data_4Z8W # _entry.id 4Z8W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4Z8W pdb_00004z8w 10.2210/pdb4z8w/pdb WWPDB D_1000208806 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-06 2 'Structure model' 1 1 2018-05-30 3 'Structure model' 1 2 2024-11-13 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_entry_details 7 3 'Structure model' pdbx_modification_feature 8 3 'Structure model' pdbx_struct_conn_angle 9 3 'Structure model' struct_conn # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 3 'Structure model' '_database_2.pdbx_DOI' 13 3 'Structure model' '_database_2.pdbx_database_accession' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_symmetry' 20 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 21 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 22 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 23 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 24 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 25 3 'Structure model' '_pdbx_struct_conn_angle.value' 26 3 'Structure model' '_struct_conn.pdbx_dist_value' 27 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 28 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 29 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 30 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 31 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 32 3 'Structure model' '_struct_conn.ptnr2_symmetry' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4Z8W _pdbx_database_status.recvd_initial_deposition_date 2015-04-09 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Freier, R.' 1 'Brandstetter, H.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'J. Allergy Clin. Immunol.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1097-6825 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 140 _citation.language ? _citation.page_first 277 _citation.page_last 280 _citation.title 'Crystal structure of Pla l 1 reveals both structural similarity and allergenic divergence within the Ole e 1-like protein family.' _citation.year 2017 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jaci.2016.10.035 _citation.pdbx_database_id_PubMed 27965108 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Stemeseder, T.' 1 ? primary 'Freier, R.' 2 ? primary 'Wildner, S.' 3 ? primary 'Fuchs, J.E.' 4 ? primary 'Briza, P.' 5 ? primary 'Lang, R.' 6 ? primary 'Batanero, E.' 7 ? primary 'Lidholm, J.' 8 ? primary 'Liedl, K.R.' 9 ? primary 'Campo, P.' 10 ? primary 'Hawranek, T.' 11 ? primary 'Villalba, M.' 12 ? primary 'Brandstetter, H.' 13 ? primary 'Ferreira, F.' 14 ? primary 'Gadermaier, G.' 15 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Major pollen allergen Pla l 1' 14545.487 1 ? ? ? 'N-terminal residues 1-6 were not clearly defined in the electron density' 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 66 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETDQDGVYRLPVVGYHEDCEIKLVK SSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFRAKTDAPGC ; _entity_poly.pdbx_seq_one_letter_code_can ;TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETDQDGVYRLPVVGYHEDCEIKLVK SSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFRAKTDAPGC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 GLN n 1 3 THR n 1 4 SER n 1 5 HIS n 1 6 PRO n 1 7 ALA n 1 8 LYS n 1 9 PHE n 1 10 HIS n 1 11 VAL n 1 12 GLU n 1 13 GLY n 1 14 GLU n 1 15 VAL n 1 16 TYR n 1 17 CYS n 1 18 ASN n 1 19 VAL n 1 20 CYS n 1 21 HIS n 1 22 SER n 1 23 ARG n 1 24 ASN n 1 25 LEU n 1 26 ILE n 1 27 ASN n 1 28 GLU n 1 29 LEU n 1 30 SER n 1 31 GLU n 1 32 ARG n 1 33 MET n 1 34 ALA n 1 35 GLY n 1 36 ALA n 1 37 GLN n 1 38 VAL n 1 39 GLN n 1 40 LEU n 1 41 ASP n 1 42 CYS n 1 43 LYS n 1 44 ASP n 1 45 ASP n 1 46 SER n 1 47 LYS n 1 48 LYS n 1 49 VAL n 1 50 ILE n 1 51 TYR n 1 52 SER n 1 53 ILE n 1 54 GLY n 1 55 GLY n 1 56 GLU n 1 57 THR n 1 58 ASP n 1 59 GLN n 1 60 ASP n 1 61 GLY n 1 62 VAL n 1 63 TYR n 1 64 ARG n 1 65 LEU n 1 66 PRO n 1 67 VAL n 1 68 VAL n 1 69 GLY n 1 70 TYR n 1 71 HIS n 1 72 GLU n 1 73 ASP n 1 74 CYS n 1 75 GLU n 1 76 ILE n 1 77 LYS n 1 78 LEU n 1 79 VAL n 1 80 LYS n 1 81 SER n 1 82 SER n 1 83 ARG n 1 84 PRO n 1 85 ASP n 1 86 CYS n 1 87 SER n 1 88 GLU n 1 89 ILE n 1 90 PRO n 1 91 LYS n 1 92 LEU n 1 93 ALA n 1 94 LYS n 1 95 GLY n 1 96 THR n 1 97 ILE n 1 98 GLN n 1 99 THR n 1 100 SER n 1 101 LYS n 1 102 VAL n 1 103 ASP n 1 104 LEU n 1 105 SER n 1 106 LYS n 1 107 ASN n 1 108 THR n 1 109 THR n 1 110 ILE n 1 111 THR n 1 112 GLU n 1 113 LYS n 1 114 THR n 1 115 ARG n 1 116 HIS n 1 117 VAL n 1 118 LYS n 1 119 PRO n 1 120 LEU n 1 121 SER n 1 122 PHE n 1 123 ARG n 1 124 ALA n 1 125 LYS n 1 126 THR n 1 127 ASP n 1 128 ALA n 1 129 PRO n 1 130 GLY n 1 131 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 131 _entity_src_gen.gene_src_common_name 'English plantain' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plantago lanceolata' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 39414 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant 'Rosetta-gami B pLysS' _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 ? ? ? A . n A 1 2 GLN 2 2 ? ? ? A . n A 1 3 THR 3 3 ? ? ? A . n A 1 4 SER 4 4 ? ? ? A . n A 1 5 HIS 5 5 ? ? ? A . n A 1 6 PRO 6 6 ? ? ? A . n A 1 7 ALA 7 7 7 ALA ALA A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 PHE 9 9 9 PHE PHE A . n A 1 10 HIS 10 10 10 HIS HIS A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 VAL 15 15 15 VAL VAL A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 CYS 17 17 17 CYS CYS A . n A 1 18 ASN 18 18 18 ASN ASN A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 CYS 20 20 20 CYS