data_4ZCP # _entry.id 4ZCP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.296 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4ZCP WWPDB D_1000208804 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4ZCP _pdbx_database_status.recvd_initial_deposition_date 2015-04-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Guca, E.' 1 'Hoh, F.' 2 'Guichou, J.-F.' 3 'Cerdan, R.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 11215 _citation.page_last 11215 _citation.title 'Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-018-29500-9 _citation.pdbx_database_id_PubMed 30046154 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guca, E.' 1 ? primary 'Nagy, G.N.' 2 ? primary 'Hajdu, F.' 3 ? primary 'Marton, L.' 4 ? primary 'Izrael, R.' 5 ? primary 'Hoh, F.' 6 ? primary 'Yang, Y.' 7 ? primary 'Vial, H.' 8 ? primary 'Vertessy, B.G.' 9 ? primary 'Guichou, J.F.' 10 ? primary 'Cerdan, R.' 11 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4ZCP _cell.details ? _cell.formula_units_Z ? _cell.length_a 50.520 _cell.length_a_esd ? _cell.length_b 69.300 _cell.length_b_esd ? _cell.length_c 116.440 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4ZCP _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cholinephosphate cytidylyltransferase' 20810.123 1 2.7.7.15 ? ? ? 2 non-polymer syn "CYTIDINE-5'-MONOPHOSPHATE" 323.197 1 ? ? ? ? 3 water nat water 18.015 43 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMAVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDN ETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQR TEGVSTTDLIVRILKNYEDY ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMAVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDN ETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQR TEGVSTTDLIVRILKNYEDY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ALA n 1 5 VAL n 1 6 PRO n 1 7 ASP n 1 8 ASP n 1 9 ASP n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 ASP n 1 14 ASN n 1 15 SER n 1 16 ASN n 1 17 ASP n 1 18 GLU n 1 19 SER n 1 20 GLU n 1 21 TYR n 1 22 GLU n 1 23 SER n 1 24 SER n 1 25 GLN n 1 26 MET n 1 27 ASP n 1 28 SER n 1 29 GLU n 1 30 LYS n 1 31 ASN n 1 32 LYS n 1 33 GLY n 1 34 SER n 1 35 ILE n 1 36 LYS n 1 37 ASN n 1 38 SER n 1 39 LYS n 1 40 ASN n 1 41 VAL n 1 42 VAL n 1 43 ILE n 1 44 TYR n 1 45 ALA n 1 46 ASP n 1 47 GLY n 1 48 VAL n 1 49 TYR n 1 50 ASP n 1 51 MET n 1 52 LEU n 1 53 HIS n 1 54 LEU n 1 55 GLY n 1 56 HIS n 1 57 MET n 1 58 LYS n 1 59 GLN n 1 60 LEU n 1 61 GLU n 1 62 GLN n 1 63 ALA n 1 64 LYS n 1 65 LYS n 1 66 LEU n 1 67 PHE n 1 68 GLU n 1 69 ASN n 1 70 THR n 1 71 THR n 1 72 LEU n 1 73 ILE n 1 74 VAL n 1 75 GLY n 1 76 VAL n 1 77 THR n 1 78 SER n 1 79 ASP n 1 80 ASN n 1 81 GLU n 1 82 THR n 1 83 LYS n 1 84 LEU n 1 85 PHE n 1 86 LYS n 1 87 GLY n 1 88 GLN n 1 89 VAL n 1 90 VAL n 1 91 GLN n 1 92 THR n 1 93 LEU n 1 94 GLU n 1 95 GLU n 1 96 ARG n 1 97 THR n 1 98 GLU n 1 99 THR n 1 100 LEU n 1 101 LYS n 1 102 HIS n 1 103 ILE n 1 104 ARG n 1 105 TRP n 1 106 VAL n 1 107 ASP n 1 108 