'SSA (A^2)' 14850 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_575 -x,-y+2,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 158.5700000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id HOH _pdbx_struct_special_symmetry.auth_seq_id 378 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id F _pdbx_struct_special_symmetry.label_comp_id HOH _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-30 2 'Structure model' 1 1 2020-02-05 3 'Structure model' 1 2 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_source 2 2 'Structure model' pdbx_struct_oper_list 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 1 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 471 ? ? O A HOH 491 ? ? 1.75 2 1 O3 A GOL 202 ? ? O A HOH 425 ? ? 2.09 3 1 NE2 A GLN 113 ? ? O A HOH 442 ? ? 2.10 4 1 O A HOH 460 ? ? O A HOH 469 ? ? 2.10 5 1 O A HOH 445 ? ? O A HOH 489 ? ? 2.17 6 1 O A HOH 310 ? ? O A HOH 484 ? ? 2.19 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CD A GLU 78 ? ? OE1 A GLU 78 ? ? 1.178 1.252 -0.074 0.011 N 2 1 CD A GLU 78 ? ? OE2 A GLU 78 ? ? 1.173 1.252 -0.079 0.011 N 3 1 CB A GLU 102 ? ? CG A GLU 102 ? ? 1.388 1.517 -0.129 0.019 N 4 1 CD A GLU 102 ? ? OE2 A GLU 102 ? ? 1.149 1.252 -0.103 0.011 N 5 1 CB A ASP 120 ? B CG A ASP 120 ? B 1.331 1.513 -0.182 0.021 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 83 ? ? CZ A ARG 83 ? ? NH2 A ARG 83 ? ? 117.17 120.30 -3.13 0.50 N 2 1 CB A ASP 120 ? A CG A ASP 120 ? A OD1 A ASP 120 ? A 124.72 118.30 6.42 0.90 N 3 1 CB A ASP 120 ? A CG A ASP 120 ? A OD2 A ASP 120 ? A 107.65 118.30 -10.65 0.90 N 4 1 CB A ASP 120 ? B CG A ASP 120 ? B OD2 A ASP 120 ? B 111.57 118.30 -6.73 0.90 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 40 ? ? 71.83 -0.10 2 1 PRO A 58 ? ? -81.13 48.86 3 1 ALA A 75 ? ? -116.12 -91.17 4 1 LYS A 127 ? ? -131.67 -40.36 5 1 ALA A 158 ? ? -130.62 -41.44 # _pdbx_validate_planes.id 1 _pdbx_validate_planes.PDB_model_num 1 _pdbx_validate_planes.auth_comp_id ARG _pdbx_validate_planes.auth_asym_id A _pdbx_validate_planes.auth_seq_id 83 _pdbx_validate_planes.PDB_ins_code ? _pdbx_validate_planes.label_alt_id ? _pdbx_validate_planes.rmsd 0.079 _pdbx_validate_planes.type 'SIDE CHAIN' # loop_ _pdbx_distant_solvent_atoms.id _pdbx_distant_solvent_atoms.PDB_model_num _pdbx_distant_solvent_atoms.auth_atom_id _pdbx_distant_solvent_atoms.label_alt_id _pdbx_distant_solvent_atoms.auth_asym_id _pdbx_distant_solvent_atoms.auth_comp_id _pdbx_distant_solvent_atoms.auth_seq_id _pdbx_distant_solvent_atoms.PDB_ins_code _pdbx_distant_solvent_atoms.neighbor_macromolecule_distance _pdbx_distant_solvent_atoms.neighbor_ligand_distance 1 1 O ? A HOH 440 ? 6.12 . 2 1 O ? A HOH 474 ? 6.12 . 3 1 O ? A HOH 476 ? 6.15 . 4 1 O ? A HOH 490 ? 6.71 . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -7 ? A MET 1 2 1 Y 1 A TRP -6 ? A TRP 2 3 1 Y 1 A SER -5 ? A SER 3 4 1 Y 1 A HIS -4 ? A HIS 4 5 1 Y 1 A PRO -3 ? A PRO 5 6 1 Y 1 A GLN -2 ? A GLN 6 7 1 Y 1 A PHE -1 ? A PHE 7 8 1 Y 1 A GLU 0 ? A GLU 8 9 1 Y 1 A LYS 1 ? A LYS 9 10 1 Y 1 A ASN 2 ? A ASN 10 11 1 Y 1 A GLN 3 ? A GLN 11 12 1 Y 1 A LEU 4 ? A LEU 12 13 1 Y 1 A GLN 5 ? A GLN 13 14 1 Y 1 A GLN 6 ? A GLN 14 15 1 Y 1 A LEU 7 ? A LEU 15 16 1 Y 1 A GLN 8 ? A GLN 16 17 1 Y 1 A ASN 9 ? A ASN 17 18 1 Y 1 A PRO 10 ? A PRO 18 19 1 Y 1 A GLY 11 ? A GLY 19 20 1 Y 1 A GLU 12 ? A GLU 20 21 1 Y 1 A SER 13 ? A SER 21 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 GOL C1 C N N 137 GOL O1 O N N 138 GOL C2 C N N 139 GOL O2 O N N 140 GOL C3 C N N 141 GOL O3 O N N 142 GOL H11 H N N 143 GOL H12 H N N 144 GOL HO1 H N N 145 GOL H2 H N N 146 GOL HO2 H N N 147 GOL H31 H N N 148 GOL H32 H N N 149 GOL HO3 H N N 150 HIS N N N N 151 HIS CA C N S 152 HIS C C N N 153 HIS O O N N 154 HIS CB C N N 155 HIS CG C Y N 156 HIS ND1 N Y N 157 HIS CD2 C Y N 158 HIS CE1 C Y N 159 HIS NE2 N Y N 160 HIS OXT O N N 161 HIS H H N N 162 HIS H2 H N N 163 HIS HA H N N 164 HIS HB2 H N N 165 HIS HB3 H N N 166 HIS HD1 H N N 167 HIS HD2 H N N 168 HIS HE1 H N N 169 HIS HE2 H N N 170 HIS HXT H N N 171 HOH O O N N 172 HOH H1 H N N 173 HOH H2 H N N 174 ILE N N N N 175 ILE CA C N S 176 ILE C C N N 177 ILE O O N N 178 ILE CB C N S 179 ILE CG1 C N N 180 ILE CG2 C N N 181 ILE CD1 C N N 182 ILE OXT O N N 183 ILE H H N N 184 ILE H2 H N N 185 ILE HA H N N 186 ILE HB H N N 187 ILE HG12 H N N 188 ILE HG13 H N N 189 ILE HG21 H N N 190 ILE HG22 H N N 191 ILE HG23 H N N 192 ILE HD11 H N N 193 ILE HD12 H N N 194 ILE HD13 H N N 195 ILE HXT H N N 196 LEU N N N N 197 LEU CA C N S 198 LEU C C N N 199 LEU O O N N 200 LEU CB C N N 201 LEU CG C N N 202 LEU CD1 C N N 203 LEU CD2 C N N 204 LEU OXT O N N 205 LEU H H N N 206 LEU H2 H N N 207 LEU HA H N N 208 LEU HB2 H N N 209 LEU HB3 H N N 210 LEU HG H N N 211 LEU HD11 H N N 212 LEU HD12 H N N 213 LEU HD13 H N N 214 LEU HD21 H N N 215 LEU HD22 H N N 216 LEU HD23 H N N 217 LEU HXT H N N 218 LYS N N N N 219 LYS CA C N S 220 LYS C C N N 221 LYS O O N N 222 LYS CB C N N 223 LYS CG C N N 224 LYS CD C N N 225 LYS CE C N N 226 LYS NZ N N N 227 LYS OXT O N N 228 LYS H H N N 229 LYS H2 H N N 230 LYS HA H N N 231 LYS HB2 H N N 232 LYS HB3 H N N 233 LYS HG2 H N N 234 LYS HG3 H N N 235 LYS HD2 H N N 236 LYS HD3 H N N 237 LYS HE2 H N N 238 LYS HE3 H N N 239 LYS HZ1 H N N 240 LYS HZ2 H N N 241 LYS HZ3 H N N 242 LYS HXT H N N 243 MET N N N N 244 MET CA C N S 245 MET C C N N 246 MET O O N N 247 MET CB C N N 248 MET CG C N N 249 MET SD S N N 250 MET CE C N N 251 MET OXT O N N 252 MET H H N N 253 MET H2 H N N 254 MET HA H N N 255 MET HB2 H N N 256 MET HB3 H N N 257 MET HG2 H N N 258 MET HG3 H N N 259 MET HE1 H N N 260 MET HE2 H N N 261 MET HE3 H N N 262 MET HXT H N N 263 PHE N N N N 264 PHE CA C N S 265 PHE C C N N 266 PHE O O N N 267 PHE CB C N N 268 PHE CG C Y N 269 PHE CD1 C Y N 270 PHE CD2 C Y N 271 PHE CE1 C Y N 272 PHE CE2 C Y N 273 PHE CZ C Y