CYS A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 ARG 23 23 23 ARG ARG A . n A 1 24 ASN 24 24 24 ASN ASN A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 ILE 26 26 26 ILE ILE A . n A 1 27 ASN 27 27 27 ASN ASN A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 MET 33 33 33 MET MET A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 GLN 37 37 37 GLN GLN A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 SER 46 46 46 SER SER A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 VAL 49 49 49 VAL VAL A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 TYR 51 51 51 TYR TYR A . n A 1 52 SER 52 52 52 SER SER A . n A 1 53 ILE 53 53 53 ILE ILE A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 THR 57 57 57 THR THR A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 GLN 59 59 59 GLN GLN A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLY 61 61 61 GLY GLY A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 VAL 67 67 67 VAL VAL A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 GLU 72 72 72 GLU GLU A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 CYS 74 74 74 CYS CYS A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 LYS 80 80 80 LYS LYS A . n A 1 81 SER 81 81 81 SER SER A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 ASP 85 85 85 ASP ASP A . n A 1 86 CYS 86 86 86 CYS CYS A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLU 88 88 88 GLU GLU A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 PRO 90 90 90 PRO PRO A . n A 1 91 LYS 91 91 91 LYS LYS A . n A 1 92 LEU 92 92 92 LEU LEU A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 LYS 94 94 94 LYS LYS A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 GLN 98 98 98 GLN GLN A . n A 1 99 THR 99 99 99 THR THR A . n A 1 100 SER 100 100 100 SER SER A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 VAL 102 102 102 VAL VAL A . n A 1 103 ASP 103 103 103 ASP ASP A . n A 1 104 LEU 104 104 104 LEU LEU A . n A 1 105 SER 105 105 105 SER SER A . n A 1 106 LYS 106 106 106 LYS LYS A . n A 1 107 ASN 107 107 107 ASN ASN A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 THR 109 109 109 THR THR A . n A 1 110 ILE 110 110 110 ILE ILE A . n A 1 111 THR 111 111 111 THR THR A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 LYS 113 113 113 LYS LYS A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 HIS 116 116 116 HIS HIS A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 PRO 119 119 119 PRO PRO A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 ARG 123 123 123 ARG ARG A . n A 1 124 ALA 124 124 124 ALA ALA A . n A 1 125 LYS 125 125 125 LYS LYS A . n A 1 126 THR 126 126 126 THR THR A . n A 1 127 ASP 127 127 127 ASP ASP A . n A 1 128 ALA 128 128 128 ALA ALA A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 GLY 130 130 130 GLY GLY A . n A 1 131 CYS 131 131 131 CYS CYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 201 1 ZN ZN A . C 3 HOH 1 301 22 HOH HOH A . C 3 HOH 2 302 11 HOH HOH A . C 3 HOH 3 303 32 HOH HOH A . C 3 HOH 4 304 40 HOH HOH A . C 3 HOH 5 305 28 HOH HOH A . C 3 HOH 6 306 9 HOH HOH A . C 3 HOH 7 307 17 HOH HOH A . C 3 HOH 8 308 38 HOH HOH A . C 3 HOH 9 309 4 HOH HOH A . C 3 HOH 10 310 57 HOH HOH A . C 3 HOH 11 311 10 HOH HOH A . C 3 HOH 12 312 44 HOH HOH A . C 3 HOH 13 313 39 HOH HOH A . C 3 HOH 14 314 37 HOH HOH A . C 3 HOH 15 315 52 HOH HOH A . C 3 HOH 16 316 2 HOH HOH A . C 3 HOH 17 317 46 HOH HOH A . C 3 HOH 18 318 1 HOH HOH A . C 3 HOH 19 319 64 HOH HOH A . C 3 HOH 20 320 6 HOH HOH A . C 3 HOH 21 321 13 HOH HOH A . C 3 HOH 22 322 20 HOH HOH A . C 3 HOH 23 323 58 HOH HOH A . C 3 HOH 24 324 35 HOH HOH A . C 3 HOH 25 325 66 HOH HOH A . C 3 HOH 26 326 47 HOH HOH A . C 3 HOH 27 327 59 HOH HOH A . C 3 HOH 28 328 55 HOH HOH A . C 3 HOH 29 329 45 HOH HOH A . C 3 HOH 30 330 21 HOH HOH A . C 3 HOH 31 331 12 HOH HOH A . C 3 HOH 32 332 31 HOH HOH A . C 3 HOH 33 333 27 HOH HOH A . C 3 HOH 34 334 43 HOH HOH A . C 3 HOH 35 335 42 HOH HOH A . C 3 HOH 36 336 19 HOH HOH A . C 3 HOH 37 337 14 HOH HOH A . C 3 HOH 38 338 48 HOH HOH A . C 3 HOH 39 339 24 HOH HOH A . C 3 HOH 40 340 29 HOH HOH A . C 3 HOH 41 341 7 HOH HOH A . C 3 HOH 42 342 65 HOH HOH A . C 3 HOH 43 343 56 HOH HOH A . C 3 HOH 44 344 8 HOH HOH A . C 3 HOH 45 345 3 HOH HOH A . C 3 HOH 46 346 16 HOH HOH A . C 3 HOH 47 347 54 HOH HOH A . C 3 HOH 48 348 30 HOH HOH A . C 3 HOH 49 349 60 HOH HOH A . C 3 HOH 50 350 63 HOH HOH A . C 3 HOH 51 351 49 HOH HOH A . C 3 HOH 52 352 51 HOH HOH A . C 3 HOH 53 353 5 HOH HOH A . C 3 HOH 54 354 15 HOH HOH A . C 3 HOH 55 355 26 HOH HOH A . C 3 HOH 56 356 25 HOH HOH A . C 3 HOH 57 357 23 HOH HOH A . C 3 HOH 58 358 53 HOH HOH A . C 3 HOH 59 359 34 HOH HOH A . C 3 HOH 60 360 18 HOH HOH A . C 3 HOH 61 361 61 HOH HOH A . C 3 HOH 62 362 50 HOH HOH A . C 3 HOH 63 363 62 HOH HOH A . C 3 HOH 64 364 33 HOH HOH A . C 3 HOH 65 365 36 HOH HOH A . C 3 HOH 66 366 41 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.20 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELX ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0049 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 4Z8W _cell.details ? _cell.formula_units_Z ? _cell.length_a 49.640 _cell.length_a_esd ? _cell.length_b 49.640 _cell.length_b_esd ? _cell.length_c 130.090 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4Z8W _symmetry.cell_setting ? _symmetry.Int_Tables_number 96 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 43 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4Z8W _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.35 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '21% PEG550, 10 mM zinc sulfate, 100 mM MES sodium salt pH 5.7' _exptl_crystal_grow.pdbx_pH_range 5.5-6.