GLU n 1 109 ILE n 1 110 ILE n 1 111 SER n 1 112 PRO n 1 113 CYS n 1 114 PRO n 1 115 TRP n 1 116 VAL n 1 117 VAL n 1 118 THR n 1 119 PRO n 1 120 GLU n 1 121 PHE n 1 122 LEU n 1 123 GLU n 1 124 LYS n 1 125 TYR n 1 126 LYS n 1 127 ILE n 1 128 ASP n 1 129 TYR n 1 130 VAL n 1 131 ALA n 1 132 HIS n 1 133 ASP n 1 134 ASP n 1 135 ILE n 1 136 PRO n 1 137 TYR n 1 138 ALA n 1 139 ASN n 1 140 ASN n 1 141 GLN n 1 142 LYS n 1 143 GLU n 1 144 ASP n 1 145 ILE n 1 146 TYR n 1 147 ALA n 1 148 TRP n 1 149 LEU n 1 150 LYS n 1 151 ARG n 1 152 ALA n 1 153 GLY n 1 154 LYS n 1 155 PHE n 1 156 LYS n 1 157 ALA n 1 158 THR n 1 159 GLN n 1 160 ARG n 1 161 THR n 1 162 GLU n 1 163 GLY n 1 164 VAL n 1 165 SER n 1 166 THR n 1 167 THR n 1 168 ASP n 1 169 LEU n 1 170 ILE n 1 171 VAL n 1 172 ARG n 1 173 ILE n 1 174 LEU n 1 175 LYS n 1 176 ASN n 1 177 TYR n 1 178 GLU n 1 179 ASP n 1 180 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 180 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ctP, MAL13P1.86' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium falciparum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 5833 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8IEE9_PLAF7 _struct_ref.pdbx_db_accession Q8IEE9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETK LFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKKKKKKKSKGKSFSFDEENEDI YAWLKRAGKFKATQRTEGVSTTDLIVRILKNYEDY ; _struct_ref.pdbx_align_begin 581 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4ZCP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IEE9 _struct_ref_seq.db_align_beg 581 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 775 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 581 _struct_ref_seq.pdbx_auth_seq_align_end 775 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4ZCP GLY A 1 ? UNP Q8IEE9 ? ? 'expression tag' 578 1 1 4ZCP HIS A 2 ? UNP Q8IEE9 ? ? 'expression tag' 579 2 1 4ZCP MET A 3 ? UNP Q8IEE9 ? ? 'expression tag' 580 3 1 4ZCP ? A ? ? UNP Q8IEE9 LYS 720 deletion ? 4 1 4ZCP ? A ? ? UNP Q8IEE9 LYS 721 deletion ? 5 1 4ZCP ? A ? ? UNP Q8IEE9 LYS 722 deletion ? 6 1 4ZCP ? A ? ? UNP Q8IEE9 LYS 723 deletion ? 7 1 4ZCP ? A ? ? UNP Q8IEE9 LYS 724 deletion ? 8 1 4ZCP ? A ? ? UNP Q8IEE9 LYS 725 deletion ? 9 1 4ZCP ? A ? ? UNP Q8IEE9 SER 726 deletion ? 10 1 4ZCP ? A ? ? UNP Q8IEE9 LYS 727 deletion ? 11 1 4ZCP ? A ? ? UNP Q8IEE9 GLY 728 deletion ? 12 1 4ZCP ? A ? ? UNP Q8IEE9 LYS 729 deletion ? 13 1 4ZCP ? A ? ? UNP Q8IEE9 SER 730 deletion ? 14 1 4ZCP ? A ? ? UNP Q8IEE9 PHE 731 deletion ? 15 1 4ZCP ? A ? ? UNP Q8IEE9 SER 732 deletion ? 16 1 4ZCP ? A ? ? UNP Q8IEE9 PHE 733 deletion ? 17 1 4ZCP ? A ? ? UNP Q8IEE9 ASP 734 deletion ? 18 1 4ZCP ? A ? ? UNP Q8IEE9 GLU 735 deletion ? 19 1 4ZCP ? A ? ? UNP Q8IEE9 GLU 736 deletion ? 20 1 4ZCP ? A ? ? UNP Q8IEE9 ASN 737 deletion ? 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 C5P non-polymer . "CYTIDINE-5'-MONOPHOSPHATE" ? 