data_4Z8Z # _entry.id 4Z8Z # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.320 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4Z8Z WWPDB D_1000208818 # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.db_id MCSG-APC113005 _pdbx_database_related.content_type unspecified _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4Z8Z _pdbx_database_status.recvd_initial_deposition_date 2015-04-09 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Filippova, E.V.' 1 'Wawrzak, Z.' 2 'Kiryukhina, O.' 3 'Endres, M.' 4 'Joachimiak, J.' 5 'Anderson, W.F.' 6 'Midwest Center for Structural Genomics (MCSG)' 7 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Crystal structure of the hypothetical protein from Ruminiclostridium thermocellum ATCC 27405' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Filippova, E.V.' 1 ? primary 'Wawrzak, Z.' 2 ? primary 'Kiryukhina, O.' 3 ? primary 'Endres, M.' 4 ? primary 'Joachimiak, J.' 5 ? primary 'Anderson, W.F.' 6 ? primary 'Midwest Center for Structural Genomics (MCSG)' 7 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 4Z8Z _cell.details ? _cell.formula_units_Z ? _cell.length_a 141.353 _cell.length_a_esd ? _cell.length_b 141.353 _cell.length_b_esd ? _cell.length_c 112.676 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4Z8Z _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein' 38050.422 1 ? ? ? ? 2 water nat water 18.015 27 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)NEASSKFVDNIAIEKLLNEKLLRVSHRPKNLFYDDEKVFDDLCKCETD(MSE)SKVKLAEGDKNLKRFEFPSFLK TEEYIENNIVYLYYHPAKDPVCNILLLHGLYDDN(MSE)LNYGFLTR(MSE)LNELKFNVFL(MSE)ELPFHFNRKPAES FFSGEYFISADLLRARNAFIQSIYDIEASRNLIGNINTLPCLLVGFS(MSE)GGCISFRYH(MSE)LRDSFKGTFLINPV TD(MSE)LLLVWDNPLLVKVKKDLEDSGVGKEQV(MSE)DVFRIIDPCENINTRFNTDNIAVVYSIYDQIVGEEKNAIFV EKIKKAGLKKILEYHAGHLNILRVPKLSNDIYEFF(MSE)SCL ; _entity_poly.pdbx_seq_one_letter_code_can ;MNEASSKFVDNIAIEKLLNEKLLRVSHRPKNLFYDDEKVFDDLCKCETDMSKVKLAEGDKNLKRFEFPSFLKTEEYIENN IVYLYYHPAKDPVCNILLLHGLYDDNMLNYGFLTRMLNELKFNVFLMELPFHFNRKPAESFFSGEYFISADLLRARNAFI QSIYDIEASRNLIGNINTLPCLLVGFSMGGCISFRYHMLRDSFKGTFLINPVTDMLLLVWDNPLLVKVKKDLEDSGVGKE QVMDVFRIIDPCENINTRFNTDNIAVVYSIYDQIVGEEKNAIFVEKIKKAGLKKILEYHAGHLNILRVPKLSNDIYEFFM SCL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier MCSG-APC113005 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 ASN n 1 3 GLU n 1 4 ALA n 1 5 SER n 1 6 SER n 1 7 LYS n 1 8 PHE n 1 9 VAL n 1 10 ASP n 1 11 ASN n 1 12 ILE n 1 13 ALA n 1 14 ILE n 1 15 GLU n 1 16 LYS n 1 17 LEU n 1 18 LEU n 1 19 ASN n 1 20 GLU n 1 21 LYS n 1 22 LEU n 1 23 LEU n 1 24 ARG n 1 25 VAL n 1 26 SER n 1 27 HIS n 1 28 ARG n 1 29 PRO n 1 30 LYS n 1 31 ASN n 1 32 LEU n 1 33 PHE n 1 34 TYR n 1 35 ASP n 1 36 ASP n 1 37 GLU n 1 38 LYS n 1 39 VAL n 1 40 PHE n 1 41 ASP n 1 42 ASP n 1 43 LEU n 1 44 CYS n 1 45 LYS n 1 46 CYS n 1 47 GLU n 1 48 THR n 1 49 ASP n 1 50 MSE n 1 51 SER n 1 52 LYS n 1 53 VAL n 1 54 LYS n 1 55 LEU n 1 56 ALA n 1 57 GLU n 1 58 GLY n 1 59 ASP n 1 60 LYS n 1 61 ASN n 1 62 LEU n 1 63 LYS n 1 64 ARG n 1 65 PHE n 1 66 GLU n 1 67 PHE n 1 68 PRO n 1 69 SER n 1 70 PHE n 1 71 LEU n 1 72 LYS n 1 73 THR n 1 74 GLU n 1 75 GLU n 1 76 TYR n 1 77 ILE n 1 78 GLU n 1 79 ASN n 1 80 ASN n 1 81 ILE n 1 82 VAL n 1 83 TYR n 1 84 LEU n 1 85 TYR n 1 86 TYR n 1 87 HIS n 1 88 PRO n 1 89 ALA n 1 90 LYS n 1 91 ASP n 1 92 PRO n 1 93 VAL n 1 94 CYS n 1 95 ASN n 1 96 ILE n 1 97 LEU n 1 98 LEU n 1 99 LEU n 1 100 HIS n 1 101 GLY n 1 102 LEU n 1 103 TYR n 1 104 ASP n 1 105 ASP n 1 106 ASN n 1 107 MSE n 1 108 LEU n 1 109 ASN n 1 110 TYR n 1 111 GLY n 1 112 PHE n 1 113 LEU n 1 114 THR n 1 115 ARG n 1 116 MSE n 1 117 LEU n 1 118 ASN n 1 119 GLU n 1 120 LEU n 1 121 LYS n 1 122 PHE n 1 123 ASN n 1 124 VAL n 1 125 PHE n 1 126 LEU n 1 127 MSE n 1 128 GLU n 1 129 LEU n 1 130 PRO n 1 131 PHE n 1 132 HIS n 1 133 PHE n 1 134 ASN n 1 135 ARG n 1 136 LYS n 1 137 PRO n 1 138 ALA n 1 139 GLU n 1 140 SER n 1 141 PHE n 1 142 PHE n 1 143 SER n 1 144 GLY n 1 145 GLU n 1 146 TYR n 1 147 PHE n 1 148 ILE n 1 149 SER n 1 150 ALA n 1 151 ASP n 1 152 LEU n 1 153 LEU n 1 154 ARG n 1 155 ALA n 1 156 ARG n 1 157 ASN n 1 158 ALA n 1 159 PHE n 1 160 ILE n 1 161 GLN n 1 162 SER n 1 163 ILE n 1 164 TYR n 1 