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-10-08 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si (111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8726 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.8726 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-2 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4Z8W _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.98 _reflns.d_resolution_low 46.378 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 14300 _reflns.number_obs 12037 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 27.800 _reflns.pdbx_Rmerge_I_obs 0.065 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.067 _reflns.pdbx_netI_over_av_sigmaI 6.152 _reflns.pdbx_netI_over_sigmaI 34.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.076 _reflns.pdbx_Rpim_I_all 0.014 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 333679 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.980 2.03 ? 10.2 46301 ? ? 1687 ? 99.900 ? ? ? ? 0.339 ? ? ? ? ? ? ? ? 25.9 0.330 ? ? 10.700 ? 0.064 0 1 1 ? ? 2.090 2.220 ? 3.200 46370 ? ? 1616 ? 100.000 ? ? ? ? 0.226 ? ? ? ? ? ? ? ? 28.700 0.226 ? ? 15.000 ? 0.043 0 2 1 ? ? 2.220 2.370 ? 4.300 43640 ? ? 1527 ? 100.000 ? ? ? ? 0.172 ? ? ? ? ? ? ? ? 28.600 0.172 ? ? 19.200 ? 0.032 0 3 1 ? ? 2.370 2.560 ? 6.000 40371 ? ? 1414 ? 100.000 ? ? ? ? 0.120 ? ? ? ? ? ? ? ? 28.600 0.120 ? ? 24.900 ? 0.023 0 4 1 ? ? 2.560 2.800 ? 7.100 37668 ? ? 1329 ? 100.000 ? ? ? ? 0.097 ? ? ? ? ? ? ? ? 28.300 0.097 ? ? 30.700 ? 0.019 0 5 1 ? ? 2.800 3.130 ? 9.500 33865 ? ? 1205 ? 100.000 ? ? ? ? 0.069 ? ? ? ? ? ? ? ? 28.100 0.069 ? ? 40.200 ? 0.013 0 6 1 ? ? 3.130 3.620 ? 10.500 29933 ? ? 1079 ? 100.000 ? ? ? ? 0.057 ? ? ? ? ? ? ? ? 27.700 0.057 ? ? 51.300 ? 0.011 0 7 1 ? ? 3.620 4.430 ? 8.700 25594 ? ? 938 ? 100.000 ? ? ? ? 0.068 ? ? ? ? ? ? ? ? 27.300 0.068 ? ? 57.900 ? 0.013 0 8 1 ? ? 4.430 6.270 ? 10.200 19557 ? ? 749 ? 100.000 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 26.100 0.058 ? ? 56.800 ? 0.011 0 9 1 ? ? 6.270 33.889 ? 14.600 10380 ? ? 455 ? 97.900 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 22.800 0.042 ? ? 51.800 ? 0.009 0 10 1 ? ? # _refine.aniso_B[1][1] 1.7100 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] 1.7100 _refine.aniso_B[2][3] 0.0000 _refine.aniso_B[3][3] -3.4300 _refine.B_iso_max 88.390 _refine.B_iso_mean 35.1980 _refine.B_iso_min 18.700 _refine.correlation_coeff_Fo_to_Fc 0.9420 _refine.correlation_coeff_Fo_to_Fc_free 0.9310 _refine.details 'U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4Z8W _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.9800 _refine.ls_d_res_low 39.46 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 11378 _refine.ls_number_reflns_R_free 572 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.8200 _refine.ls_percent_reflns_R_free 4.8000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2183 _refine.ls_R_factor_R_free 0.2477 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2168 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.2601 _refine.ls_wR_factor_R_work 0.2217 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.1680 _refine.pdbx_overall_ESU_R_Free 0.1520 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.9370 _refine.overall_SU_ML 0.1130 _refine.overall_SU_R_Cruickshank_DPI 0.1679 _refine.overall_SU_R_free 0.1521 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8136 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.9800 _refine_hist.d_res_low 39.46 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 66 _refine_hist.number_atoms_total 1035 _refine_hist.pdbx_number_residues_total 125 _refine_hist.pdbx_B_iso_mean_ligand 30.27 _refine_hist.pdbx_B_iso_mean_solvent 38.11 _refine_hist.pdbx_number_atoms_protein 968 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.020 0.019 1012 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.873 1.974 1371 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 6.992 5.000 133 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.006 24.884 43 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.994 15.000 196 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.701 15.000 6 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.142 0.200 156 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.010 0.021 740 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 3.568 3.259 509 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.549 4.859 636 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 4.326 3.672 503 ? r_scbond_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.9820 _refine_ls_shell.d_res_low 2.0330 _refine_ls_shell.number_reflns_all 842 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 42 _refine_ls_shell.number_reflns_R_work 800 _refine_ls_shell.percent_reflns_obs 99.6400 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3090 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2310 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 4Z8W _struct.title 'Crystal Structure of the Major Plantain Pollen Allergen Pla l 1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4Z8W _struct_keywords.text 'Major plantain pollen allergen Ole e 1-like, allergen' _struct_keywords.pdbx_keywords ALLERGEN # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PLAL1_PLALA _struct_ref.pdbx_db_accession P82242 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TQTSHPAKFHVEGEVYCNVCHSRNLINELSERMAGAQVQLDCKDDSKKVIYSIGGETDQDGVYRLPVVGYHEDCEIKLVK SSRPDCSEIPKLAKGTIQTSKVDLSKNTTITEKTRHVKPLSFRAKTDAPGC ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4Z8W _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 131 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P82242 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 131 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 131 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 70 ? 