'C9 H14 N3 O8 P' 323.197 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4ZCP _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.45 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.77 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG 4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-02-20 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.8726 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.8726 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-2 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4ZCP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.98 _reflns.d_resolution_low 58.22 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 13840 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.30 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.059 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 10.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] -0.00 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 0.01 _refine.aniso_B[2][3] 0.00 _refine.aniso_B[3][3] -0.01 _refine.B_iso_max ? _refine.B_iso_mean 40.135 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.954 _refine.correlation_coeff_Fo_to_Fc_free 0.936 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4ZCP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.98 _refine.ls_d_res_low 58.22 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 13840 _refine.ls_number_reflns_R_free 710 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.30 _refine.ls_percent_reflns_R_free 4.9 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.20923 _refine.ls_R_factor_R_free 0.24713 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.20730 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ZCT _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.142 _refine.pdbx_overall_ESU_R_Free 0.140 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 4.278 _refine.overall_SU_ML 0.117 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 1023 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 21 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 1087 _refine_hist.d_res_high 1.98 _refine_hist.d_res_low 58.22 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 0.020 1065 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 999 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.104 1.969 1449 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.673 3.007 2292 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 5.069 5.000 127 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 32.788 24.348 46 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 11.852 15.000 180 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 15.769 15.000 5 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.067 0.200 171 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 0.020 1164 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.001 0.020 236 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 1.967 4.031 514 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 1.967 4.023 513 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 