165 ASP n 1 166 ILE n 1 167 GLU n 1 168 ALA n 1 169 SER n 1 170 ARG n 1 171 ASN n 1 172 LEU n 1 173 ILE n 1 174 GLY n 1 175 ASN n 1 176 ILE n 1 177 ASN n 1 178 THR n 1 179 LEU n 1 180 PRO n 1 181 CYS n 1 182 LEU n 1 183 LEU n 1 184 VAL n 1 185 GLY n 1 186 PHE n 1 187 SER n 1 188 MSE n 1 189 GLY n 1 190 GLY n 1 191 CYS n 1 192 ILE n 1 193 SER n 1 194 PHE n 1 195 ARG n 1 196 TYR n 1 197 HIS n 1 198 MSE n 1 199 LEU n 1 200 ARG n 1 201 ASP n 1 202 SER n 1 203 PHE n 1 204 LYS n 1 205 GLY n 1 206 THR n 1 207 PHE n 1 208 LEU n 1 209 ILE n 1 210 ASN n 1 211 PRO n 1 212 VAL n 1 213 THR n 1 214 ASP n 1 215 MSE n 1 216 LEU n 1 217 LEU n 1 218 LEU n 1 219 VAL n 1 220 TRP n 1 221 ASP n 1 222 ASN n 1 223 PRO n 1 224 LEU n 1 225 LEU n 1 226 VAL n 1 227 LYS n 1 228 VAL n 1 229 LYS n 1 230 LYS n 1 231 ASP n 1 232 LEU n 1 233 GLU n 1 234 ASP n 1 235 SER n 1 236 GLY n 1 237 VAL n 1 238 GLY n 1 239 LYS n 1 240 GLU n 1 241 GLN n 1 242 VAL n 1 243 MSE n 1 244 ASP n 1 245 VAL n 1 246 PHE n 1 247 ARG n 1 248 ILE n 1 249 ILE n 1 250 ASP n 1 251 PRO n 1 252 CYS n 1 253 GLU n 1 254 ASN n 1 255 ILE n 1 256 ASN n 1 257 THR n 1 258 ARG n 1 259 PHE n 1 260 ASN n 1 261 THR n 1 262 ASP n 1 263 ASN n 1 264 ILE n 1 265 ALA n 1 266 VAL n 1 267 VAL n 1 268 TYR n 1 269 SER n 1 270 ILE n 1 271 TYR n 1 272 ASP n 1 273 GLN n 1 274 ILE n 1 275 VAL n 1 276 GLY n 1 277 GLU n 1 278 GLU n 1 279 LYS n 1 280 ASN n 1 281 ALA n 1 282 ILE n 1 283 PHE n 1 284 VAL n 1 285 GLU n 1 286 LYS n 1 287 ILE n 1 288 LYS n 1 289 LYS n 1 290 ALA n 1 291 GLY n 1 292 LEU n 1 293 LYS n 1 294 LYS n 1 295 ILE n 1 296 LEU n 1 297 GLU n 1 298 TYR n 1 299 HIS n 1 300 ALA n 1 301 GLY n 1 302 HIS n 1 303 LEU n 1 304 ASN n 1 305 ILE n 1 306 LEU n 1 307 ARG n 1 308 VAL n 1 309 PRO n 1 310 LYS n 1 311 LEU n 1 312 SER n 1 313 ASN n 1 314 ASP n 1 315 ILE n 1 316 TYR n 1 317 GLU n 1 318 PHE n 1 319 PHE n 1 320 MSE n 1 321 SER n 1 322 CYS n 1 323 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 323 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene Cthe_0134 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Clostridium thermocellum (strain ATCC 27405 / DSM 1237 / NBRC 103400 / NCIMB 10682 / NRRL B-4536 / VPI 7372)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 203119 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pMCSG68 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code A3DBP6_CLOTH _struct_ref.pdbx_db_accession A3DBP6 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNEASSKFVDNIAIEKLLNEKLLRVSHRPKNLFYDDEKVFDDLCKCETDMSKVKLAEGDKNLKRFEFPSFLKTEEYIENN IVYLYYHPAKDPVCNILLLHGLYDDNMLNYGFLTRMLNELKFNVFLMELPFHFNRKPAESFFSGEYFISADLLRARNAFI QSIYDIEASRNLIGNINTLPCLLVGFSMGGCISFRYHMLRDSFKGTFLINPVTDMLLLVWDNPLLVKVKKDLEDSGVGKE QVMDVFRIIDPCENINTRFNTDNIAVVYSIYDQIVGEEKNAIFVEKIKKAGLKKILEYHAGHLNILRVPKLSNDIYEFFM SCL ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4Z8Z _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 323 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession A3DBP6 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 323 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 323 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4Z8Z _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.88 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 57.32 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.2 M Trimethylamine N-oxide, 0.1 M Tris, 20% PEG2000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-11-24 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'C(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97872 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-F' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97872 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-F _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4Z8Z _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.55 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 14192 _reflns.number_obs 14192 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.2 _reflns.pdbx_Rmerge_I_obs 0.06 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 51.