1 MORE -19 ? 1 'SSA (A^2)' 7440 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 17 SG ? ? ? 1_555 A CYS 86 SG ? ? A CYS 17 A CYS 86 1_555 ? ? ? ? ? ? ? 2.026 ? ? disulf2 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 131 SG A ? A CYS 20 A CYS 131 1_555 ? ? ? ? ? ? ? 2.086 ? ? disulf3 disulf ? ? A CYS 20 SG ? ? ? 1_555 A CYS 131 SG B ? A CYS 20 A CYS 131 1_555 ? ? ? ? ? ? ? 2.042 ? ? disulf4 disulf ? ? A CYS 42 SG ? ? ? 1_555 A CYS 74 SG ? ? A CYS 42 A CYS 74 1_555 ? ? ? ? ? ? ? 2.200 ? ? metalc1 metalc ? ? A HIS 21 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 21 A ZN 201 4_575 ? ? ? ? ? ? ? 1.957 ? ? metalc2 metalc ? ? A ASP 45 OD1 ? ? ? 1_555 B ZN . ZN ? ? A ASP 45 A ZN 201 1_555 ? ? ? ? ? ? ? 1.954 ? ? metalc3 metalc ? ? A ASP 73 OD1 ? ? ? 1_555 B ZN . ZN ? ? A ASP 73 A ZN 201 1_555 ? ? ? ? ? ? ? 2.016 ? ? metalc4 metalc ? ? A ASP 73 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 73 A ZN 201 1_555 ? ? ? ? ? ? ? 2.670 ? ? metalc5 metalc ? ? A GLU 88 OE2 ? ? ? 1_555 B ZN . ZN ? ? A GLU 88 A ZN 201 4_575 ? ? ? ? ? ? ? 1.903 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 21 ? A HIS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 4_575 OD1 ? A ASP 45 ? A ASP 45 ? 1_555 122.4 ? 2 NE2 ? A HIS 21 ? A HIS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 4_575 OD1 ? A ASP 73 ? A ASP 73 ? 1_555 119.7 ? 3 OD1 ? A ASP 45 ? A ASP 45 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 4_575 OD1 ? A ASP 73 ? A ASP 73 ? 1_555 3.1 ? 4 NE2 ? A HIS 21 ? A HIS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 4_575 OD2 ? A ASP 73 ? A ASP 73 ? 1_555 123.0 ? 5 OD1 ? A ASP 45 ? A ASP 45 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 4_575 OD2 ? A ASP 73 ? A ASP 73 ? 1_555 3.0 ? 6 OD1 ? A ASP 73 ? A ASP 73 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 4_575 OD2 ? A ASP 73 ? A ASP 73 ? 1_555 3.7 ? 7 NE2 ? A HIS 21 ? A HIS 21 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 4_575 OE2 ? A GLU 88 ? A GLU 88 ? 1_555 103.6 ? 8 OD1 ? A ASP 45 ? A ASP 45 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 4_575 OE2 ? A GLU 88 ? A GLU 88 ? 1_555 76.7 ? 9 OD1 ? A ASP 73 ? A ASP 73 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 4_575 OE2 ? A GLU 88 ? A GLU 88 ? 1_555 75.6 ? 10 OD2 ? A ASP 73 ? A ASP 73 ? 1_555 ZN ? B ZN . ? A ZN 201 ? 4_575 OE2 ? A GLU 88 ? A GLU 88 ? 1_555 73.6 ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 CYS A 17 ? CYS A 86 ? CYS A 17 ? 1_555 CYS A 86 ? 1_555 SG SG . . . None 'Disulfide bridge' 2 CYS A 20 ? CYS A 131 A CYS A 20 ? 1_555 CYS A 131 ? 1_555 SG SG . . . None 'Disulfide bridge' 3 CYS A 20 ? CYS A 131 B CYS A 20 ? 1_555 CYS A 131 ? 1_555 SG SG . . . None 'Disulfide bridge' 4 CYS A 42 ? CYS A 74 ? CYS A 42 ? 1_555 CYS A 74 ? 1_555 SG SG . . . None 'Disulfide bridge' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 3 ? AA2 ? 3 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA2 1 2 ? anti-parallel AA2 2 3 ? parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 31 ? ARG A 32 ? GLU A 31 ARG A 32 AA1 2 LYS A 8 ? ASN A 18 ? LYS A 8 ASN A 18 AA1 3 THR A 114 ? HIS A 116 ? THR A 114 HIS A 116 AA2 1 VAL A 62 ? VAL A 68 ? VAL A 62 VAL A 68 AA2 2 LYS A 8 ? ASN A 18 ? LYS A 8 ASN A 18 AA2 3 LEU A 120 ? ARG A 123 ? LEU A 120 ARG A 123 AA3 1 TYR A 51 ? GLU A 56 ? TYR A 51 GLU A 56 AA3 2 GLN A 37 ? CYS A 42 ? GLN A 37 CYS A 42 AA3 3 CYS A 74 ? LYS A 80 ? CYS A 74 LYS A 80 AA3 4 SER A 100 ? VAL A 102 ? SER A 100 VAL A 102 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 31 ? O GLU A 31 N CYS A 17 ? N CYS A 17 AA1 2 3 N GLU A 12 ? N GLU A 12 O ARG A 115 ? O ARG A 115 AA2 1 2 O VAL A 67 ? O VAL A 67 N PHE A 9 ? N PHE A 9 AA2 2 3 N ASN A 18 ? N ASN A 18 O PHE A 122 ? O PHE A 122 AA3 1 2 O ILE A 53 ? O ILE A 53 N LEU A 40 ? N LEU A 40 AA3 2 3 N GLN A 37 ? N GLN A 37 O LYS A 80 ? O LYS A 80 AA3 3 4 N ILE A 76 ? N ILE A 76 O SER A 100 ? O SER A 100 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue ZN A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 HIS A 21 ? HIS A 21 . ? 3_744 ? 2 AC1 4 ASP A 45 ? ASP A 45 . ? 1_555 ? 3 AC1 4 ASP A 73 ? ASP A 73 . ? 1_555 ? 4 AC1 4 GLU A 88 ? GLU A 88 . ? 3_744 ? # _pdbx_entry_details.entry_id 4Z8W _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 58 ? ? -102.63 -160.49 2 1 VAL A 79 ? ? -122.37 -59.18 # loop_ _pdbx_phasing_MAD_set_site.id _pdbx_phasing_MAD_set_site.atom_type_symbol _pdbx_phasing_MAD_set_site.Cartn_x _pdbx_phasing_MAD_set_site.Cartn_y _pdbx_phasing_MAD_set_site.Cartn_z _pdbx_phasing_MAD_set_site.occupancy _pdbx_phasing_MAD_set_site.b_iso 1 CA 34.189 19.478 15.959 1.00 20.00 2 C 34.029 20.310 14.691 1.00 20.00 3 O 33.306 19.911 13.780 1.00 20.00 4 N 34.700 21.463 14.627 1.00 20.00 5 CA 34.619 22.335 13.460 1.00 20.00 6 CB 34.218 23.754 13.875 1.00 20.00 7 C 35.936 22.355 12.693 1.00 20.00 8 O 36.974 22.694 13.258 1.00 20.00 9 N 35.900 21.993 11.407 1.00 20.00 10 CA 37.102 21.976 10.581 1.00 20.00 11 CB 37.459 20.542 10.178 1.00 20.00 12 C 36.930 22.853 9.345 1.00 20.00 13 O 35.805 23.099 8.916 1.00 20.00 14 N 38.041 23.325 8.772 1.00 20.00 15 CA 37.990 24.173 7.586 1.00 20.00 16 CB 38.397 25.609 7.932 1.00 20.00 17 C 38.877 23.617 6.478 1.00 20.00 18 O 39.986 23.161 6.747 1.00 20.00 19 N 38.394 