N 274 PHE OXT O N N 275 PHE H H N N 276 PHE H2 H N N 277 PHE HA H N N 278 PHE HB2 H N N 279 PHE HB3 H N N 280 PHE HD1 H N N 281 PHE HD2 H N N 282 PHE HE1 H N N 283 PHE HE2 H N N 284 PHE HZ H N N 285 PHE HXT H N N 286 PRO N N N N 287 PRO CA C N S 288 PRO C C N N 289 PRO O O N N 290 PRO CB C N N 291 PRO CG C N N 292 PRO CD C N N 293 PRO OXT O N N 294 PRO H H N N 295 PRO HA H N N 296 PRO HB2 H N N 297 PRO HB3 H N N 298 PRO HG2 H N N 299 PRO HG3 H N N 300 PRO HD2 H N N 301 PRO HD3 H N N 302 PRO HXT H N N 303 SER N N N N 304 SER CA C N S 305 SER C C N N 306 SER O O N N 307 SER CB C N N 308 SER OG O N N 309 SER OXT O N N 310 SER H H N N 311 SER H2 H N N 312 SER HA H N N 313 SER HB2 H N N 314 SER HB3 H N N 315 SER HG H N N 316 SER HXT H N N 317 THR N N N N 318 THR CA C N S 319 THR C C N N 320 THR O O N N 321 THR CB C N R 322 THR OG1 O N N 323 THR CG2 C N N 324 THR OXT O N N 325 THR H H N N 326 THR H2 H N N 327 THR HA H N N 328 THR HB H N N 329 THR HG1 H N N 330 THR HG21 H N N 331 THR HG22 H N N 332 THR HG23 H N N 333 THR HXT H N N 334 TRP N N N N 335 TRP CA C N S 336 TRP C C N N 337 TRP O O N N 338 TRP CB C N N 339 TRP CG C Y N 340 TRP CD1 C Y N 341 TRP CD2 C Y N 342 TRP NE1 N Y N 343 TRP CE2 C Y N 344 TRP CE3 C Y N 345 TRP CZ2 C Y N 346 TRP CZ3 C Y N 347 TRP CH2 C Y N 348 TRP OXT O N N 349 TRP H H N N 350 TRP H2 H N N 351 TRP HA H N N 352 TRP HB2 H N N 353 TRP HB3 H N N 354 TRP HD1 H N N 355 TRP HE1 H N N 356 TRP HE3 H N N 357 TRP HZ2 H N N 358 TRP HZ3 H N N 359 TRP HH2 H N N 360 TRP HXT H N N 361 TYR N N N N 362 TYR CA C N S 363 TYR C C N N 364 TYR O O N N 365 TYR CB C N N 366 TYR CG C Y N 367 TYR CD1 C Y N 368 TYR CD2 C Y N 369 TYR CE1 C Y N 370 TYR CE2 C Y N 371 TYR CZ C Y N 372 TYR OH O N N 373 TYR OXT O N N 374 TYR H H N N 375 TYR H2 H N N 376 TYR HA H N N 377 TYR HB2 H N N 378 TYR HB3 H N N 379 TYR HD1 H N N 380 TYR HD2 H N N 381 TYR HE1 H N N 382 TYR HE2 H N N 383 TYR HH H N N 384 TYR HXT H N N 385 VAL N N N N 386 VAL CA C N S 387 VAL C C N N 388 VAL O O N N 389 VAL CB C N N 390 VAL CG1 C N N 391 VAL CG2 C N N 392 VAL OXT O N N 393 VAL H H N N 394 VAL H2 H N N 395 VAL HA H N N 396 VAL HB H N N 397 VAL HG11 H N N 398 VAL HG12 H N N 399 VAL HG13 H N N 400 VAL HG21 H N N 401 VAL HG22 H N N 402 VAL HG23 H N N 403 VAL HXT H N N 404 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 GOL C1 O1 sing N N 129 GOL C1 C2 sing N N 130 GOL C1 H11 sing N N 131 GOL C1 H12 sing N N 132 GOL O1 HO1 sing N N 133 GOL C2 O2 sing N N 134 GOL C2 C3 sing N N 135 GOL C2 H2 sing N N 136 GOL O2 HO2 sing N N 137 GOL C3 O3 sing N N 138 GOL C3 H31 sing N N 139 GOL C3 H32 sing N N 140 GOL O3 HO3 sing N N 141 HIS N CA sing N N 142 HIS N H sing N N 143 HIS N H2 sing N N 144 HIS CA C sing N N 145 HIS CA CB sing N N 146 HIS CA HA sing N N 147 HIS C O doub N N 148 HIS C OXT sing N N 149 HIS CB CG sing N N 150 HIS CB HB2 sing N N 151 HIS CB HB3 sing N N 152 HIS CG ND1 sing Y N 153 HIS CG