3.147 6.018 639 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.146 6.027 640 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 2.371 4.204 551 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 2.369 4.204 552 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 3.795 6.220 811 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 6.617 32.958 1224 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 6.615 32.966 1225 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.980 _refine_ls_shell.d_res_low 2.031 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 51 _refine_ls_shell.number_reflns_R_work 1019 _refine_ls_shell.percent_reflns_obs 99.72 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.308 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.342 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 4ZCP _struct.title ;Crystal structure of the C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase in complex with CMP ; _struct.pdbx_descriptor 'CTP:phosphocholine cytidylyltransferase (E.C.2.7.7.15)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4ZCP _struct_keywords.text 'enzyme, malaria, cytidylyltransferase, phosphatidylcholine, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 53 ? LYS A 65 ? HIS A 630 LYS A 642 1 ? 13 HELX_P HELX_P2 AA2 SER A 78 ? LYS A 86 ? SER A 655 LYS A 663 1 ? 9 HELX_P HELX_P3 AA3 THR A 92 ? LYS A 101 ? THR A 669 LYS A 678 1 ? 10 HELX_P HELX_P4 AA4 THR A 118 ? TYR A 125 ? THR A 695 TYR A 702 1 ? 8 HELX_P HELX_P5 AA5 TYR A 146 ? GLY A 153 ? TYR A 741 GLY A 748 1 ? 8 HELX_P HELX_P6 AA6 SER A 165 ? LEU A 174 ? SER A 760 LEU A 769 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 111 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 688 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 112 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 689 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.36 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 108 ? CYS A 113 ? GLU A 685 CYS A 690 AA1 2 THR A 70 ? THR A 77 ? THR A 647 THR A 654 AA1 3 VAL A 41 ? GLY A 47 ? VAL A 618 GLY A 624 AA1 4 TYR A 129 ? ASP A 133 ? TYR A 706 ASP A 710 AA1 5 PHE A 155 ? THR A 158 ? PHE A 750 THR A 753 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 110 ? O ILE A 687 N VAL A 74 ? N VAL A 651 AA1 2 3 O ILE A 73 ? O ILE A 650 N ILE A 43 ? N ILE A 620 AA1 3 4 N TYR A 44 ? N TYR A 621 O ALA A 131 ? O ALA A 708 AA1 4 5 N VAL A 130 ? N VAL A 707 O LYS A 156 ? O LYS A 751 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id C5P _struct_site.pdbx_auth_seq_id 801 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 17 _struct_site.details 'binding site for residue C5P A 801' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 17 GLY A 47 ? GLY A 624 . ? 1_555 ? 2 AC1 17 VAL A 48 ? VAL A 625 . ? 1_555 ? 3 AC1 17 TYR A 49 ? TYR A 626 . ? 1_555 ? 4 AC1 17 HIS A 53 ? HIS A 630 . ? 1_555 ? 5 AC1 17 GLY A 55 ? GLY A 632 . ? 1_555 ? 6 AC1 17 HIS A 56 ? HIS A 633 . ? 