23.651 5.233 1.00 20.00 20 CA 39.159 23.145 4.099 1.00 20.00 21 CB 38.374 22.070 3.340 1.00 20.00 22 C 39.537 24.291 3.167 1.00 20.00 23 O 38.747 24.673 2.306 1.00 20.00 24 N 40.743 24.842 3.335 1.00 20.00 25 CA 41.205 25.944 2.498 1.00 20.00 26 CB 41.914 26.997 3.357 1.00 20.00 27 C 42.120 25.461 1.377 1.00 20.00 28 O 43.001 24.637 1.613 1.00 20.00 29 N 41.915 25.971 0.160 1.00 20.00 30 CA 42.732 25.578 -0.983 1.00 20.00 31 CB 41.911 24.759 -1.984 1.00 20.00 32 C 43.333 26.806 -1.660 1.00 20.00 33 O 42.701 27.859 -1.699 1.00 20.00 34 N 44.551 26.675 -2.192 1.00 20.00 35 CA 45.219 27.786 -2.862 1.00 20.00 36 CB 46.741 27.634 -2.777 1.00 20.00 37 C 44.771 27.890 -4.316 1.00 20.00 38 O 44.816 26.904 -5.047 1.00 20.00 39 N 44.338 29.082 -4.738 1.00 20.00 40 CA 43.887 29.292 -6.109 1.00 20.00 41 CA 57.880 18.369 -15.340 1.00 20.00 42 C 56.714 18.695 -14.412 1.00 20.00 43 O 56.115 19.762 -14.527 1.00 20.00 44 N 56.390 17.781 -13.494 1.00 20.00 45 CA 55.292 17.991 -12.557 1.00 20.00 46 CB 54.571 16.671 -12.266 1.00 20.00 47 C 55.807 18.626 -11.269 1.00 20.00 48 O 56.904 18.304 -10.819 1.00 20.00 49 N 55.019 19.528 -10.676 1.00 20.00 50 CA 55.415 20.196 -9.441 1.00 20.00 51 CB 54.893 21.634 -9.516 1.00 20.00 52 C 54.990 19.539 -8.131 1.00 20.00 53 O 53.870 19.045 -8.024 1.00 20.00 54 N 55.881 19.530 -7.136 1.00 20.00 55 CA 55.578 18.928 -5.842 1.00 20.00 56 CB 56.867 18.562 -5.099 1.00 20.00 57 C 54.720 19.864 -4.997 1.00 20.00 58 O 54.471 21.000 -5.396 1.00 20.00 59 N 54.267 19.393 -3.832 1.00 20.00 60 CA 53.438 20.204 -2.947 1.00 20.00 61 CB 52.331 19.347 -2.326 1.00 20.00 62 C 54.267 20.880 -1.860 1.00 20.00 63 O 53.844 21.888 -1.299 1.00 20.00 64 N 55.447 20.329 -1.560 1.00 20.00 65 CA 56.319 20.894 -0.536 1.00 20.00 66 CB 56.656 19.852 0.535 1.00 20.00 67 C 57.593 21.442 -1.171 1.00 20.00 68 O 57.769 21.344 -2.383 1.00 20.00 69 N 58.481 22.020 -0.356 1.00 20.00 70 CA 59.732 22.577 -0.859 1.00 20.00 71 CB 59.801 24.088 -0.618 1.00 20.00 72 C 60.915 21.874 -0.200 1.00 20.00 73 O 61.181 22.090 0.980 1.00 20.00 74 N 61.625 21.034 -0.958 1.00 20.00 75 CA 62.775 20.310 -0.429 1.00 20.00 76 CB 63.315 19.318 -1.464 1.00 20.00 77 C 63.870 21.278 0.008 1.00 20.00 78 O 64.000 22.359 -0.563 1.00 20.00 79 N 64.656 20.896 1.018 1.00 20.00 80 CA 65.733 21.746 1.515 1.00 20.00 81 CB 66.535 21.010 2.593 1.00 20.00 82 C 66.649 22.208 0.387 1.00 20.00 83 O 66.949 21.435 -0.520 1.00 20.00 84 N 67.096 23.466 0.439 1.00 20.00 85 CA 67.977 24.010 -0.588 1.00 20.00 86 CA 43.237 19.401 9.034 1.00 20.00 87 C 44.565 19.029 8.384 1.00 20.00 88 O 45.480 19.848 8.338 1.00 20.00 89 N 44.675 17.796 7.882 1.00 20.00 90 CA 45.901 17.336 7.239 1.00 20.00 91 CB 46.076 15.826 7.430 1.00 20.00 92 C 45.899 17.697 5.757 1.00 20.00 93 O 45.005 18.404 5.297 1.00 20.00 94 N 46.896 17.215 5.010 1.00 20.00 95 CA 46.990 17.500 3.582 1.00 20.00 96 CB 48.430 17.320 3.090 1.00 20.00 97 C 46.023 16.597 2.824 1.00 20.00 98 O 45.821 15.447 3.209 1.00 20.00 99 N 45.423 17.112 1.747 1.00 20.00 100 CA 44.480 16.336 0.949 1.00 20.00 101 CB 43.050 16.840 1.163 1.00 20.00 102 C 44.860 16.389 -0.527 1.00 20.00 103 O 45.118 17.466 -1.059 1.00 20.00 104 N 44.895 15.230 -1.191 1.00 20.00 105 CA 45.246 15.167 -2.606 1.00 20.00 106 CB 46.020 13.881 -2.912 1.00 20.00 107 C 43.977 15.269 -3.445 1.00 20.00 108 O 43.248 14.290 -3.583 1.00 20.00 109 N 43.711 16.452 -4.007 1.00 20.00 110 CA 42.524 16.660 -4.830 1.00 20.00 111 CB 41.655 17.779 -4.249 1.00 20.00 112 C 42.920 16.971 -6.269 1.00 20.00 113 O 42.096 17.448 -7.046 1.00 20.00 114 N 44.179 16.704 -6.628 1.00 20.00 115 CA 44.663 16.964 -7.979 1.00 20.00 116 CB 46.185 16.799 -8.048 1.00 20.00 117 C 43.975 16.047 -8.986 1.00 20.00 118 O 43.588 14.933 -8.641 1.00 20.00 119 N 43.822 16.511 -10.229 1.00 20.00 120 CA 43.178 15.717 -11.270 1.00 20.00 121 CB 42.168 16.567 -12.049 1.00 20.00 122 C 44.211 15.112 -12.214 1.00 20.00 123 O 43.847 14.464 -13.193 1.00 20.00 124 N 45.499 15.321 -11.925 1.00 20.00 125 CA 46.569 14.787 -12.761 1.00 20.00 126 CB 47.731 15.782 -12.850 1.00 20.00 127 C 47.074 13.440 -12.255 1.00 20.00 128 O 48.257 13.135 -12.389 1.00 20.00 129 N 46.182 12.631 -11.676 1.00 20.00 130 CA 46.558 11.320 -11.158 1.00 20.00 131 CB 46.507 11.311 -9.626 1.00 20.00 132 C 45.697 10.181 -11.693 1.00 20.00 133 O 44.720 10.425 -12.397 1.00 20.00 134 N 46.056 8.937 -11.363 1.00 20.00 135 CA 45.303 7.775 -11.821 1.00 20.00 136 CB 46.251 6.625 -12.177 1.00 20.00 137 C 44.300 7.352 -10.753 1.00 20.00 138 O 43.772 6.244 -10.807 1.00 20.00 139 N 44.035 8.230 -9.782 1.00 20.00 140 CA 43.092 7.928 -8.711 1.00 20.00 141 CB 43.361 8.813 -7.489 1.00 20.00 142 C 41.653 8.095 -9.187 1.00 20.00 143 O 41.326 9.094 -9.824 1.00 20.00 144 N 40.791 7.121 -8.881 1.00 20.00 145 CA 39.391 7.180 -9.287 1.00 20.00 146 CB 39.018 5.946 -10.114 1.00 20.00 147 C 38.442 7.311 -8.100 1.00 20.00 148 O 37.287 7.694 -8.274 1.00 20.00 149 N 38.924 6.995 -6.895 1.00 20.00 150 CA 38.102 7.084 -5.693 1.00 20.00 151 CB 38.890 6.618 -4.465 1.00 20.00 152 C 37.586 8.505 -5.494 1.00 20.00 153 O 38.377 9.442 -5.403 1.00 20.00 154 N 36.262 8.670 -5.427 1.00 20.00 155 CA 35.661 9.987 -5.238 1.00 20.00 156 CB 34.215 9.997 -5.743 1.00 20.00 157 C 35.722 10.410 -3.775 1.00 20.00 158 O 35.192 11.459 -3.414 1.00 20.00 159 N 36.366 9.600 -2.930 1.00 20.00 160 CA 36.484 9.910 -1.509 1.00 20.00 161 CB 35.659 8.926 -0.673 1.00 20.00 162 C 37.943 9.898 -1.066 1.00 20.00 163 O 38.640 8.905 -1.266 1.00 20.00 164 N 38.409 10.997 -0.466 1.00 20.00 165 CA 39.789 11.092 -0.003 1.00 20.00 166 CB 40.465 12.341 -0.578 1.00 20.00 167 C 39.698 11.088 1.519 1.00 