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.55 _reflns_shell.d_res_low 2.59 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.61 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 9.4 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -2.02 _refine.aniso_B[1][2] -1.01 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] -2.02 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] 6.56 _refine.B_iso_max ? _refine.B_iso_mean 64.527 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.967 _refine.correlation_coeff_Fo_to_Fc_free 0.949 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4Z8Z _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.55 _refine.ls_d_res_low 30 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13496 _refine.ls_number_reflns_R_free 694 _refine.ls_number_reflns_R_work 13496 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.61 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.17745 _refine.ls_R_factor_R_free 0.22171 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.17505 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.433 _refine.pdbx_overall_ESU_R_Free 0.255 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 21.269 _refine.overall_SU_ML 0.210 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 2619 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 27 _refine_hist.number_atoms_total 2646 _refine_hist.d_res_high 2.55 _refine_hist.d_res_low 30 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.014 0.019 2675 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 2590 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.733 1.983 3607 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.016 3.000 5959 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 7.276 5.000 318 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 36.910 24.545 132 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 17.505 15.000 463 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 16.900 15.000 13 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.098 0.200 399 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.007 0.020 2984 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 627 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.065 4.389 1278 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.064 4.387 1277 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.250 6.576 1594 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.249 6.578 1595 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.493 4.654 1397 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.493 4.656 1398 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.922 6.866 2014 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 5.327 34.323 2903 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 5.323 34.331 2903 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.551 _refine_ls_shell.d_res_low 2.617 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 49 _refine_ls_shell.number_reflns_R_work 970 _refine_ls_shell.percent_reflns_obs 97.33 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.336 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.257 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 4Z8Z _struct.title 'Crystal structure of the hypothetical protein from Ruminiclostridium thermocellum ATCC 27405' _struct.pdbx_descriptor 'hypothetical protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4Z8Z _struct_keywords.text 'Structural Genomics, Human Microbiome, Midwest Center For Structural Genomics, MCSG, PSI-Biology, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 2 ? LYS A 21 ? ASN A 2 LYS A 21 1 ? 20 HELX_P HELX_P2 AA2 LEU A 22 ? VAL A 25 ? LEU A 22 VAL A 25 5 ? 4 HELX_P HELX_P3 AA3 ASP A 49 ? VAL A 53 ? ASP A 49 VAL A 53 5 ? 5 HELX_P HELX_P4 AA4 TYR A 76 ? ASN A 79 ? TYR A 76 ASN A 79 5 ? 4 HELX_P HELX_P5 AA5 ASN A 106 ? ASN A 109 ? ASN A 106 ASN A 109 5 ? 4 HELX_P HELX_P6 AA6 TYR A 110 ? LEU A 120 ? TYR A 110 LEU A 120 1 ? 11 HELX_P HELX_P7 AA7 HIS A 132 ? LYS A 136 ? HIS A 132 LYS A 136 5 ? 5 HELX_P HELX_P8 AA8 ASP A 151 ? ASN A 177 ? ASP A 151 ASN A 177 1 ? 27 HELX_P HELX_P9 AA9 SER A 187 ? ARG A 200 ? SER A 187 ARG A 200 1 ? 14 HELX_P HELX_P10 AB1 LEU A 217 ? ASN A 222 ? LEU A 217 ASN A 222 1 ? 