1_555 ? 7 AC1 17 GLN A 59 ? GLN A 636 . ? 1_555 ? 8 AC1 17 ASP A 133 ? ASP A 710 . ? 1_555 ? 9 AC1 17 GLN A 159 ? GLN A 754 . ? 1_555 ? 10 AC1 17 ARG A 160 ? ARG A 755 . ? 1_555 ? 11 AC1 17 THR A 161 ? THR A 756 . ? 1_555 ? 12 AC1 17 HOH C . ? HOH A 905 . ? 1_555 ? 13 AC1 17 HOH C . ? HOH A 908 . ? 1_555 ? 14 AC1 17 HOH C . ? HOH A 913 . ? 1_555 ? 15 AC1 17 HOH C . ? HOH A 916 . ? 1_555 ? 16 AC1 17 HOH C . ? HOH A 920 . ? 1_555 ? 17 AC1 17 HOH C . ? HOH A 936 . ? 1_555 ? # _atom_sites.entry_id 4ZCP _atom_sites.fract_transf_matrix[1][1] 0.019794 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014430 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008588 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 578 ? ? ? A . n A 1 2 HIS 2 579 ? ? ? A . n A 1 3 MET 3 580 ? ? ? A . n A 1 4 ALA 4 581 ? ? ? A . n A 1 5 VAL 5 582 ? ? ? A . n A 1 6 PRO 6 583 ? ? ? A . n A 1 7 ASP 7 584 ? ? ? A . n A 1 8 ASP 8 585 ? ? ? A . n A 1 9 ASP 9 586 ? ? ? A . n A 1 10 ASP 10 587 ? ? ? A . n A 1 11 ASP 11 588 ? ? ? A . n A 1 12 ASP 12 589 ? ? ? A . n A 1 13 ASP 13 590 ? ? ? A . n A 1 14 ASN 14 591 ? ? ? A . n A 1 15 SER 15 592 ? ? ? A . n A 1 16 ASN 16 593 ? ? ? A . n A 1 17 ASP 17 594 ? ? ? A . n A 1 18 GLU 18 595 ? ? ? A . n A 1 19 SER 19 596 ? ? ? A . n A 1 20 GLU 20 597 ? ? ? A . n A 1 21 TYR 21 598 ? ? ? A . n A 1 22 GLU 22 599 ? ? ? A . n A 1 23 SER 23 600 ? ? ? A . n A 1 24 SER 24 601 ? ? ? A . n A 1 25 GLN 25 602 ? ? ? A . n A 1 26 MET 26 603 ? ? ? A . n A 1 27 ASP 27 604 ? ? ? A . n A 1 28 SER 28 605 ? ? ? A . n A 1 29 GLU 29 606 ? ? ? A . n A 1 30 LYS 30 607 ? ? ? A . n A 1 31 ASN 31 608 ? ? ? A . n A 1 32 LYS 32 609 ? ? ? A . n A 1 33 GLY 33 610 ? ? ? A . n A 1 34 SER 34 611 ? ? ? A . n A 1 35 ILE 35 612 ? ? ? A . n A 1 36 LYS 36 613 ? ? ? A . n A 1 37 ASN 37 614 ? ? ? A . n A 1 38 SER 38 615 ? ? ? A . n A 1 39 LYS 39 616 616 LYS LYS A . n A 1 40 ASN 40 617 617 ASN ASN A . n A 1 41 VAL 41 618 618 VAL VAL A . n A 1 42 VAL 42 619 619 VAL VAL A . n A 1 43 ILE 43 620 620 ILE ILE A . n A 1 44 TYR 44 621 621 TYR TYR A . n A 1 45 ALA 45 622 622 ALA ALA A . n A 1 46 ASP 46 623 623 ASP ASP A . n A 1 47 GLY 47 624 624 GLY GLY A . n A 1 48 VAL 48 625 625 VAL VAL A . n A 1 49 TYR 49 626 626 TYR TYR A . n A 1 50 ASP 50 627 627 ASP ASP A . n A 1 51 MET 51 628 628 MET MET A . n A 1 52 LEU 52 629 629 LEU LEU A . n A 1 53 HIS 53 630 630 HIS HIS A . n A 1 54 LEU 54 631 631 LEU LEU A . n A 1 55 GLY 55 632 632 GLY GLY A . n A 1 56 HIS 56 633 633 HIS HIS A . n A 1 57 MET 57 634 634 MET MET A . n A 1 58 LYS 58 635 635 LYS LYS A . n A 1 59 GLN 59 636 636 GLN GLN A . n A 1 60 LEU 60 637 637 LEU LEU A . n A 1 61 GLU 61 638 638 GLU GLU A . n A 1 62 GLN 62 639 639 GLN GLN A . n A 1 63 ALA 63 640 640 ALA ALA A . n A 1 64 LYS 64 641 641 LYS LYS A . n A 1 65 LYS 65 642 642 LYS LYS A . n A 1 66 LEU 66 643 643 LEU LEU A . n A 1 67 PHE 67 644 644 PHE PHE A . n A 1 68 GLU 68 645 645 GLU GLU A . n A 1 69 ASN 69 646 646 ASN ASN A . n A 1 70 THR 70 647 647 THR THR A . n A 1 71 THR 71 648 648 THR THR A . n A 1 72 LEU 72 649 649 LEU LEU A . n A 1 73 ILE 73 650 650 ILE ILE A . n A 1 74 VAL 74 651 651 VAL VAL A . n A 1 75 GLY 75 652 652 GLY GLY A . n A 1 76 VAL 76 653 653 VAL VAL A . n A 1 77 THR 77 654 654 THR THR A . n A 1 78 SER 78 655 655 SER SER A . n A 1 79 ASP 79 656 656 ASP ASP A . n A 1 80 ASN 80 657 657 ASN ASN A . n A 1 81 GLU 81 658 658 GLU GLU A . n A 1 82 THR 82 659 659 THR THR A . n A 1 83 LYS 83 660 660 LYS LYS A . n A 1 84 LEU 84 661 661 LEU LEU A . n A 1 85 PHE 85 662 662 PHE PHE A . n A 1 86 LYS 86 663 663 LYS LYS A . n A 1 87 GLY 87 664 664 GLY GLY A . n A 1 88 GLN 88 665 665 GLN GLN A . n A 1 89 VAL 89 666 666 VAL VAL A . n A 1 90 VAL 90 667 667 VAL VAL A . n A 1 91 GLN 91 668 668 GLN GLN A . n A 1 92 THR 92 669 669 THR THR A . n A 1 93 LEU 93 670 670 LEU LEU A . n A 1 94 GLU 94 671 671 GLU GLU A . n A 1 95 GLU 95 672 672 GLU GLU A . n A 1 96 ARG 96 673 673 ARG ARG A . n A 1 97 THR 97 674 674 THR THR A . n A 1 98 GLU 98 675 675 GLU GLU A . n A 1 99 THR 99 676 676 THR THR A . n A 1 100 LEU 100 677 677 LEU LEU A . n A 1 101 LYS 101 678 678 LYS LYS A . n A 1 102 HIS 102 679 679 HIS HIS A . n A 1 103 ILE 103 680 680 ILE ILE A . n A 1 104 ARG 104 681 681 ARG ARG A . n A 1 105 TRP 105 682 682 TRP TRP A . n A 1 106 VAL 106 683 683 VAL VAL A . n A 1 107 ASP 107 684 684 ASP ASP A . n A 1 108 GLU 108 685 685 GLU GLU A . n A 1 109 ILE 109 686 686 ILE ILE A . n A 1 110 ILE 110 687 687 ILE ILE A . n A 1 111 SER 111 688 688 SER SER A . n A 1 112 PRO 112 689 689 PRO PRO A . n A 1 113 CYS 113 690 690 CYS CYS A . n A 1 114 PRO 114 691 691 PRO PRO A . n A 1 115 TRP 115 692 692 TRP TRP A . n A 1 116 VAL 116 693 693 VAL VAL A . n A 1 117 VAL 117 694 694 VAL VAL A . n A 1 118 THR 118 695 695 THR THR A . n A 1 119 PRO 119 696 696 PRO PRO A . n A 1 120 GLU 120 697 697 GLU GLU A . n A 1 121 PHE 121 698 698 PHE PHE A . n A 1 122 LEU 122 699 699 LEU LEU A . n A 1 123 GLU 123 700 700 GLU GLU A . n A 1 124 LYS 124 701 701 LYS LYS A . n A 1 125 TYR 125 702 702 TYR TYR A . n A 1 126 LYS 126 703 703 LYS LYS A . n A 1 127 ILE 127 704 704 ILE ILE A . n A 1 128 ASP 128 705 705 ASP ASP A . n A 1 129 TYR 129 706 706 TYR TYR A . n A 1 130 VAL 130 707 707 VAL VAL A . n A 1 131 ALA 131 708 708 ALA ALA A . n A 1 132 HIS 132 709 709 HIS HIS A . n A 1 133 ASP 133 710 710 ASP ASP A . n A 1 134 ASP 134 711 711 ASP ASP A . n A 1 135 ILE 135 712 712 ILE ILE A . n A 1 136 PRO 136 731 ? ? ? A . n A 1 137 TYR 137 732 ? ? ? A . n A 1 138 ALA 138 733 ? ? ? A . n A 1 139 ASN 139 734 ? ? ? A . n A 1 140 ASN 140 735 ? ? ? A . n A 1 141 GLN 141 736 ? ? ? A . n A 1 142 LYS 142 737 ? ? ? A . n A 1 143 GLU 143 738 ? ? ? A . n A 1 144 ASP 144 739 739 ASP ASP A . n A 1 145 ILE 145 740 740 ILE ILE A . n A 1 146 TYR 146 741 741 TYR TYR A . n A 1 147 ALA 147 742 742 ALA ALA A . n A 1 148 TRP 148 743 743 TRP TRP A . n A 1 149 LEU 149 744 744 LEU LEU A . n A 1 150 LYS 150 745 745 LYS LYS A . n A 1 151 ARG 151 746 746 ARG ARG A . n A 1 152 ALA 