20.00 168 O 38.821 11.738 2.086 1.00 20.00 169 N 40.599 10.360 2.183 1.00 20.00 170 CA 40.603 10.286 3.640 1.00 20.00 171 CA 34.075 19.292 -2.667 1.00 20.00 172 C 33.687 19.376 -4.140 1.00 20.00 173 O 33.205 18.398 -4.707 1.00 20.00 174 N 33.896 20.540 -4.761 1.00 20.00 175 CA 33.561 20.729 -6.168 1.00 20.00 176 CB 32.520 21.846 -6.292 1.00 20.00 177 C 34.771 21.023 -7.049 1.00 20.00 178 O 35.544 21.930 -6.751 1.00 20.00 179 N 34.937 20.259 -8.133 1.00 20.00 180 CA 36.060 20.454 -9.043 1.00 20.00 181 CB 36.122 21.913 -9.507 1.00 20.00 182 C 37.379 20.040 -8.400 1.00 20.00 183 O 37.443 19.862 -7.185 1.00 20.00 184 N 38.431 19.884 -9.208 1.00 20.00 185 CA 39.739 19.490 -8.697 1.00 20.00 186 CB 40.644 18.870 -9.767 1.00 20.00 187 C 40.371 20.756 -8.128 1.00 20.00 188 O 39.875 21.854 -8.369 1.00 20.00 189 N 41.463 20.607 -7.373 1.00 20.00 190 CA 42.146 21.751 -6.779 1.00 20.00 191 CB 41.339 22.309 -5.602 1.00 20.00 192 C 43.555 21.376 -6.334 1.00 20.00 193 O 43.911 20.199 -6.339 1.00 20.00 194 N 44.359 22.371 -5.948 1.00 20.00 195 CA 45.727 22.123 -5.503 1.00 20.00 196 CB 46.749 22.486 -6.585 1.00 20.00 197 C 45.986 22.922 -4.231 1.00 20.00 198 O 45.275 23.885 -3.952 1.00 20.00 199 N 47.001 22.526 -3.458 1.00 20.00 200 CA 47.336 23.219 -2.218 1.00 20.00 201 CB 47.800 24.655 -2.484 1.00 20.00 202 C 46.124 23.210 -1.294 1.00 20.00 203 O 45.687 24.265 -0.838 1.00 20.00 204 N 45.578 22.023 -1.014 1.00 20.00 205 CA 44.416 21.899 -0.141 1.00 20.00 206 CB 43.321 21.029 -0.766 1.00 20.00 207 C 44.832 21.404 1.107 1.00 20.00 208 O 45.483 20.367 1.207 1.00 20.00 209 N 44.457 22.126 2.166 1.00 20.00 210 CA 44.799 21.726 3.527 1.00 20.00 211 CB 45.927 22.604 4.079 1.00 20.00 212 C 43.564 21.792 4.418 1.00 20.00 213 O 42.707 22.651 4.221 1.00 20.00 214 N 43.469 20.889 5.398 1.00 20.00 215 CA 42.329 20.862 6.308 1.00 20.00 216 CB 41.617 19.506 6.328 1.00 20.00 217 C 42.859 21.210 7.695 1.00 20.00 218 O 43.722 20.510 8.219 1.00 20.00 219 N 42.346 22.290 8.292 1.00 20.00 220 CA 42.781 22.713 9.619 1.00 20.00 221 CB 43.340 24.138 9.565 1.00 20.00 222 C 41.651 22.618 10.638 1.00 20.00 223 O 40.481 22.620 10.262 1.00 20.00 224 N 41.995 22.534 11.926 1.00 20.00 225 CA 40.994 22.439 12.983 1.00 20.00 226 CB 41.596 21.785 14.230 1.00 20.00 227 C 40.410 23.806 13.322 1.00 20.00 228 O 41.153 24.774 13.472 1.00 20.00 229 N 39.082 23.890 13.445 1.00 20.00 230 CA 38.420 25.149 13.768 1.00 20.00 231 CB 36.898 24.978 13.752 1.00 20.00 232 C 38.887 25.680 15.119 1.00 20.00 233 O 38.107 25.718 16.069 1.00 20.00 234 N 40.155 26.089 15.209 1.00 20.00 235 CA 40.705 26.614 16.455 1.00 20.00 236 CA 32.741 16.877 1.210 1.00 20.00 237 C 33.847 15.982 0.660 1.00 20.00 238 O 35.025 16.306 0.790 1.00 20.00 239 N 33.472 14.856 0.045 1.00 20.00 240 CA 34.447 13.928 -0.517 1.00 20.00 241 CB 34.921 14.412 -1.891 1.00 20.00 242 C 35.615 13.769 0.450 1.00 20.00 243 O 36.087 12.655 0.668 1.00 20.00 244 N 36.083 14.877 1.031 1.00 20.00 245 CA 37.197 14.838 1.972 1.00 20.00 246 CB 37.783 16.239 2.173 1.00 20.00 247 C 36.755 14.240 3.304 1.00 20.00 248 O 36.117 14.921 4.103 1.00 20.00 249 N 37.092 12.970 3.545 1.00 20.00 250 CA 36.720 12.301 4.787 1.00 20.00 251 CB 36.113 10.924 4.497 1.00 20.00 252 C 37.915 12.169 5.725 1.00 20.00 253 O 38.960 11.662 5.323 1.00 20.00 254 N 37.766 12.623 6.972 1.00 20.00 255 CA 38.846 12.547 7.950 1.00 20.00 256 CB 39.788 13.746 7.809 1.00 20.00 257 C 38.293 12.463 9.369 1.00 20.00 258 O 37.161 12.875 9.615 1.00 20.00 259 N 39.086 11.931 10.303 1.00 20.00 260 CA 38.656 11.803 11.692 1.00 20.00 261 CB 38.997 10.412 12.236 1.00 20.00 262 C 39.290 12.892 12.551 1.00 20.00 263 O 40.452 13.239 12.348 1.00 20.00 264 N 38.533 13.432 13.510 1.00 20.00 265 CA 39.040 14.480 14.389 1.00 20.00 266 CB 38.297 15.797 14.143 1.00 20.00 267 C 38.929 14.067 15.852 1.00 20.00 268 O 37.870 13.621 16.288 1.00 20.00 269 N 40.018 14.212 16.612 1.00 20.00 270 CA 40.021 13.847 18.025 1.00 20.00 271 CA 47.454 12.039 22.509 1.00 20.00 272 C 46.703 13.299 22.926 1.00 20.00 273 O 47.276 14.170 23.576 1.00 20.00 274 N 45.423 13.398 22.555 1.00 20.00 275 CA 44.613 14.561 22.902 1.00 20.00 276 CB 43.248 14.491 22.210 1.00 20.00 277 C 44.410 14.729 24.404 1.00 20.00 278 O 44.454 15.847 24.911 1.00 20.00 279 N 44.189 13.621 25.118 1.00 20.00 280 CA 43.982 13.668 26.561 1.00 20.00 281 CB 43.246 12.413 27.040 1.00 20.00 282 C 45.306 13.829 27.301 1.00 20.00 283 O 45.313 14.088 28.502 1.00 20.00 284 N 46.426 13.675 26.588 1.00 20.00 285 CA 47.745 13.807 27.197 1.00 20.00 286 CB 48.665 12.652 26.788 1.00 20.00 287 C 48.360 15.147 26.804 1.00 20.00 288 O 49.039 15.238 25.784 1.00 20.00 289 N 48.124 16.186 27.609 1.00 20.00 290 CA 48.663 17.512 27.328 1.00 20.00 291 CB 48.277 18.495 28.438 1.00 20.00 292 C 50.177 17.467 27.154 1.00 20.00 293 O 50.727 18.209 26.343 1.00 20.00 294 N 50.853 16.599 27.912 1.00 20.00 295 CA 52.304 16.474 27.826 1.00 20.00 296 CB 52.818 15.448 28.842 1.00 20.00 297 C 52.738 16.095 26.414 1.00 20.00 298 O 53.893 16.303 26.047 1.00 20.00 299 N 51.818 15.539 25.621 1.00 20.00 300 CA 52.127 15.138 24.253 1.00 20.00 301 CB 52.066 13.608 24.262 1.00 20.00 302 C 51.332 15.700 23.078 1.00 20.00 303 O 50.421 16.501 23.277 1.00 20.00 304 N 51.673 15.284 21.855 1.00 20.00 305 CA 50.978 15.757 20.663 1.00 20.00 306 CB 51.762 16.905 20.018 1.00 20.00 307 C 50.746 14.635 19.657 1.00 20.00 308 O 51.502 14.500 18.698 1.00 20.00 309 N 49.701 13.830 19.872 1.00 20.00 310 CA 49.387 12.725 18.972 1.00 20.00 311 CB 50.585 11.772 18.905 1.00 20.00 312 C 48.121 11.969 19.358 1.00 20.00 313 O 47.552 12.221 20.418 1.00 20.00 314 N 47.677 11.043 