6 HELX_P HELX_P11 AB2 LEU A 225 ? SER A 235 ? LEU A 225 SER A 235 1 ? 11 HELX_P HELX_P12 AB3 GLY A 238 ? ARG A 247 ? GLY A 238 ARG A 247 1 ? 10 HELX_P HELX_P13 AB4 ILE A 248 ? ASP A 250 ? ILE A 248 ASP A 250 5 ? 3 HELX_P HELX_P14 AB5 PRO A 251 ? ILE A 255 ? PRO A 251 ILE A 255 5 ? 5 HELX_P HELX_P15 AB6 GLY A 276 ? ALA A 290 ? GLY A 276 ALA A 290 1 ? 15 HELX_P HELX_P16 AB7 LEU A 303 ? VAL A 308 ? LEU A 303 VAL A 308 5 ? 6 HELX_P HELX_P17 AB8 PRO A 309 ? SER A 321 ? PRO A 309 SER A 321 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A MSE 1 C ? ? ? 1_555 A ASN 2 N ? ? A MSE 1 A ASN 2 1_555 ? ? ? ? ? ? ? 1.324 ? covale2 covale both ? A ASP 49 C ? ? ? 1_555 A MSE 50 N ? ? A ASP 49 A MSE 50 1_555 ? ? ? ? ? ? ? 1.337 ? covale3 covale both ? A MSE 50 C ? ? ? 1_555 A SER 51 N ? ? A MSE 50 A SER 51 1_555 ? ? ? ? ? ? ? 1.334 ? covale4 covale both ? A ASN 106 C ? ? ? 1_555 A MSE 107 N ? ? A ASN 106 A MSE 107 1_555 ? ? ? ? ? ? ? 1.326 ? covale5 covale both ? A MSE 107 C ? ? ? 1_555 A LEU 108 N ? ? A MSE 107 A LEU 108 1_555 ? ? ? ? ? ? ? 1.322 ? covale6 covale both ? A ARG 115 C ? ? ? 1_555 A MSE 116 N ? ? A ARG 115 A MSE 116 1_555 ? ? ? ? ? ? ? 1.323 ? covale7 covale both ? A MSE 116 C ? ? ? 1_555 A LEU 117 N ? ? A MSE 116 A LEU 117 1_555 ? ? ? ? ? ? ? 1.331 ? covale8 covale both ? A LEU 126 C ? ? ? 1_555 A MSE 127 N ? ? A LEU 126 A MSE 127 1_555 ? ? ? ? ? ? ? 1.335 ? covale9 covale both ? A MSE 127 C ? ? ? 1_555 A GLU 128 N ? ? A MSE 127 A GLU 128 1_555 ? ? ? ? ? ? ? 1.342 ? covale10 covale both ? A SER 187 C ? ? ? 1_555 A MSE 188 N ? ? A SER 187 A MSE 188 1_555 ? ? ? ? ? ? ? 1.313 ? covale11 covale both ? A MSE 188 C ? ? ? 1_555 A GLY 189 N ? ? A MSE 188 A GLY 189 1_555 ? ? ? ? ? ? ? 1.330 ? covale12 covale both ? A HIS 197 C ? ? ? 1_555 A MSE 198 N ? ? A HIS 197 A MSE 198 1_555 ? ? ? ? ? ? ? 1.332 ? covale13 covale both ? A MSE 198 C ? ? ? 1_555 A LEU 199 N ? ? A MSE 198 A LEU 199 1_555 ? ? ? ? ? ? ? 1.319 ? covale14 covale both ? A ASP 214 C ? ? ? 1_555 A MSE 215 N ? ? A ASP 214 A MSE 215 1_555 ? ? ? ? ? ? ? 1.328 ? covale15 covale both ? A MSE 215 C ? ? ? 1_555 A LEU 216 N ? ? A MSE 215 A LEU 216 1_555 ? ? ? ? ? ? ? 1.326 ? covale16 covale both ? A VAL 242 C ? ? ? 1_555 A MSE 243 N ? ? A VAL 242 A MSE 243 1_555 ? ? ? ? ? ? ? 1.321 ? covale17 covale both ? A MSE 243 C ? ? ? 1_555 A ASP 244 N ? ? A MSE 243 A ASP 244 1_555 ? ? ? ? ? ? ? 1.316 ? covale18 covale both ? A PHE 319 C ? ? ? 1_555 A MSE 320 N ? ? A PHE 319 A MSE 320 1_555 ? ? ? ? ? ? ? 1.334 ? covale19 covale both ? A MSE 320 C ? ? ? 1_555 A SER 321 N ? ? A MSE 320 A SER 321 1_555 ? ? ? ? ? ? ? 1.339 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 9 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel AA1 7 8 ? parallel AA1 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 54 ? ALA A 56 ? LYS A 54 ALA A 56 AA1 2 LYS A 63 ? PRO A 68 ? LYS A 63 PRO A 68 AA1 3 ILE A 81 ? HIS A 87 ? ILE A 81 HIS A 87 AA1 4 PHE A 122 ? MSE A 127 ? PHE A 122 MSE A 127 AA1 5 CYS A 94 ? LEU A 99 ? CYS A 94 LEU A 99 AA1 6 CYS A 181 ? PHE A 186 ? CYS A 181 PHE A 186 AA1 7 GLY A 205 ? ILE A 209 ? GLY A 205 ILE A 209 AA1 8 ILE A 264 ? SER A 269 ? ILE A 264 SER A 269 AA1 9 LYS A 294 ? TYR A 298 ? LYS A 294 TYR A 298 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ALA A 56 ? N ALA A 56 O ARG A 64 ? O ARG A 64 AA1 2 3 N PHE A 67 ? N PHE A 67 O VAL A 82 ? O VAL A 82 AA1 3 4 N HIS A 87 ? N HIS A 87 O VAL A 124 ? O VAL A 124 AA1 4 5 O ASN A 123 ? O ASN A 123 N ILE A 96 ? N ILE A 96 AA1 5 6 N LEU A 97 ? N LEU A 97 O VAL A 184 ? O VAL A 184 AA1 6 7 N GLY A 185 ? N GLY A 185 O ILE A 209 ? O ILE A 209 AA1 7 8 N LEU A 208 ? N LEU A 208 O VAL A 267 ? O VAL A 267 AA1 8 9 N VAL A 266 ? N VAL A 266 O LEU A 296 ? O LEU A 296 # _atom_sites.entry_id 4Z8Z _atom_sites.fract_transf_matrix[1][1] 0.007074 _atom_sites.fract_transf_matrix[1][2] 0.004084 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008169 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008875 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 ASN 2 2 2 ASN ASN A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 ALA 4 4 4 ALA ALA A . n A 1 5 SER 5 5 5 SER SER A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 LYS 7 7 7 