152 747 747 ALA ALA A . n A 1 153 GLY 153 748 748 GLY GLY A . n A 1 154 LYS 154 749 749 LYS LYS A . n A 1 155 PHE 155 750 750 PHE PHE A . n A 1 156 LYS 156 751 751 LYS LYS A . n A 1 157 ALA 157 752 752 ALA ALA A . n A 1 158 THR 158 753 753 THR THR A . n A 1 159 GLN 159 754 754 GLN GLN A . n A 1 160 ARG 160 755 755 ARG ARG A . n A 1 161 THR 161 756 756 THR THR A . n A 1 162 GLU 162 757 757 GLU GLU A . n A 1 163 GLY 163 758 758 GLY GLY A . n A 1 164 VAL 164 759 759 VAL VAL A . n A 1 165 SER 165 760 760 SER SER A . n A 1 166 THR 166 761 761 THR THR A . n A 1 167 THR 167 762 762 THR THR A . n A 1 168 ASP 168 763 763 ASP ASP A . n A 1 169 LEU 169 764 764 LEU LEU A . n A 1 170 ILE 170 765 765 ILE ILE A . n A 1 171 VAL 171 766 766 VAL VAL A . n A 1 172 ARG 172 767 767 ARG ARG A . n A 1 173 ILE 173 768 768 ILE ILE A . n A 1 174 LEU 174 769 769 LEU LEU A . n A 1 175 LYS 175 770 770 LYS LYS A . n A 1 176 ASN 176 771 ? ? ? A . n A 1 177 TYR 177 772 ? ? ? A . n A 1 178 GLU 178 773 ? ? ? A . n A 1 179 ASP 179 774 ? ? ? A . n A 1 180 TYR 180 775 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 C5P 1 801 1 C5P C5P A . C 3 HOH 1 901 43 HOH HOH A . C 3 HOH 2 902 8 HOH HOH A . C 3 HOH 3 903 38 HOH HOH A . C 3 HOH 4 904 22 HOH HOH A . C 3 HOH 5 905 39 HOH HOH A . C 3 HOH 6 906 1 HOH HOH A . C 3 HOH 7 907 30 HOH HOH A . C 3 HOH 8 908 33 HOH HOH A . C 3 HOH 9 909 4 HOH HOH A . C 3 HOH 10 910 35 HOH HOH A . C 3 HOH 11 911 9 HOH HOH A . C 3 HOH 12 912 14 HOH HOH A . C 3 HOH 13 913 10 HOH HOH A . C 3 HOH 14 914 29 HOH HOH A . C 3 HOH 15 915 15 HOH HOH A . C 3 HOH 16 916 3 HOH HOH A . C 3 HOH 17 917 32 HOH HOH A . C 3 HOH 18 918 34 HOH HOH A . C 3 HOH 19 919 11 HOH HOH A . C 3 HOH 20 920 2 HOH HOH A . C 3 HOH 21 921 7 HOH HOH A . C 3 HOH 22 922 5 HOH HOH A . C 3 HOH 23 923 42 HOH HOH A . C 3 HOH 24 924 21 HOH HOH A . C 3 HOH 25 925 12 HOH HOH A . C 3 HOH 26 926 6 HOH HOH A . C 3 HOH 27 927 17 HOH HOH A . C 3 HOH 28 928 13 HOH HOH A . C 3 HOH 29 929 16 HOH HOH A . C 3 HOH 30 930 18 HOH HOH A . C 3 HOH 31 931 36 HOH HOH A . C 3 HOH 32 932 25 HOH HOH A . C 3 HOH 33 933 41 HOH HOH A . C 3 HOH 34 934 27 HOH HOH A . C 3 HOH 35 935 28 HOH HOH A . C 3 HOH 36 936 40 HOH HOH A . C 3 HOH 37 937 37 HOH HOH A . C 3 HOH 38 938 20 HOH HOH A . C 3 HOH 39 939 19 HOH HOH A . C 3 HOH 40 940 31 HOH HOH A . C 3 HOH 41 941 23 HOH HOH A . C 3 HOH 42 942 24 HOH HOH A . C 3 HOH 43 943 26 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,C 1 2 A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_595 -x,-y+4,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 277.2000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-09-14 2 'Structure model' 1 1 2018-08-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0073 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 711 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -109.95 _pdbx_validate_torsion.psi 74.71 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 660 ? CG ? A LYS 83 CG 2 1 Y 1 A LYS 660 ? CD ? A LYS 83 