CD2 doub Y N 154 HIS ND1 CE1 doub Y N 155 HIS ND1 HD1 sing N N 156 HIS CD2 NE2 sing Y N 157 HIS CD2 HD2 sing N N 158 HIS CE1 NE2 sing Y N 159 HIS CE1 HE1 sing N N 160 HIS NE2 HE2 sing N N 161 HIS OXT HXT sing N N 162 HOH O H1 sing N N 163 HOH O H2 sing N N 164 ILE N CA sing N N 165 ILE N H sing N N 166 ILE N H2 sing N N 167 ILE CA C sing N N 168 ILE CA CB sing N N 169 ILE CA HA sing N N 170 ILE C O doub N N 171 ILE C OXT sing N N 172 ILE CB CG1 sing N N 173 ILE CB CG2 sing N N 174 ILE CB HB sing N N 175 ILE CG1 CD1 sing N N 176 ILE CG1 HG12 sing N N 177 ILE CG1 HG13 sing N N 178 ILE CG2 HG21 sing N N 179 ILE CG2 HG22 sing N N 180 ILE CG2 HG23 sing N N 181 ILE CD1 HD11 sing N N 182 ILE CD1 HD12 sing N N 183 ILE CD1 HD13 sing N N 184 ILE OXT HXT sing N N 185 LEU N CA sing N N 186 LEU N H sing N N 187 LEU N H2 sing N N 188 LEU CA C sing N N 189 LEU CA CB sing N N 190 LEU CA HA sing N N 191 LEU C O doub N N 192 LEU C OXT sing N N 193 LEU CB CG sing N N 194 LEU CB HB2 sing N N 195 LEU CB HB3 sing N N 196 LEU CG CD1 sing N N 197 LEU CG CD2 sing N N 198 LEU CG HG sing N N 199 LEU CD1 HD11 sing N N 200 LEU CD1 HD12 sing N N 201 LEU CD1 HD13 sing N N 202 LEU CD2 HD21 sing N N 203 LEU CD2 HD22 sing N N 204 LEU CD2 HD23 sing N N 205 LEU OXT HXT sing N N 206 LYS N CA sing N N 207 LYS N H sing N N 208 LYS N H2 sing N N 209 LYS CA C sing N N 210 LYS CA CB sing N N 211 LYS CA HA sing N N 212 LYS C O doub N N 213 LYS C OXT sing N N 214 LYS CB CG sing N N 215 LYS CB HB2 sing N N 216 LYS CB HB3 sing N N 217 LYS CG CD sing N N 218 LYS CG HG2 sing N N 219 LYS CG HG3 sing N N 220 LYS CD CE sing N N 221 LYS CD HD2 sing N N 222 LYS CD HD3 sing N N 223 LYS CE NZ sing N N 224 LYS CE HE2 sing N N 225 LYS CE HE3 sing N N 226 LYS NZ HZ1 sing N N 227 LYS NZ HZ2 sing N N 228 LYS NZ HZ3 sing N N 229 LYS OXT HXT sing N N 230 MET N CA sing N N 231 MET N H sing N N 232 MET N H2 sing N N 233 MET CA C sing N N 234 MET CA CB sing N N 235 MET CA HA sing N N 236 MET C O doub N N 237 MET C OXT sing N N 238 MET CB CG sing N N 239 MET CB HB2 sing N N 240 MET CB HB3 sing N N 241 MET CG SD sing N N 242 MET CG HG2 sing N N 243 MET CG HG3 sing N N 244 MET SD CE sing N N 245 MET CE HE1 sing N N 246 MET CE HE2 sing N N 247 MET CE HE3 sing N N 248 MET OXT HXT sing N N 249 PHE N CA sing N N 250 PHE N H sing N N 251 PHE N H2 sing N N 252 PHE CA C sing N N 253 PHE CA CB sing N N 254 PHE CA HA sing N N 255 PHE C O doub N N 256 PHE C OXT sing N N 257 PHE CB CG sing N N 258 PHE CB HB2 sing N N 259 PHE CB HB3 sing N N 260 PHE CG CD1 doub Y N 261 PHE CG CD2 sing Y N 262 PHE CD1 CE1 sing Y N 263 PHE CD1 HD1 sing N N 264 PHE CD2 CE2 doub Y N 265 PHE CD2 HD2 sing N N 266 PHE CE1 CZ doub Y N 267 PHE CE1 HE1 sing N N 268 PHE CE2 CZ sing Y N 269 PHE CE2 HE2 sing N N 270 PHE CZ HZ sing N N 271 PHE OXT HXT sing N N 272 PRO N CA sing N N 273 PRO N CD sing N N 274 PRO N H sing N N 275 PRO CA C sing N N 276 PRO CA CB sing N