LYS LYS A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 VAL 9 9 9 VAL VAL A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ILE 12 12 12 ILE ILE A . n A 1 13 ALA 13 13 13 ALA ALA A . n A 1 14 ILE 14 14 14 ILE ILE A . n A 1 15 GLU 15 15 15 GLU GLU A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 LEU 17 17 17 LEU LEU A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ASN 19 19 19 ASN ASN A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 LEU 22 22 22 LEU LEU A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ARG 24 24 24 ARG ARG A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 SER 26 26 26 SER SER A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 PRO 29 29 29 PRO PRO A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 ASP 35 35 35 ASP ASP A . n A 1 36 ASP 36 36 36 ASP ASP A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 LYS 38 38 38 LYS LYS A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 PHE 40 40 40 PHE PHE A . n A 1 41 ASP 41 41 41 ASP ASP A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 CYS 44 44 44 CYS CYS A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 CYS 46 46 46 CYS CYS A . n A 1 47 GLU 47 47 47 GLU GLU A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 MSE 50 50 50 MSE MSE A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 LYS 52 52 52 LYS LYS A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 LYS 54 54 54 LYS LYS A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 GLY 58 58 ? ? ? A . n A 1 59 ASP 59 59 ? ? ? A . n A 1 60 LYS 60 60 ? ? ? A . n A 1 61 ASN 61 61 61 ASN ASN A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 LYS 63 63 63 LYS LYS A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 GLU 66 66 66 GLU GLU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 PRO 68 68 68 PRO PRO A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 PHE 70 70 70 PHE PHE A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LYS 72 72 72 LYS LYS A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 GLU 75 75 75 GLU GLU A . n A 1 76 TYR 76 76 76 TYR TYR A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ASN 79 79 79 ASN ASN A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 ILE 81 81 81 ILE ILE A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 TYR 85 85 85 TYR TYR A . n A 1 86 TYR 86 86 86 TYR TYR A . n A 1 87 HIS 87 87 87 HIS HIS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 ALA 89 89 89 ALA ALA A . n A 1 90 LYS 90 90 90 LYS LYS A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 VAL 93 93 93 VAL VAL A . n A 1 94 CYS 94 94 94 CYS CYS A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 ILE 96 96 96 ILE ILE A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 LEU 98 98 98 LEU LEU A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 HIS 100 100 100 HIS HIS A . n A 1 101 GLY 101 101 101 GLY GLY A . n A 1 102 LEU 102 102 102 LEU LEU A . n A 1 103 TYR 103 103 103 TYR TYR A . n A 1 104 ASP 104 104 104 ASP ASP A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 MSE 107 107 107 MSE MSE A . n A 1 108 LEU 108 108 108 LEU LEU A . n A 1 109 ASN 109 109 109 ASN ASN A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 GLY 111 111 111 GLY GLY A . n A 1 112 PHE 112 112 112 PHE PHE A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 THR 114 114 114 THR THR A . n A 1 115 ARG 115 115 115 ARG ARG A . n A 1 116 MSE 116 116 116 MSE MSE A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 LYS 121 121 121 LYS LYS A . n A 1 122 PHE 122 122 122 PHE PHE A . n A 1 123 ASN 123 123 123 ASN ASN A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 MSE 127 127 127 MSE MSE A . n A 1 128 GLU 128 128 128 GLU GLU A . n A 1 129 LEU 129 129 129 LEU LEU A . n A 1 130 PRO 130 130 130 PRO PRO A . n A 1 131 PHE 131 131 131 PHE PHE A . n A 1 132 HIS 132 132 132 HIS HIS A . n A 1 133 PHE 133 133 133 PHE PHE A . n A 1 134 ASN 134 134 134 ASN ASN A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 LYS 136 136 136 LYS LYS A . n A 1 137 PRO 137 137 137 PRO PRO A . n A 1 138 ALA 138 138 138 ALA ALA A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 PHE 141 141 141 PHE PHE A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 