CD 3 1 Y 1 A LYS 660 ? CE ? A LYS 83 CE 4 1 Y 1 A LYS 660 ? NZ ? A LYS 83 NZ 5 1 Y 1 A LEU 661 ? CG ? A LEU 84 CG 6 1 Y 1 A LEU 661 ? CD1 ? A LEU 84 CD1 7 1 Y 1 A LEU 661 ? CD2 ? A LEU 84 CD2 8 1 Y 1 A LYS 663 ? CG ? A LYS 86 CG 9 1 Y 1 A LYS 663 ? CD ? A LYS 86 CD 10 1 Y 1 A LYS 663 ? CE ? A LYS 86 CE 11 1 Y 1 A LYS 663 ? NZ ? A LYS 86 NZ 12 1 Y 1 A GLN 665 ? CB ? A GLN 88 CB 13 1 Y 1 A GLN 665 ? CG ? A GLN 88 CG 14 1 Y 1 A GLN 665 ? CD ? A GLN 88 CD 15 1 Y 1 A GLN 665 ? OE1 ? A GLN 88 OE1 16 1 Y 1 A GLN 665 ? NE2 ? A GLN 88 NE2 17 1 Y 1 A LYS 703 ? CE ? A LYS 126 CE 18 1 Y 1 A LYS 703 ? NZ ? A LYS 126 NZ 19 1 Y 1 A ILE 712 ? CG1 ? A ILE 135 CG1 20 1 Y 1 A ILE 712 ? CG2 ? A ILE 135 CG2 21 1 Y 1 A ILE 712 ? CD1 ? A ILE 135 CD1 22 1 Y 1 A GLU 757 ? CD ? A GLU 162 CD 23 1 Y 1 A GLU 757 ? OE1 ? A GLU 162 OE1 24 1 Y 1 A GLU 757 ? OE2 ? A GLU 162 OE2 25 1 Y 1 A ILE 765 ? CD1 ? A ILE 170 CD1 26 1 Y 1 A ILE 768 ? CD1 ? A ILE 173 CD1 27 1 Y 1 A LEU 769 ? CD1 ? A LEU 174 CD1 28 1 Y 1 A LEU 769 ? CD2 ? A LEU 174 CD2 29 1 Y 1 A LYS 770 ? CG ? A LYS 175 CG 30 1 Y 1 A LYS 770 ? CD ? A LYS 175 CD 31 1 Y 1 A LYS 770 ? CE ? A LYS 175 CE 32 1 Y 1 A LYS 770 ? NZ ? A LYS 175 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 578 ? A GLY 1 2 1 Y 1 A HIS 579 ? A HIS 2 3 1 Y 1 A MET 580 ? A MET 3 4 1 Y 1 A ALA 581 ? A ALA 4 5 1 Y 1 A VAL 582 ? A VAL 5 6 1 Y 1 A PRO 583 ? A PRO 6 7 1 Y 1 A ASP 584 ? A ASP 7 8 1 Y 1 A ASP 585 ? A ASP 8 9 1 Y 1 A ASP 586 ? A ASP 9 10 1 Y 1 A ASP 587 ? A ASP 10 11 1 Y 1 A ASP 588 ? A ASP 11 12 1 Y 1 A ASP 589 ? A ASP 12 13 1 Y 1 A ASP 590 ? A ASP 13 14 1 Y 1 A ASN 591 ? A ASN 14 15 1 Y 1 A SER 592 ? A SER 15 16 1 Y 1 A ASN 593 ? A ASN 16 17 1 Y 1 A ASP 594 ? A ASP 17 18 1 Y 1 A GLU 595 ? A GLU 18 19 1 Y 1 A SER 596 ? A SER 19 20 1 Y 1 A GLU 597 ? A GLU 20 21 1 Y 1 A TYR 598 ? A TYR 21 22 1 Y 1 A GLU 599 ? A GLU 22 23 1 Y 1 A SER 600 ? A SER 23 24 1 Y 1 A SER 601 ? A SER 24 25 1 Y 1 A GLN 602 ? A GLN 25 26 1 Y 1 A MET 603 ? A MET 26 27 1 Y 1 A ASP 604 ? A ASP 27 28 1 Y 1 A SER 605 ? A SER 28 29 1 Y 1 A GLU 606 ? A GLU 29 30 1 Y 1 A LYS 607 ? A LYS 30 31 1 Y 1 A ASN 608 ? A ASN 31 32 1 Y 1 A LYS 609 ? A LYS 32 33 1 Y 1 A GLY 610 ? A GLY 33 34 1 Y 1 A SER 611 ? A SER 34 35 1 Y 1 A ILE 612 ? A ILE 35 36 1 Y 1 A LYS 613 ? A LYS 36 37 1 Y 1 A ASN 614 ? A ASN 37 38 1 Y 1 A SER 615 ? A SER 38 39 1 Y 1 A PRO 731 ? A PRO 136 40 1 Y 1 A TYR 732 ? A TYR 137 41 1 Y 1 A ALA 733 ? A ALA 138 42 1 Y 1 A ASN 734 ? A ASN 139 43 1 Y 1 A ASN 735 ? A ASN 140 44 1 Y 1 A GLN 736 ? A GLN 141 45 1 Y 1 A LYS 737 ? A LYS 142 46 1 Y 1 A GLU 738 ? A GLU 143 47 1 Y 1 A ASN 771 ? A ASN 176 48 1 Y 1 A TYR 772 ? A TYR 177 49 1 Y 1 A GLU 773 ? A GLU 178 50 1 Y 1 A ASP 774 ? A ASP 179 51 1 Y 1 A TYR 775 ? A TYR 180 # _pdbx_audit_support.funding_organization 'EU-ITN Marie Curie Paramet' _pdbx_audit_support.country France _pdbx_audit_support.grant_number 290080 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 "CYTIDINE-5'-MONOPHOSPHATE" C5P 3 water HOH #