18.503 1.00 20.00 315 CA 46.475 10.262 18.775 1.00 20.00 316 CB 45.537 10.124 17.571 1.00 20.00 317 C 46.995 8.895 19.209 1.00 20.00 318 O 47.838 8.312 18.531 1.00 20.00 319 N 46.495 8.382 20.337 1.00 20.00 320 CA 46.922 7.082 20.843 1.00 20.00 321 CB 47.946 7.250 21.970 1.00 20.00 322 C 45.725 6.268 21.323 1.00 20.00 323 O 44.588 6.584 20.981 1.00 20.00 324 N 45.976 5.221 22.113 1.00 20.00 325 CA 44.905 4.374 22.628 1.00 20.00 326 CB 45.488 3.127 23.299 1.00 20.00 327 C 44.009 5.137 23.599 1.00 20.00 328 O 42.887 4.712 23.865 1.00 20.00 329 N 44.500 6.260 24.129 1.00 20.00 330 CA 43.728 7.066 25.068 1.00 20.00 331 CB 44.662 7.668 26.123 1.00 20.00 332 C 42.922 8.161 24.377 1.00 20.00 333 O 42.051 8.769 24.996 1.00 20.00 334 N 43.208 8.415 23.097 1.00 20.00 335 CA 42.499 9.442 22.342 1.00 20.00 336 CB 43.015 9.509 20.901 1.00 20.00 337 C 40.995 9.186 22.361 1.00 20.00 338 O 40.567 8.037 22.441 1.00 20.00 339 N 40.193 10.252 22.289 1.00 20.00 340 CA 38.740 10.120 22.300 1.00 20.00 341 CB 38.156 10.635 23.619 1.00 20.00 342 C 38.127 10.861 21.116 1.00 20.00 343 O 38.390 12.046 20.928 1.00 20.00 344 N 37.310 10.167 20.319 1.00 20.00 345 CA 36.669 10.777 19.159 1.00 20.00 346 CB 35.807 9.757 18.409 1.00 20.00 347 C 35.831 11.978 19.587 1.00 20.00 348 O 35.035 11.873 20.517 1.00 20.00 349 N 36.007 13.117 18.911 1.00 20.00 350 CA 35.256 14.325 19.237 1.00 20.00 351 CB 36.202 15.527 19.328 1.00 20.00 352 C 34.148 14.590 18.224 1.00 20.00 353 O 34.410 14.655 17.026 1.00 20.00 354 N 32.909 14.742 18.701 1.00 20.00 355 CA 31.775 14.999 17.820 1.00 20.00 356 CB 30.557 14.177 18.254 1.00 20.00 357 C 31.435 16.485 17.788 1.00 20.00 358 O 31.675 17.193 18.764 1.00 20.00 359 N 30.878 16.961 16.671 1.00 20.00 360 CA 30.514 18.367 16.535 1.00 20.00 361 CB 29.334 18.695 17.455 1.00 20.00 362 C 31.691 19.294 16.821 1.00 20.00 363 O 32.823 18.985 16.455 1.00 20.00 364 N 31.429 20.431 17.473 1.00 20.00 365 CA 32.480 21.389 17.797 1.00 20.00 366 CA 46.971 31.795 -6.746 1.00 20.00 367 C 47.882 31.621 -5.535 1.00 20.00 368 O 48.372 30.522 -5.286 1.00 20.00 369 N 48.111 32.700 -4.782 1.00 20.00 370 CA 48.966 32.645 -3.601 1.00 20.00 371 CB 50.065 33.709 -3.681 1.00 20.00 372 C 48.170 32.810 -2.312 1.00 20.00 373 O 48.753 33.006 -1.248 1.00 20.00 374 N 46.839 32.733 -2.401 1.00 20.00 375 CA 45.982 32.877 -1.230 1.00 20.00 376 CB 45.465 34.314 -1.113 1.00 20.00 377 C 44.861 31.853 -1.379 1.00 20.00 378 O 44.728 31.234 -2.432 1.00 20.00 379 N 44.055 31.673 -0.328 1.00 20.00 380 CA 42.952 30.719 -0.363 1.00 20.00 381 CB 42.331 30.562 1.028 1.00 20.00 382 C 41.886 31.131 -1.374 1.00 20.00 383 O 41.440 32.276 -1.367 1.00 20.00 384 N 41.478 30.202 -2.243 1.00 20.00 385 CA 40.464 30.489 -3.252 1.00 20.00 386 CB 41.024 30.261 -4.660 1.00 20.00 387 C 39.214 29.644 -3.030 1.00 20.00 388 O 38.105 30.102 -3.296 1.00 20.00 389 N 39.388 28.411 -2.545 1.00 20.00 390 CA 38.261 27.519 -2.295 1.00 20.00 391 CB 38.346 26.280 -3.193 1.00 20.00 392 C 38.324 27.201 -0.805 1.00 20.00 393 O 39.374 26.808 -0.303 1.00 20.00 394 N 37.204 27.369 -0.097 1.00 20.00 395 CA 37.153 27.094 1.335 1.00 20.00 396 CB 37.324 28.387 2.138 1.00 20.00 397 C 35.871 26.395 1.773 1.00 20.00 398 O 34.782 26.937 1.596 1.00 20.00 399 N 35.995 25.193 2.343 1.00 20.00 400 CA 34.833 24.437 2.799 1.00 20.00 401 CB 34.716 23.115 2.035 1.00 20.00 402 C 34.952 24.214 4.303 1.00 20.00 403 O 35.991 23.759 4.778 1.00 20.00 404 N 33.894 24.532 5.054 1.00 20.00 405 CA 33.902 24.358 6.502 1.00 20.00 406 CB 33.778 25.703 7.225 1.00 20.00 407 C 32.770 23.422 6.913 1.00 20.00 408 O 31.657 23.541 6.405 1.00 20.00 409 N 33.049 22.492 7.830 1.00 20.00 410 CA 32.040 21.546 8.294 1.00 20.00 411 CB 31.965 20.334 7.360 1.00 20.00 412 C 32.328 21.103 9.725 1.00 20.00 413 O 33.333 21.508 10.305 1.00 20.00 414 N 31.450 20.274 10.296 1.00 20.00 415 CA 31.629 19.789 11.661 1.00 20.00 416 CB 30.490 20.284 12.557 1.00 20.00 417 C 31.721 18.267 11.702 1.00 20.00 418 O 31.236 17.596 10.794 1.00 20.00 419 N 32.342 17.722 12.751 1.00 20.00 420 CA 32.487 16.276 12.890 1.00 20.00 421 CB 33.650 15.966 13.838 1.00 20.00 422 C 31.209 15.596 13.368 1.00 20.00 423 O 30.372 16.232 14.004 1.00 20.00 424 N 31.055 14.304 13.065 1.00 20.00 425 CA 29.870 13.556 13.473 1.00 20.00 426 CB 29.516 12.559 12.365 1.00 20.00 427 C 29.999 12.843 14.815 1.00 20.00 428 O 30.813 13.238 15.647 1.00 20.00 429 N 29.200 11.794 15.028 1.00 20.00 430 CA 29.241 11.041 16.277 1.00 20.00 431 CB 28.518 9.690 16.279 1.00 20.00 432 C 30.747 10.843 16.417 1.00 20.00 433 O 31.300 9.901 15.854 1.00 20.00 434 N 31.411 11.728 17.165 1.00 20.00 435 CA 32.854 11.633 17.365 1.00 20.00 436 CA 38.138 19.076 20.734 1.00 20.00 437 C 37.578 20.494 20.749 1.00 20.00 438 O 37.653 21.176 21.769 1.00 20.00 439 N 37.018 20.942 19.622 1.00 20.00 440 CA 36.452 22.283 19.527 1.00 20.00 441 CB 36.195 22.658 18.064 1.00 20.00 442 C 35.166 22.409 20.338 1.00 20.00 443 O 34.920 23.448 20.945 1.00 20.00 444 N 34.346 21.354 20.350 1.00 20.00 445 CA 33.091 21.368 21.093 1.00 20.00 446 CB 32.047 20.483 20.404 1.00 20.00 447 C 33.325 20.918 22.531 1.00 20.00 448 O 32.452 21.084 23.379 1.00 20.00 449 N 34.502 20.349 22.809 1.00 20.00 450 CA 34.830 19.882 24.152 1.00 20.00 451 CB 35.878 18.767 24.094 1.00 20.00 452 C 35.327 20.978 25.089 1.00 20.00 453 O 36.256 21.706 24.748 1.00 20.00 454 N 34.711 21.098 26.269 1.00 20.00 455 CA 35.107 22.112 27.240 1.00 20.00 456 CB 33.997 22.473 28.232 1.00 20.00 457 C 36.313 21.532 27.971 1.00 20.00 458 O 36.153 20.689 28.850 1.00 20.00 459 N 37.519 21.980 27.611 1.00 20.00 460 CA 38.739 21.492 28.245 1.00 20.00 461 CB 38.405 20.637 29.472 1.00 20.00 462 C 39.589 20.702 27.256 1.00 20.00 463 O 40.572 20.078 27.648 1.00 20.00 464 N 39.214 20.727 25.973 1.00 20.00 465 CA 39.956 20.007 24.944 1.00 20.00 466 CB 39.381 18.603 24.733 1.00 20.00 467 C 39.944 20.793 23.637 1.00 20.00 468 O 39.619 20.241 22.589 1.00 20.00 469 N 40.298 22.080 23.696 1.00 20.00 470 CA 40.321 22.924 22.506 1.00 20.00 471 CB 39.318 24.070 22.673 1.00 20.00 472 C 41.709 23.468 22.186 1.00 20.00 473 O 41.832 24.473 21.489 1.00 20.00 474 N 42.755 22.808 22.692 1.00 20.00 475 CA 44.126 23.242 22.447 1.00 20.00 476 CB 45.069 22.743 23.547 1.00 20.00 477 C 44.590 22.754 21.079 1.00 20.00 478 O 44.410 21.584 20.749 1.00 20.00 479 N 45.188 23.645 20.283 1.00 20.00 480 CA 45.670 23.283 18.954 1.00 20.00 481 CB 45.396 24.379 17.920 1.00 20.00 482 C 47.166 23.004 19.057 1.00 20.00 483 O 47.975 23.917 18.905 1.00 20.00 484 N 47.536 21.747 19.315 1.00 20.00 485 CA 48.941 21.371 19.433 1.00 20.00 486 CB 49.141 19.862 19.258 1.00 20.00 487 C 49.703 22.103 18.520 1.00 20.00 488 O 49.284 22.396 17.402 1.00 20.00 489 N 50.890 22.513 18.975 1.00 20.00 490 CA 51.776 23.345 18.167 1.00 20.00 491 CB 52.250 24.565 18.964 1.00 20.00 492 C 52.967 22.536 17.664 1.00 20.00 493 O 53.690 21.942 18.461 1.00 20.00 494 N 53.174 22.511 16.344 1.00 20.00 495 CA 54.284 21.768 15.757 1.00 20.00 496 CB 54.315 21.959 14.237 1.00 20.00 497 C 55.612 22.188 16.377 1.00 20.00 498 O 55.904 23.379 16.461 1.00 20.00 499 N 56.418 21.215 16.812 1.00 20.00 500 CA 57.711 21.506 17.422 1.00 20.00 501 CB 58.114 20.387 18.387 1.00 20.00 502 C 58.786 21.712 16.360 1.00 20.00 503 O 59.113 20.782 15.626 1.00 20.00 504 N 59.336 22.926 16.275 1.00 20.00 505 CA 60.372 23.232 15.295 1.00 20.00 506 CB 59.767 23.396 13.897 1.00 20.00 507 C 61.142 24.485 15.697 1.00 20.00 508 O 60.768 25.157 16.655 1.00 20.00 509 N 62.217 24.801 14.968 1.00 20.00 510 CA 63.025 25.979 15.266 1.00 20.00 511 CB 64.270 25.590 16.070 1.00 20.00 512 C 63.419 26.708 13.986 1.00 20.00 513 O 64.490 27.307 13.922 1.00 20.00 514 N 62.557 26.659 12.966 1.00 20.00 515 CA 62.835 27.321 11.696 1.00 20.00 516 CB 61.576 28.040 11.199 1.00 20.00 517 C 64.006 28.293 11.790 1.00 20.00 518 O 63.858 29.385 12.334 1.00 20.00 519 N 65.169 27.900 11.264 1.00 20.00 520 CA 66.354 28.751 11.300 1.00 20.00 521 CB 66.490 29.528 9.986 1.00 20.00 522 C 66.319 29.708 12.487 1.00 20.00 523 O 65.754 29.378 13.528 1.00 20.00 524 N 66.921 30.891 12.335 1.00 20.00 525 CA 66.947 31.880 13.407 1.00 20.00 526 CB 68.390 32.205 13.806 1.00 20.00 527 C 66.205 33.149 13.000 1.00 20.00 528 O 65.282 33.572 13.692 1.00 20.00 529 N 66.604 33.756 11.878 1.00 20.00 530 CA 65.963 34.975 11.397 1.00 20.00 531 CB 66.992 36.105 11.292 1.00 20.00 532 C 65.265 34.759 10.059 1.00 20.00 533 O 64.561 35.646 9.581 1.00 20.00 534 N 65.456 33.584 9.453 1.00 20.00 535 CA 64.834 33.273 8.170 1.00 20.00 536 CB 65.109 31.808 7.815 1.00 20.00 537 C 63.337 33.561 8.140 1.00 20.00 538 O 62.818 34.022 7.126 1.00 20.00 539 N 62.641 33.291 9.248 1.00 20.00 540 CA 61.204 33.529 9.327 1.00 20.00 541 CB 60.635 33.029 10.659 1.00 20.00 542 C 60.908 35.013 9.141 1.00 20.00 543 O 60.011 35.372 8.381 1.00 20.00 544 N 61.657 35.877 9.831 1.00 20.00 545 CA 61.459 37.318 9.727 1.00 20.00 # _phasing.method SAD # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A THR 1 ? A THR 1 2 1 Y 1 A GLN 2 ? A GLN 2 3 1 Y 1 A THR 3 ? A THR 3 4 1 Y 1 A SER 4 ? A SER 4 5 1 Y 1 A HIS 5 ? A HIS 5 6 1 Y 1 A PRO 6 ? A PRO 6 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TYR N N N N 321 TYR CA C N S 322 TYR C C N N 323 TYR O O N N 324 TYR CB C N N 325 TYR CG C Y N 326 TYR CD1 C Y N 327 TYR CD2 C Y N 328 TYR CE1 C Y N 329 TYR CE2 C Y N 330 TYR CZ C Y N 331 TYR OH O N N 332 TYR OXT O N N 333 TYR H H N N 334 TYR H2 H N N 335 TYR HA H N N 336 TYR HB2 H N N 337 TYR HB3 H N N 338 TYR HD1 H N N 339 TYR HD2 H N N 340 TYR HE1 H N N 341 TYR HE2 H N N 342 TYR HH H N N 343 TYR HXT H N N 344 VAL N N N N 345 VAL CA C N S 346 VAL C C N N 347 VAL O O N N 348 VAL CB C N N 349 VAL CG1 C N N 350 VAL CG2 C N N 351 VAL OXT O N N 352 VAL H H N N 353 VAL H2 H N N 354 VAL HA H N N 355 VAL HB H N N 356 VAL HG11 H N N 357 VAL HG12 H N N 358 VAL HG13 H N N 359 VAL HG21 H N N 360 VAL HG22 H N N 361 VAL HG23 H N N 362 VAL HXT H N N 363 ZN ZN ZN N N 364 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TYR N CA sing N N 306 TYR N H sing N N 307 TYR N H2 sing N N 308 TYR CA C sing N N 309 TYR CA CB sing N N 310 TYR CA HA sing N N 311 TYR C O doub N N 312 TYR C OXT sing N N 313 TYR CB CG sing N N 314 TYR CB HB2 sing N N 315 TYR CB HB3 sing N N 316 TYR CG CD1 doub Y N 317 TYR CG CD2 sing Y N 318 TYR CD1 CE1 sing Y N 319 TYR CD1 HD1 sing N N 320 TYR CD2 CE2 doub Y N 321 TYR CD2 HD2 sing N N 322 TYR CE1 CZ doub Y N 323 TYR CE1 HE1 sing N N 324 TYR CE2 CZ sing Y N 325 TYR CE2 HE2 sing N N 326 TYR CZ OH sing N N 327 TYR OH HH sing N N 328 TYR OXT HXT sing N N 329 VAL N CA sing N N 330 VAL N H sing N N 331 VAL N H2 sing N N 332 VAL CA C sing N N 333 VAL CA CB sing N N 334 VAL CA HA sing N N 335 VAL C O doub N N 336 VAL C OXT sing N N 337 VAL CB CG1 sing N N 338 VAL CB CG2 sing N N 339 VAL CB HB sing N N 340 VAL CG1 HG11 sing N N 341 VAL CG1 HG12 sing N N 342 VAL CG1 HG13 sing N N 343 VAL CG2 HG21 sing N N 344 VAL CG2 HG22 sing N N 345 VAL CG2 HG23 sing N N 346 VAL OXT HXT sing N N 347 # _atom_sites.entry_id 4Z8W _atom_sites.fract_transf_matrix[1][1] 0.020145 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.020145 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007687 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S ZN # loop_ #