GLU 145 145 145 GLU GLU A . n A 1 146 TYR 146 146 146 TYR TYR A . n A 1 147 PHE 147 147 147 PHE PHE A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ARG 154 154 154 ARG ARG A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 ARG 156 156 156 ARG ARG A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 PHE 159 159 159 PHE PHE A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 GLN 161 161 161 GLN GLN A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 TYR 164 164 164 TYR TYR A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 SER 169 169 169 SER SER A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 ASN 171 171 171 ASN ASN A . n A 1 172 LEU 172 172 172 LEU LEU A . n A 1 173 ILE 173 173 173 ILE ILE A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 ASN 175 175 175 ASN ASN A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 ASN 177 177 177 ASN ASN A . n A 1 178 THR 178 178 178 THR THR A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 PRO 180 180 180 PRO PRO A . n A 1 181 CYS 181 181 181 CYS CYS A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 LEU 183 183 183 LEU LEU A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 PHE 186 186 186 PHE PHE A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 MSE 188 188 188 MSE MSE A . n A 1 189 GLY 189 189 189 GLY GLY A . n A 1 190 GLY 190 190 190 GLY GLY A . n A 1 191 CYS 191 191 191 CYS CYS A . n A 1 192 ILE 192 192 192 ILE ILE A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 ARG 195 195 195 ARG ARG A . n A 1 196 TYR 196 196 196 TYR TYR A . n A 1 197 HIS 197 197 197 HIS HIS A . n A 1 198 MSE 198 198 198 MSE MSE A . n A 1 199 LEU 199 199 199 LEU LEU A . n A 1 200 ARG 200 200 200 ARG ARG A . n A 1 201 ASP 201 201 201 ASP ASP A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 PHE 203 203 203 PHE PHE A . n A 1 204 LYS 204 204 204 LYS LYS A . n A 1 205 GLY 205 205 205 GLY GLY A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 PHE 207 207 207 PHE PHE A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 ILE 209 209 209 ILE ILE A . n A 1 210 ASN 210 210 210 ASN ASN A . n A 1 211 PRO 211 211 211 PRO PRO A . n A 1 212 VAL 212 212 212 VAL VAL A . n A 1 213 THR 213 213 213 THR THR A . n A 1 214 ASP 214 214 214 ASP ASP A . n A 1 215 MSE 215 215 215 MSE MSE A . n A 1 216 LEU 216 216 216 LEU LEU A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 VAL 219 219 219 VAL VAL A . n A 1 220 TRP 220 220 220 TRP TRP A . n A 1 221 ASP 221 221 221 ASP ASP A . n A 1 222 ASN 222 222 222 ASN ASN A . n A 1 223 PRO 223 223 223 PRO PRO A . n A 1 224 LEU 224 224 224 LEU LEU A . n A 1 225 LEU 225 225 225 LEU LEU A . n A 1 226 VAL 226 226 226 VAL VAL A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 VAL 228 228 228 VAL VAL A . n A 1 229 LYS 229 229 229 LYS LYS A . n A 1 230 LYS 230 230 230 LYS LYS A . n A 1 231 ASP 231 231 231 ASP ASP A . n A 1 232 LEU 232 232 232 LEU LEU A . n A 1 233 GLU 233 233 233 GLU GLU A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 SER 235 235 235 SER SER A . n A 1 236 GLY 236 236 236 GLY GLY A . n A 1 237 VAL 237 237 237 VAL VAL A . n A 1 238 GLY 238 238 238 GLY GLY A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 GLU 240 240 240 GLU GLU A . n A 1 241 GLN 241 241 241 GLN GLN A . n A 1 242 VAL 242 242 242 VAL VAL A . n A 1 243 MSE 243 243 243 MSE MSE A . n A 1 244 ASP 244 244 244 ASP ASP A . n A 1 245 VAL 245 245 245 VAL VAL A . n A 1 246 PHE 246 246 246 PHE PHE A . n A 1 247 ARG 247 247 247 ARG ARG A . n A 1 248 ILE 248 248 248 ILE ILE A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 ASP 250 250 250 ASP ASP A . n A 1 251 PRO 251 251 251 PRO PRO A . n A 1 252 CYS 252 252 252 CYS CYS A . n A 1 253 GLU 253 253 253 GLU GLU A . n A 1 254 ASN 254 254 254 ASN ASN A . n A 1 255 ILE 255 255 255 ILE ILE A . n A 1 256 ASN 256 256 256 ASN ASN A . n A 1 257 THR 257 257 257 THR THR A . n A 1 258 ARG 258 258 258 ARG ARG A . n A 1 259 PHE 259 259 259 PHE PHE A . n A 1 260 ASN 260 260 260 ASN ASN A . n A 1 261 THR 261 261 261 THR THR A . n A 1 262 ASP 262 262 262 ASP ASP A . n A 1 263 ASN 263 263 263 ASN ASN A . n A 1 264 ILE 264 264 264 ILE ILE A . n A 1 265 ALA 265 265 265 ALA ALA A . n A 1 