N 277 PRO CA HA sing N N 278 PRO C O doub N N 279 PRO C OXT sing N N 280 PRO CB CG sing N N 281 PRO CB HB2 sing N N 282 PRO CB HB3 sing N N 283 PRO CG CD sing N N 284 PRO CG HG2 sing N N 285 PRO CG HG3 sing N N 286 PRO CD HD2 sing N N 287 PRO CD HD3 sing N N 288 PRO OXT HXT sing N N 289 SER N CA sing N N 290 SER N H sing N N 291 SER N H2 sing N N 292 SER CA C sing N N 293 SER CA CB sing N N 294 SER CA HA sing N N 295 SER C O doub N N 296 SER C OXT sing N N 297 SER CB OG sing N N 298 SER CB HB2 sing N N 299 SER CB HB3 sing N N 300 SER OG HG sing N N 301 SER OXT HXT sing N N 302 THR N CA sing N N 303 THR N H sing N N 304 THR N H2 sing N N 305 THR CA C sing N N 306 THR CA CB sing N N 307 THR CA HA sing N N 308 THR C O doub N N 309 THR C OXT sing N N 310 THR CB OG1 sing N N 311 THR CB CG2 sing N N 312 THR CB HB sing N N 313 THR OG1 HG1 sing N N 314 THR CG2 HG21 sing N N 315 THR CG2 HG22 sing N N 316 THR CG2 HG23 sing N N 317 THR OXT HXT sing N N 318 TRP N CA sing N N 319 TRP N H sing N N 320 TRP N H2 sing N N 321 TRP CA C sing N N 322 TRP CA CB sing N N 323 TRP CA HA sing N N 324 TRP C O doub N N 325 TRP C OXT sing N N 326 TRP CB CG sing N N 327 TRP CB HB2 sing N N 328 TRP CB HB3 sing N N 329 TRP CG CD1 doub Y N 330 TRP CG CD2 sing Y N 331 TRP CD1 NE1 sing Y N 332 TRP CD1 HD1 sing N N 333 TRP CD2 CE2 doub Y N 334 TRP CD2 CE3 sing Y N 335 TRP NE1 CE2 sing Y N 336 TRP NE1 HE1 sing N N 337 TRP CE2 CZ2 sing Y N 338 TRP CE3 CZ3 doub Y N 339 TRP CE3 HE3 sing N N 340 TRP CZ2 CH2 doub Y N 341 TRP CZ2 HZ2 sing N N 342 TRP CZ3 CH2 sing Y N 343 TRP CZ3 HZ3 sing N N 344 TRP CH2 HH2 sing N N 345 TRP OXT HXT sing N N 346 TYR N CA sing N N 347 TYR N H sing N N 348 TYR N H2 sing N N 349 TYR CA C sing N N 350 TYR CA CB sing N N 351 TYR CA HA sing N N 352 TYR C O doub N N 353 TYR C OXT sing N N 354 TYR CB CG sing N N 355 TYR CB HB2 sing N N 356 TYR CB HB3 sing N N 357 TYR CG CD1 doub Y N 358 TYR CG CD2 sing Y N 359 TYR CD1 CE1 sing Y N 360 TYR CD1 HD1 sing N N 361 TYR CD2 CE2 doub Y N 362 TYR CD2 HD2 sing N N 363 TYR CE1 CZ doub Y N 364 TYR CE1 HE1 sing N N 365 TYR CE2 CZ sing Y N 366 TYR CE2 HE2 sing N N 367 TYR CZ OH sing N N 368 TYR OH HH sing N N 369 TYR OXT HXT sing N N 370 VAL N CA sing N N 371 VAL N H sing N N 372 VAL N H2 sing N N 373 VAL CA C sing N N 374 VAL CA CB sing N N 375 VAL CA HA sing N N 376 VAL C O doub N N 377 VAL C OXT sing N N 378 VAL CB CG1 sing N N 379 VAL CB CG2 sing N N 380 VAL CB HB sing N N 381 VAL CG1 HG11 sing N N 382 VAL CG1 HG12 sing N N 383 VAL CG1 HG13 sing N N 384 VAL CG2 HG21 sing N N 385 VAL CG2 HG22 sing N N 386 VAL CG2 HG23 sing N N 387 VAL OXT HXT sing N N 388 # _pdbx_audit_support.funding_organization MEXT _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 'area 2204' _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 GLYCEROL GOL 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2A13 _pdbx_initial_refinement_model.details ? #