266 VAL 266 266 266 VAL VAL A . n A 1 267 VAL 267 267 267 VAL VAL A . n A 1 268 TYR 268 268 268 TYR TYR A . n A 1 269 SER 269 269 269 SER SER A . n A 1 270 ILE 270 270 270 ILE ILE A . n A 1 271 TYR 271 271 271 TYR TYR A . n A 1 272 ASP 272 272 272 ASP ASP A . n A 1 273 GLN 273 273 273 GLN GLN A . n A 1 274 ILE 274 274 274 ILE ILE A . n A 1 275 VAL 275 275 275 VAL VAL A . n A 1 276 GLY 276 276 276 GLY GLY A . n A 1 277 GLU 277 277 277 GLU GLU A . n A 1 278 GLU 278 278 278 GLU GLU A . n A 1 279 LYS 279 279 279 LYS LYS A . n A 1 280 ASN 280 280 280 ASN ASN A . n A 1 281 ALA 281 281 281 ALA ALA A . n A 1 282 ILE 282 282 282 ILE ILE A . n A 1 283 PHE 283 283 283 PHE PHE A . n A 1 284 VAL 284 284 284 VAL VAL A . n A 1 285 GLU 285 285 285 GLU GLU A . n A 1 286 LYS 286 286 286 LYS LYS A . n A 1 287 ILE 287 287 287 ILE ILE A . n A 1 288 LYS 288 288 288 LYS LYS A . n A 1 289 LYS 289 289 289 LYS LYS A . n A 1 290 ALA 290 290 290 ALA ALA A . n A 1 291 GLY 291 291 291 GLY GLY A . n A 1 292 LEU 292 292 292 LEU LEU A . n A 1 293 LYS 293 293 293 LYS LYS A . n A 1 294 LYS 294 294 294 LYS LYS A . n A 1 295 ILE 295 295 295 ILE ILE A . n A 1 296 LEU 296 296 296 LEU LEU A . n A 1 297 GLU 297 297 297 GLU GLU A . n A 1 298 TYR 298 298 298 TYR TYR A . n A 1 299 HIS 299 299 299 HIS HIS A . n A 1 300 ALA 300 300 300 ALA ALA A . n A 1 301 GLY 301 301 301 GLY GLY A . n A 1 302 HIS 302 302 302 HIS HIS A . n A 1 303 LEU 303 303 303 LEU LEU A . n A 1 304 ASN 304 304 304 ASN ASN A . n A 1 305 ILE 305 305 305 ILE ILE A . n A 1 306 LEU 306 306 306 LEU LEU A . n A 1 307 ARG 307 307 307 ARG ARG A . n A 1 308 VAL 308 308 308 VAL VAL A . n A 1 309 PRO 309 309 309 PRO PRO A . n A 1 310 LYS 310 310 310 LYS LYS A . n A 1 311 LEU 311 311 311 LEU LEU A . n A 1 312 SER 312 312 312 SER SER A . n A 1 313 ASN 313 313 313 ASN ASN A . n A 1 314 ASP 314 314 314 ASP ASP A . n A 1 315 ILE 315 315 315 ILE ILE A . n A 1 316 TYR 316 316 316 TYR TYR A . n A 1 317 GLU 317 317 317 GLU GLU A . n A 1 318 PHE 318 318 318 PHE PHE A . n A 1 319 PHE 319 319 319 PHE PHE A . n A 1 320 MSE 320 320 320 MSE MSE A . n A 1 321 SER 321 321 321 SER SER A . n A 1 322 CYS 322 322 322 CYS CYS A . n A 1 323 LEU 323 323 323 LEU LEU A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Midwest Center for Structural Genomics' _pdbx_SG_project.initial_of_center MCSG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 401 23 HOH HOH A . B 2 HOH 2 402 20 HOH HOH A . B 2 HOH 3 403 5 HOH HOH A . B 2 HOH 4 404 18 HOH HOH A . B 2 HOH 5 405 10 HOH HOH A . B 2 HOH 6 406 9 HOH HOH A . B 2 HOH 7 407 6 HOH HOH A . B 2 HOH 8 408 16 HOH HOH A . B 2 HOH 9 409 12 HOH HOH A . B 2 HOH 10 410 3 HOH HOH A . B 2 HOH 11 411 2 HOH HOH A . B 2 HOH 12 412 7 HOH HOH A . B 2 HOH 13 413 15 HOH HOH A . B 2 HOH 14 414 26 HOH HOH A . B 2 HOH 15 415 17 HOH HOH A . B 2 HOH 16 416 28 HOH HOH A . B 2 HOH 17 417 21 HOH HOH A . B 2 HOH 18 418 8 HOH HOH A . B 2 HOH 19 419 19 HOH HOH A . B 2 HOH 20 420 13 HOH HOH A . B 2 HOH 21 421 22 HOH HOH A . B 2 HOH 22 422 25 HOH HOH A . B 2 HOH 23 423 14 HOH HOH A . B 2 HOH 24 424 4 HOH HOH A . B 2 HOH 25 425 1 HOH HOH A . B 2 HOH 26 426 24 HOH HOH A . B 2 HOH 27 427 27 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET 'modified residue' 2 A MSE 50 A MSE 50 ? MET 'modified residue' 3 A MSE 107 A MSE 107 ? MET 'modified residue' 4 A MSE 116 A MSE 116 ? MET 'modified residue' 5 A MSE 127 A MSE 127 ? MET 'modified residue' 6 A MSE 188 A MSE 188 ? MET 'modified residue' 7 A MSE 198 A MSE 198 ? MET 'modified residue' 8 A MSE 215 A MSE 215 ? MET 'modified residue' 9 A MSE 243 A MSE 243 ? MET 'modified residue' 10 A MSE 320 A MSE 320 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-05-06 2 'Structure model' 1 1 2017-09-27 3 'Structure model' 1 2 2018-01-24 4 'Structure model' 1 3 2019-12-11 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Author supporting evidence' 2 2 'Structure model' 'Derived calculations' 3 2 'Structure model' 'Refinement description' 4 2 'Structure model' 'Source and taxonomy' 5 2 'Structure model' 'Structure summary' 6 3 'Structure model' 'Database references' 7 4 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' entity_src_gen 3 2 'Structure model' pdbx_audit_support 4 2 'Structure model' pdbx_struct_assembly 5 2 'Structure model' pdbx_struct_oper_list 6 2 'Structure model' software 7 2 'Structure model' struct_keywords 8 3 'Structure model' citation_author 9 4 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 2 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 3 2 'Structure model' '_pdbx_audit_support.funding_organization' 4 2 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 5 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 6 2 'Structure model' '_software.classification' 7 2 'Structure model' '_struct_keywords.text' 8 3 'Structure model' '_citation_author.name' 9 4 'Structure model' '_pdbx_audit_support.funding_organization' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 106.6335 133.5031 123.8781 0.2857 ? -0.0854 ? -0.0496 ? 0.2760 ? 0.0324 ? 0.0654 ? 2.1125 ? -1.6498 ? -0.6855 ? 8.9912 ? 1.0819 ? 0.3007 ? -0.0900 ? -0.0797 ? -0.1656 ? -0.1945 ? 0.0047 ? 0.1604 ? -0.0596 ? 0.1119 ? 0.0854 ? 2 'X-RAY DIFFRACTION' ? refined 96.9550 108.2275 130.7690 0.2016 ? 0.0405 ? -0.0182 ? 0.0384 ? 0.0216 ? 0.1429 ? 3.0093 ? 0.6996 ? -0.0328 ? 1.4283 ? 0.5067 ? 3.4290 ? -0.0673 ? -0.0780 ? -0.6175 ? -0.3279 ? 0.0010 ? -0.0432 ? 0.3965 ? 0.1326 ? 0.0662 ? 3 'X-RAY DIFFRACTION' ? refined 103.2341 113.9036 152.6684 0.0450 ? 0.0686 ? -0.0292 ? 0.5775 ? 0.1703 ? 0.1369 ? 2.9796 ? 0.4520 ? 1.6910 ? 5.8184 ? -2.3464 ? 2.1965 ? 0.1681 ? -0.4977 ? -0.4224 ? 0.2366 ? -0.2370 ? -0.6663 ? 0.0293 ? -0.0369 ? 0.0689 ? 4 'X-RAY DIFFRACTION' ? refined 101.5222 118.5096 144.7921 0.0996 ? 0.0544 ? -0.0545 ? 0.4643 ? 0.0933 ? 0.0665 ? 1.6428 ? -0.1822 ? -1.4184 ? 3.2722 ? 1.8020 ? 2.6056 ? -0.0527 ? -0.7237 ? -0.1653 ? 0.0848 ? 0.0173 ? -0.0989 ? 0.0919 ? 0.5286 ? 0.0354 ? 5 'X-RAY DIFFRACTION' ? refined 104.5293 132.5613 143.5191 0.1536 ? -0.0396 ? -0.0177 ? 0.3304 ? -0.0219 ? 0.0994 ? 7.7172 ? -3.4555 ? -5.0555 ? 1.7904 ? 2.8168 ? 4.6375 ? -0.0203 ? -0.6229 ? 0.2507 ? -0.0831 ? 0.1712 ? -0.1087 ? -0.1838 ? 0.2672 ? -0.1509 ? 6 'X-RAY DIFFRACTION' ? refined 93.0358 122.0074 133.6760 0.1311 ? 0.0302 ? -0.0571 ? 0.1906 ? 0.0297 ? 0.0421 ? 2.1020 ? 0.3985 ? -0.4209 ? 1.3020 ? 0.0514 ? 1.7510 ? -0.0599 ? -0.3299 ? -0.0839 ? -0.2294 ? -0.0196 ? 0.1683 ? -0.0248 ? 0.1308 ? 0.0795 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 1 ? ? A 17 ? ? 2 'X-RAY DIFFRACTION' 2 ? ? A 18 ? ? A 48 ? ? 3 'X-RAY DIFFRACTION' 3 ? ? A 49 ? ? A 71 ? ? 4 'X-RAY DIFFRACTION' 4 ? ? A 72 ? ? A 105 ? ? 5 'X-RAY DIFFRACTION' 5 ? ? A 106 ? ? A 119 ? ? 6 'X-RAY DIFFRACTION' 6 ? ? A 120 ? ? A 323 ? ? # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0103 1 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? BLU-MAX ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 NE A ARG 195 ? ? CZ A ARG 195 ? ? NH1 A ARG 195 ? ? 123.36 120.30 3.06 0.50 N 2 1 NE A ARG 200 ? ? CZ A ARG 200 ? ? NH1 A ARG 200 ? ? 124.24 120.30 3.94 0.50 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 21 ? ? -138.53 -70.88 2 1 LYS A 30 ? ? -129.03 -66.67 3 1 LEU A 62 ? ? -173.39 141.52 4 1 TYR A 103 ? ? 52.30 18.08 5 1 LYS A 121 ? ? 82.86 32.15 6 1 PHE A 133 ? ? 53.25 -132.43 7 1 SER A 187 ? ? 57.44 -123.58 8 1 ASP A 201 ? ? -108.12 59.42 9 1 ASP A 214 ? ? -162.08 109.01 10 1 ASN A 263 ? ? -99.79 36.78 11 1 HIS A 299 ? ? -101.40 71.79 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 ASP _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 42 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 LEU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 43 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega -148.18 # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 1 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id CYS _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 322 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id SG _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id CYS _pdbx_unobs_or_zero_occ_atoms.label_seq_id 322 _pdbx_unobs_or_zero_occ_atoms.label_atom_id SG # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 58 ? A GLY 58 2 1 Y 1 A ASP 59 ? A ASP 59 3 1 Y 1 A LYS 60 ? A LYS 60 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #