data_4ZCT # _entry.id 4ZCT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.296 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4ZCT WWPDB D_1000208859 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '4ZCP contains the same protein complexed with CMP.' 4ZCP unspecified PDB '4ZCQ contains the same protein complexed with choline.' 4ZCQ unspecified PDB '4ZCR contains the same protein complexed with phosphocholine.' 4ZCR unspecified PDB '4ZCS contains the same protein complexed with CDP-choline.' 4ZCS unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4ZCT _pdbx_database_status.recvd_initial_deposition_date 2015-04-16 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Guca, E.' 1 'Hoh, F.' 2 'Guichou, J.-F.' 3 'Cerdan, R.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 8 _citation.language ? _citation.page_first 11215 _citation.page_last 11215 _citation.title 'Structural determinants of the catalytic mechanism of Plasmodium CCT, a key enzyme of malaria lipid biosynthesis.' _citation.year 2018 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/s41598-018-29500-9 _citation.pdbx_database_id_PubMed 30046154 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Guca, E.' 1 ? primary 'Nagy, G.N.' 2 ? primary 'Hajdu, F.' 3 ? primary 'Marton, L.' 4 ? primary 'Izrael, R.' 5 ? primary 'Hoh, F.' 6 ? primary 'Yang, Y.' 7 ? primary 'Vial, H.' 8 ? primary 'Vertessy, B.G.' 9 ? primary 'Guichou, J.F.' 10 ? primary 'Cerdan, R.' 11 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4ZCT _cell.details ? _cell.formula_units_Z ? _cell.length_a 48.500 _cell.length_a_esd ? _cell.length_b 74.390 _cell.length_b_esd ? _cell.length_c 118.980 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4ZCT _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cholinephosphate cytidylyltransferase' 20810.123 1 2.7.7.15 ? 'UNP residues 581-775' ? 2 water nat water 18.015 98 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMAVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDN ETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQR TEGVSTTDLIVRILKNYEDY ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMAVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDN ETKLFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKEDIYAWLKRAGKFKATQR TEGVSTTDLIVRILKNYEDY ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ALA n 1 5 VAL n 1 6 PRO n 1 7 ASP n 1 8 ASP n 1 9 ASP n 1 10 ASP n 1 11 ASP n 1 12 ASP n 1 13 ASP n 1 14 ASN n 1 15 SER n 1 16 ASN n 1 17 ASP n 1 18 GLU n 1 19 SER n 1 20 GLU n 1 21 TYR n 1 22 GLU n 1 23 SER n 1 24 SER n 1 25 GLN n 1 26 MET n 1 27 ASP n 1 28 SER n 1 29 GLU n 1 30 LYS n 1 31 ASN n 1 32 LYS n 1 33 GLY n 1 34 SER n 1 35 ILE n 1 36 LYS n 1 37 ASN n 1 38 SER n 1 39 LYS n 1 40 ASN n 1 41 VAL n 1 42 VAL n 1 43 ILE n 1 44 TYR n 1 45 ALA n 1 46 ASP n 1 47 GLY n 1 48 VAL n 1 49 TYR n 1 50 ASP n 1 51 MET n 1 52 LEU n 1 53 HIS n 1 54 LEU n 1 55 GLY n 1 56 HIS n 1 57 MET n 1 58 LYS n 1 59 GLN n 1 60 LEU n 1 61 GLU n 1 62 GLN n 1 63 ALA n 1 64 LYS n 1 65 LYS n 1 66 LEU n 1 67 PHE n 1 68 GLU n 1 69 ASN n 1 70 THR n 1 71 THR n 1 72 LEU n 1 73 ILE n 1 74 VAL n 1 75 GLY n 1 76 VAL n 1 77 THR n 1 78 SER n 1 79 ASP n 1 80 ASN n 1 81 GLU n 1 82 THR n 1 83 LYS n 1 84 LEU n 1 85 PHE n 1 86 LYS n 1 87 GLY n 1 88 GLN n 1 89 VAL n 1 90 VAL n 1 91 GLN n 1 92 THR n 1 93 LEU n 1 94 GLU n 1 95 GLU n 1 96 ARG n 1 97 THR n 1 98 GLU n 1 99 THR n 1 100 LEU n 1 101 LYS n 1 102 HIS n 1 103 ILE n 1 104 ARG n 1 105 TRP n 1 106 VAL n 1 107 ASP n 1 108 GLU n 1 109 ILE n 1 110 ILE n 1 111 SER n 1 112 PRO n 1 113 CYS n 1 114 PRO n 1 115 TRP n 1 116 VAL n 1 117 VAL n 1 118 THR n 1 119 PRO n 1 120 GLU n 1 121 PHE n 1 122 LEU n 1 123 GLU n 1 124 LYS n 1 125 TYR n 1 126 LYS n 1 127 ILE n 1 128 ASP n 1 129 TYR n 1 130 VAL n 1 131 ALA n 1 132 HIS n 1 133 ASP n 1 134 ASP n 1 135 ILE n 1 136 PRO n 1 137 TYR n 1 138 ALA n 1 139 ASN n 1 140 ASN n 1 141 GLN n 1 142 LYS n 1 143 GLU n 1 144 ASP n 1 145 ILE n 1 146 TYR n 1 147 ALA n 1 148 TRP n 1 149 LEU n 1 150 LYS n 1 151 ARG n 1 152 ALA n 1 153 GLY n 1 154 LYS n 1 155 PHE n 1 156 LYS n 1 157 ALA n 1 158 THR n 1 159 GLN n 1 160 ARG n 1 161 THR n 1 162 GLU n 1 163 GLY n 1 164 VAL n 1 165 SER n 1 166 THR n 1 167 THR n 1 168 ASP n 1 169 LEU n 1 170 ILE n 1 171 VAL n 1 172 ARG n 1 173 ILE n 1 174 LEU n 1 175 LYS n 1 176 ASN n 1 177 TYR n 1 178 GLU n 1 179 ASP n 1 180 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 180 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'ctP, MAL13P1.86' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'isolate 3D7' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Plasmodium falciparum' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 36329 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8IEE9_PLAF7 _struct_ref.pdbx_db_accession Q8IEE9 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;AVPDDDDDDDNSNDESEYESSQMDSEKNKGSIKNSKNVVIYADGVYDMLHLGHMKQLEQAKKLFENTTLIVGVTSDNETK LFKGQVVQTLEERTETLKHIRWVDEIISPCPWVVTPEFLEKYKIDYVAHDDIPYANNQKKKKKKKSKGKSFSFDEENEDI YAWLKRAGKFKATQRTEGVSTTDLIVRILKNYEDY ; _struct_ref.pdbx_align_begin 581 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4ZCT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8IEE9 _struct_ref_seq.db_align_beg 581 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 775 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 581 _struct_ref_seq.pdbx_auth_seq_align_end 775 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4ZCT GLY A 1 ? UNP Q8IEE9 ? ? 'expression tag' 578 1 1 4ZCT HIS A 2 ? UNP Q8IEE9 ? ? 'expression tag' 579 2 1 4ZCT MET A 3 ? UNP Q8IEE9 ? ? 'expression tag' 580 3 1 4ZCT ? A ? ? UNP Q8IEE9 LYS 720 deletion ? 4 1 4ZCT ? A ? ? UNP Q8IEE9 LYS 721 deletion ? 5 1 4ZCT ? A ? ? UNP Q8IEE9 LYS 722 deletion ? 6 1 4ZCT ? A ? ? UNP Q8IEE9 LYS 723 deletion ? 7 1 4ZCT ? A ? ? UNP Q8IEE9 LYS 724 deletion ? 8 1 4ZCT ? A ? ? UNP Q8IEE9 LYS 725 deletion ? 9 1 4ZCT ? A ? ? UNP Q8IEE9 SER 726 deletion ? 10 1 4ZCT ? A ? ? UNP Q8IEE9 LYS 727 deletion ? 11 1 4ZCT ? A ? ? UNP Q8IEE9 GLY 728 deletion ? 12 1 4ZCT ? A ? ? UNP Q8IEE9 LYS 729 deletion ? 13 1 4ZCT ? A ? ? UNP Q8IEE9 SER 730 deletion ? 14 1 4ZCT ? A ? ? UNP Q8IEE9 PHE 731 deletion ? 15 1 4ZCT ? A ? ? UNP Q8IEE9 SER 732 deletion ? 16 1 4ZCT ? A ? ? UNP Q8IEE9 PHE 733 deletion ? 17 1 4ZCT ? A ? ? UNP Q8IEE9 ASP 734 deletion ? 18 1 4ZCT ? A ? ? UNP Q8IEE9 GLU 735 deletion ? 19 1 4ZCT ? A ? ? UNP Q8IEE9 GLU 736 deletion ? 20 1 4ZCT ? A ? ? UNP Q8IEE9 ASN 737 deletion ? 21 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4ZCT _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.30 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20% PEG 43350, 0.1M NaF' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M-F' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-06-25 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97625 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID29' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97625 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID29 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4ZCT _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.220 _reflns.d_resolution_low 40.628 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 10780 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.93 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.087 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4ZCT _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.220 _refine.ls_d_res_low 40.628 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 10780 _refine.ls_number_reflns_R_free 517 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.93 _refine.ls_percent_reflns_R_free 4.80 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2021 _refine.ls_R_factor_R_free 0.2426 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2000 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.39 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4ZCS _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 22.37 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.18 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1083 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 98 _refine_hist.number_atoms_total 1181 _refine_hist.d_res_high 2.220 _refine_hist.d_res_low 40.628 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1142 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.003 ? 1554 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.034 ? 434 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.039 ? 180 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 193 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.2200 2.4434 . . 125 2495 98.00 . . . 0.2888 . 0.2182 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4434 2.7969 . . 134 2544 99.00 . . . 0.2697 . 0.2143 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7969 3.5235 . . 124 2567 98.00 . . . 0.2385 . 0.1988 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5235 40.6347 . . 134 2657 98.00 . . . 0.2148 . 0.1869 . . . . . . . . . . # _struct.entry_id 4ZCT _struct.title 'Crystal structure of the C-terminal catalytic domain of Plasmodium falciparum CTP:phosphocholine cytidylyltransferase' _struct.pdbx_descriptor 'CTP:phosphocholine cytidylyltransferase (E.C.2.7.7.15)' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4ZCT _struct_keywords.text 'transferase, malaria, cytidylyltransferase, phosphatidylcholine' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 53 ? LYS A 65 ? HIS A 630 LYS A 642 1 ? 13 HELX_P HELX_P2 AA2 SER A 78 ? LYS A 86 ? SER A 655 LYS A 663 1 ? 9 HELX_P HELX_P3 AA3 THR A 92 ? LYS A 101 ? THR A 669 LYS A 678 1 ? 10 HELX_P HELX_P4 AA4 THR A 118 ? TYR A 125 ? THR A 695 TYR A 702 1 ? 8 HELX_P HELX_P5 AA5 TYR A 146 ? ALA A 152 ? TYR A 741 ALA A 747 1 ? 7 HELX_P HELX_P6 AA6 SER A 165 ? LYS A 175 ? SER A 760 LYS A 770 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 111 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 688 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 112 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 689 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 1.26 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 108 ? ILE A 110 ? GLU A 685 ILE A 687 AA1 2 THR A 70 ? VAL A 76 ? THR A 647 VAL A 653 AA1 3 VAL A 41 ? GLY A 47 ? VAL A 618 GLY A 624 AA1 4 TYR A 129 ? ASP A 133 ? TYR A 706 ASP A 710 AA1 5 PHE A 155 ? THR A 158 ? PHE A 750 THR A 753 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 110 ? O ILE A 687 N VAL A 74 ? N VAL A 651 AA1 2 3 O ILE A 73 ? O ILE A 650 N ILE A 43 ? N ILE A 620 AA1 3 4 N TYR A 44 ? N TYR A 621 O ALA A 131 ? O ALA A 708 AA1 4 5 N VAL A 130 ? N VAL A 707 O LYS A 156 ? O LYS A 751 # _atom_sites.entry_id 4ZCT _atom_sites.fract_transf_matrix[1][1] 0.020619 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013443 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008405 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 578 ? ? ? A . n A 1 2 HIS 2 579 ? ? ? A . n A 1 3 MET 3 580 ? ? ? A . n A 1 4 ALA 4 581 ? ? ? A . n A 1 5 VAL 5 582 ? ? ? A . n A 1 6 PRO 6 583 ? ? ? A . n A 1 7 ASP 7 584 ? ? ? A . n A 1 8 ASP 8 585 ? ? ? A . n A 1 9 ASP 9 586 ? ? ? A . n A 1 10 ASP 10 587 ? ? ? A . n A 1 11 ASP 11 588 ? ? ? A . n A 1 12 ASP 12 589 ? ? ? A . n A 1 13 ASP 13 590 ? ? ? A . n A 1 14 ASN 14 591 ? ? ? A . n A 1 15 SER 15 592 ? ? ? A . n A 1 16 ASN 16 593 ? ? ? A . n A 1 17 ASP 17 594 ? ? ? A . n A 1 18 GLU 18 595 ? ? ? A . n A 1 19 SER 19 596 ? ? ? A . n A 1 20 GLU 20 597 ? ? ? A . n A 1 21 TYR 21 598 ? ? ? A . n A 1 22 GLU 22 599 ? ? ? A . n A 1 23 SER 23 600 ? ? ? A . n A 1 24 SER 24 601 ? ? ? A . n A 1 25 GLN 25 602 ? ? ? A . n A 1 26 MET 26 603 ? ? ? A . n A 1 27 ASP 27 604 ? ? ? A . n A 1 28 SER 28 605 ? ? ? A . n A 1 29 GLU 29 606 ? ? ? A . n A 1 30 LYS 30 607 ? ? ? A . n A 1 31 ASN 31 608 ? ? ? A . n A 1 32 LYS 32 609 ? ? ? A . n A 1 33 GLY 33 610 ? ? ? A . n A 1 34 SER 34 611 ? ? ? A . n A 1 35 ILE 35 612 ? ? ? A . n A 1 36 LYS 36 613 ? ? ? A . n A 1 37 ASN 37 614 ? ? ? A . n A 1 38 SER 38 615 ? ? ? A . n A 1 39 LYS 39 616 616 LYS LYS A . n A 1 40 ASN 40 617 617 ASN ASN A . n A 1 41 VAL 41 618 618 VAL VAL A . n A 1 42 VAL 42 619 619 VAL VAL A . n A 1 43 ILE 43 620 620 ILE ILE A . n A 1 44 TYR 44 621 621 TYR TYR A . n A 1 45 ALA 45 622 622 ALA ALA A . n A 1 46 ASP 46 623 623 ASP ASP A . n A 1 47 GLY 47 624 624 GLY GLY A . n A 1 48 VAL 48 625 625 VAL VAL A . n A 1 49 TYR 49 626 626 TYR TYR A . n A 1 50 ASP 50 627 627 ASP ASP A . n A 1 51 MET 51 628 628 MET MET A . n A 1 52 LEU 52 629 629 LEU LEU A . n A 1 53 HIS 53 630 630 HIS HIS A . n A 1 54 LEU 54 631 631 LEU LEU A . n A 1 55 GLY 55 632 632 GLY GLY A . n A 1 56 HIS 56 633 633 HIS HIS A . n A 1 57 MET 57 634 634 MET MET A . n A 1 58 LYS 58 635 635 LYS LYS A . n A 1 59 GLN 59 636 636 GLN GLN A . n A 1 60 LEU 60 637 637 LEU LEU A . n A 1 61 GLU 61 638 638 GLU GLU A . n A 1 62 GLN 62 639 639 GLN GLN A . n A 1 63 ALA 63 640 640 ALA ALA A . n A 1 64 LYS 64 641 641 LYS LYS A . n A 1 65 LYS 65 642 642 LYS LYS A . n A 1 66 LEU 66 643 643 LEU LEU A . n A 1 67 PHE 67 644 644 PHE PHE A . n A 1 68 GLU 68 645 645 GLU GLU A . n A 1 69 ASN 69 646 646 ASN ASN A . n A 1 70 THR 70 647 647 THR THR A . n A 1 71 THR 71 648 648 THR THR A . n A 1 72 LEU 72 649 649 LEU LEU A . n A 1 73 ILE 73 650 650 ILE ILE A . n A 1 74 VAL 74 651 651 VAL VAL A . n A 1 75 GLY 75 652 652 GLY GLY A . n A 1 76 VAL 76 653 653 VAL VAL A . n A 1 77 THR 77 654 654 THR THR A . n A 1 78 SER 78 655 655 SER SER A . n A 1 79 ASP 79 656 656 ASP ASP A . n A 1 80 ASN 80 657 657 ASN ASN A . n A 1 81 GLU 81 658 658 GLU GLU A . n A 1 82 THR 82 659 659 THR THR A . n A 1 83 LYS 83 660 660 LYS LYS A . n A 1 84 LEU 84 661 661 LEU LEU A . n A 1 85 PHE 85 662 662 PHE PHE A . n A 1 86 LYS 86 663 663 LYS LYS A . n A 1 87 GLY 87 664 664 GLY GLY A . n A 1 88 GLN 88 665 665 GLN GLN A . n A 1 89 VAL 89 666 666 VAL VAL A . n A 1 90 VAL 90 667 667 VAL VAL A . n A 1 91 GLN 91 668 668 GLN GLN A . n A 1 92 THR 92 669 669 THR THR A . n A 1 93 LEU 93 670 670 LEU LEU A . n A 1 94 GLU 94 671 671 GLU GLU A . n A 1 95 GLU 95 672 672 GLU GLU A . n A 1 96 ARG 96 673 673 ARG ARG A . n A 1 97 THR 97 674 674 THR THR A . n A 1 98 GLU 98 675 675 GLU GLU A . n A 1 99 THR 99 676 676 THR THR A . n A 1 100 LEU 100 677 677 LEU LEU A . n A 1 101 LYS 101 678 678 LYS LYS A . n A 1 102 HIS 102 679 679 HIS HIS A . n A 1 103 ILE 103 680 680 ILE ILE A . n A 1 104 ARG 104 681 681 ARG ARG A . n A 1 105 TRP 105 682 682 TRP TRP A . n A 1 106 VAL 106 683 683 VAL VAL A . n A 1 107 ASP 107 684 684 ASP ASP A . n A 1 108 GLU 108 685 685 GLU GLU A . n A 1 109 ILE 109 686 686 ILE ILE A . n A 1 110 ILE 110 687 687 ILE ILE A . n A 1 111 SER 111 688 688 SER SER A . n A 1 112 PRO 112 689 689 PRO PRO A . n A 1 113 CYS 113 690 690 CYS CYS A . n A 1 114 PRO 114 691 691 PRO PRO A . n A 1 115 TRP 115 692 692 TRP TRP A . n A 1 116 VAL 116 693 693 VAL VAL A . n A 1 117 VAL 117 694 694 VAL VAL A . n A 1 118 THR 118 695 695 THR THR A . n A 1 119 PRO 119 696 696 PRO PRO A . n A 1 120 GLU 120 697 697 GLU GLU A . n A 1 121 PHE 121 698 698 PHE PHE A . n A 1 122 LEU 122 699 699 LEU LEU A . n A 1 123 GLU 123 700 700 GLU GLU A . n A 1 124 LYS 124 701 701 LYS LYS A . n A 1 125 TYR 125 702 702 TYR TYR A . n A 1 126 LYS 126 703 703 LYS LYS A . n A 1 127 ILE 127 704 704 ILE ILE A . n A 1 128 ASP 128 705 705 ASP ASP A . n A 1 129 TYR 129 706 706 TYR TYR A . n A 1 130 VAL 130 707 707 VAL VAL A . n A 1 131 ALA 131 708 708 ALA ALA A . n A 1 132 HIS 132 709 709 HIS HIS A . n A 1 133 ASP 133 710 710 ASP ASP A . n A 1 134 ASP 134 711 711 ASP ASP A . n A 1 135 ILE 135 730 ? ? ? A . n A 1 136 PRO 136 731 ? ? ? A . n A 1 137 TYR 137 732 ? ? ? A . n A 1 138 ALA 138 733 ? ? ? A . n A 1 139 ASN 139 734 ? ? ? A . n A 1 140 ASN 140 735 ? ? ? A . n A 1 141 GLN 141 736 ? ? ? A . n A 1 142 LYS 142 737 ? ? ? A . n A 1 143 GLU 143 738 ? ? ? A . n A 1 144 ASP 144 739 739 ASP ASP A . n A 1 145 ILE 145 740 740 ILE ILE A . n A 1 146 TYR 146 741 741 TYR TYR A . n A 1 147 ALA 147 742 742 ALA ALA A . n A 1 148 TRP 148 743 743 TRP TRP A . n A 1 149 LEU 149 744 744 LEU LEU A . n A 1 150 LYS 150 745 745 LYS LYS A . n A 1 151 ARG 151 746 746 ARG ARG A . n A 1 152 ALA 152 747 747 ALA ALA A . n A 1 153 GLY 153 748 748 GLY GLY A . n A 1 154 LYS 154 749 749 LYS LYS A . n A 1 155 PHE 155 750 750 PHE PHE A . n A 1 156 LYS 156 751 751 LYS LYS A . n A 1 157 ALA 157 752 752 ALA ALA A . n A 1 158 THR 158 753 753 THR THR A . n A 1 159 GLN 159 754 754 GLN GLN A . n A 1 160 ARG 160 755 755 ARG ARG A . n A 1 161 THR 161 756 756 THR THR A . n A 1 162 GLU 162 757 757 GLU GLU A . n A 1 163 GLY 163 758 758 GLY GLY A . n A 1 164 VAL 164 759 759 VAL VAL A . n A 1 165 SER 165 760 760 SER SER A . n A 1 166 THR 166 761 761 THR THR A . n A 1 167 THR 167 762 762 THR THR A . n A 1 168 ASP 168 763 763 ASP ASP A . n A 1 169 LEU 169 764 764 LEU LEU A . n A 1 170 ILE 170 765 765 ILE ILE A . n A 1 171 VAL 171 766 766 VAL VAL A . n A 1 172 ARG 172 767 767 ARG ARG A . n A 1 173 ILE 173 768 768 ILE ILE A . n A 1 174 LEU 174 769 769 LEU LEU A . n A 1 175 LYS 175 770 770 LYS LYS A . n A 1 176 ASN 176 771 771 ASN ASN A . n A 1 177 TYR 177 772 772 TYR TYR A . n A 1 178 GLU 178 773 773 GLU GLU A . n A 1 179 ASP 179 774 774 ASP ASP A . n A 1 180 TYR 180 775 775 TYR TYR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 801 98 HOH HOH A . B 2 HOH 2 802 79 HOH HOH A . B 2 HOH 3 803 55 HOH HOH A . B 2 HOH 4 804 92 HOH HOH A . B 2 HOH 5 805 56 HOH HOH A . B 2 HOH 6 806 34 HOH HOH A . B 2 HOH 7 807 57 HOH HOH A . B 2 HOH 8 808 19 HOH HOH A . B 2 HOH 9 809 61 HOH HOH A . B 2 HOH 10 810 38 HOH HOH A . B 2 HOH 11 811 104 HOH HOH A . B 2 HOH 12 812 1 HOH HOH A . B 2 HOH 13 813 78 HOH HOH A . B 2 HOH 14 814 73 HOH HOH A . B 2 HOH 15 815 18 HOH HOH A . B 2 HOH 16 816 53 HOH HOH A . B 2 HOH 17 817 97 HOH HOH A . B 2 HOH 18 818 21 HOH HOH A . B 2 HOH 19 819 6 HOH HOH A . B 2 HOH 20 820 101 HOH HOH A . B 2 HOH 21 821 28 HOH HOH A . B 2 HOH 22 822 13 HOH HOH A . B 2 HOH 23 823 70 HOH HOH A . B 2 HOH 24 824 51 HOH HOH A . B 2 HOH 25 825 86 HOH HOH A . B 2 HOH 26 826 36 HOH HOH A . B 2 HOH 27 827 50 HOH HOH A . B 2 HOH 28 828 100 HOH HOH A . B 2 HOH 29 829 105 HOH HOH A . B 2 HOH 30 830 41 HOH HOH A . B 2 HOH 31 831 37 HOH HOH A . B 2 HOH 32 832 12 HOH HOH A . B 2 HOH 33 833 46 HOH HOH A . B 2 HOH 34 834 33 HOH HOH A . B 2 HOH 35 835 14 HOH HOH A . B 2 HOH 36 836 5 HOH HOH A . B 2 HOH 37 837 15 HOH HOH A . B 2 HOH 38 838 82 HOH HOH A . B 2 HOH 39 839 67 HOH HOH A . B 2 HOH 40 840 7 HOH HOH A . B 2 HOH 41 841 80 HOH HOH A . B 2 HOH 42 842 25 HOH HOH A . B 2 HOH 43 843 71 HOH HOH A . B 2 HOH 44 844 63 HOH HOH A . B 2 HOH 45 845 17 HOH HOH A . B 2 HOH 46 846 20 HOH HOH A . B 2 HOH 47 847 103 HOH HOH A . B 2 HOH 48 848 8 HOH HOH A . B 2 HOH 49 849 68 HOH HOH A . B 2 HOH 50 850 99 HOH HOH A . B 2 HOH 51 851 23 HOH HOH A . B 2 HOH 52 852 54 HOH HOH A . B 2 HOH 53 853 44 HOH HOH A . B 2 HOH 54 854 4 HOH HOH A . B 2 HOH 55 855 96 HOH HOH A . B 2 HOH 56 856 90 HOH HOH A . B 2 HOH 57 857 42 HOH HOH A . B 2 HOH 58 858 102 HOH HOH A . B 2 HOH 59 859 2 HOH HOH A . B 2 HOH 60 860 11 HOH HOH A . B 2 HOH 61 861 72 HOH HOH A . B 2 HOH 62 862 88 HOH HOH A . B 2 HOH 63 863 39 HOH HOH A . B 2 HOH 64 864 77 HOH HOH A . B 2 HOH 65 865 22 HOH HOH A . B 2 HOH 66 866 59 HOH HOH A . B 2 HOH 67 867 16 HOH HOH A . B 2 HOH 68 868 3 HOH HOH A . B 2 HOH 69 869 75 HOH HOH A . B 2 HOH 70 870 29 HOH HOH A . B 2 HOH 71 871 81 HOH HOH A . B 2 HOH 72 872 26 HOH HOH A . B 2 HOH 73 873 31 HOH HOH A . B 2 HOH 74 874 24 HOH HOH A . B 2 HOH 75 875 49 HOH HOH A . B 2 HOH 76 876 40 HOH HOH A . B 2 HOH 77 877 107 HOH HOH A . B 2 HOH 78 878 30 HOH HOH A . B 2 HOH 79 879 43 HOH HOH A . B 2 HOH 80 880 58 HOH HOH A . B 2 HOH 81 881 91 HOH HOH A . B 2 HOH 82 882 85 HOH HOH A . B 2 HOH 83 883 62 HOH HOH A . B 2 HOH 84 884 65 HOH HOH A . B 2 HOH 85 885 76 HOH HOH A . B 2 HOH 86 886 87 HOH HOH A . B 2 HOH 87 887 95 HOH HOH A . B 2 HOH 88 888 60 HOH HOH A . B 2 HOH 89 889 48 HOH HOH A . B 2 HOH 90 890 89 HOH HOH A . B 2 HOH 91 891 106 HOH HOH A . B 2 HOH 92 892 66 HOH HOH A . B 2 HOH 93 893 45 HOH HOH A . B 2 HOH 94 894 84 HOH HOH A . B 2 HOH 95 895 32 HOH HOH A . B 2 HOH 96 896 52 HOH HOH A . B 2 HOH 97 897 74 HOH HOH A . B 2 HOH 98 898 108 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2070 ? 1 MORE -7 ? 1 'SSA (A^2)' 14840 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A GLU 658 ? A GLU 81 2 1 A GLU 658 ? A GLU 81 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-09-14 2 'Structure model' 1 1 2018-08-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' citation_author # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 NH2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 ARG _pdbx_validate_close_contact.auth_seq_id_1 746 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 A _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 801 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.15 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A ASN 657 ? ? 1_555 CD2 A LEU 661 ? ? 2_455 1.01 2 1 C A ASN 657 ? ? 1_555 CD2 A LEU 661 ? ? 2_455 1.93 # _pdbx_validate_rmsd_bond.id 1 _pdbx_validate_rmsd_bond.PDB_model_num 1 _pdbx_validate_rmsd_bond.auth_atom_id_1 CD _pdbx_validate_rmsd_bond.auth_asym_id_1 A _pdbx_validate_rmsd_bond.auth_comp_id_1 GLU _pdbx_validate_rmsd_bond.auth_seq_id_1 658 _pdbx_validate_rmsd_bond.PDB_ins_code_1 ? _pdbx_validate_rmsd_bond.label_alt_id_1 ? _pdbx_validate_rmsd_bond.auth_atom_id_2 OE2 _pdbx_validate_rmsd_bond.auth_asym_id_2 A _pdbx_validate_rmsd_bond.auth_comp_id_2 GLU _pdbx_validate_rmsd_bond.auth_seq_id_2 658 _pdbx_validate_rmsd_bond.PDB_ins_code_2 ? _pdbx_validate_rmsd_bond.label_alt_id_2 ? _pdbx_validate_rmsd_bond.bond_value 1.186 _pdbx_validate_rmsd_bond.bond_target_value 1.252 _pdbx_validate_rmsd_bond.bond_deviation -0.066 _pdbx_validate_rmsd_bond.bond_standard_deviation 0.011 _pdbx_validate_rmsd_bond.linker_flag N # _pdbx_validate_rmsd_angle.id 1 _pdbx_validate_rmsd_angle.PDB_model_num 1 _pdbx_validate_rmsd_angle.auth_atom_id_1 CA _pdbx_validate_rmsd_angle.auth_asym_id_1 A _pdbx_validate_rmsd_angle.auth_comp_id_1 LEU _pdbx_validate_rmsd_angle.auth_seq_id_1 661 _pdbx_validate_rmsd_angle.PDB_ins_code_1 ? _pdbx_validate_rmsd_angle.label_alt_id_1 ? _pdbx_validate_rmsd_angle.auth_atom_id_2 CB _pdbx_validate_rmsd_angle.auth_asym_id_2 A _pdbx_validate_rmsd_angle.auth_comp_id_2 LEU _pdbx_validate_rmsd_angle.auth_seq_id_2 661 _pdbx_validate_rmsd_angle.PDB_ins_code_2 ? _pdbx_validate_rmsd_angle.label_alt_id_2 ? _pdbx_validate_rmsd_angle.auth_atom_id_3 CG _pdbx_validate_rmsd_angle.auth_asym_id_3 A _pdbx_validate_rmsd_angle.auth_comp_id_3 LEU _pdbx_validate_rmsd_angle.auth_seq_id_3 661 _pdbx_validate_rmsd_angle.PDB_ins_code_3 ? _pdbx_validate_rmsd_angle.label_alt_id_3 ? _pdbx_validate_rmsd_angle.angle_value 129.24 _pdbx_validate_rmsd_angle.angle_target_value 115.30 _pdbx_validate_rmsd_angle.angle_deviation 13.94 _pdbx_validate_rmsd_angle.angle_standard_deviation 2.30 _pdbx_validate_rmsd_angle.linker_flag N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 663 ? ? -121.12 -77.10 2 1 ILE A 740 ? ? -69.27 11.00 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A PHE 662 ? CG ? A PHE 85 CG 2 1 Y 1 A PHE 662 ? CD1 ? A PHE 85 CD1 3 1 Y 1 A PHE 662 ? CD2 ? A PHE 85 CD2 4 1 Y 1 A PHE 662 ? CE1 ? A PHE 85 CE1 5 1 Y 1 A PHE 662 ? CE2 ? A PHE 85 CE2 6 1 Y 1 A PHE 662 ? CZ ? A PHE 85 CZ 7 1 Y 1 A LYS 663 ? CE ? A LYS 86 CE 8 1 Y 1 A LYS 663 ? NZ ? A LYS 86 NZ 9 1 Y 1 A GLN 665 ? CD ? A GLN 88 CD 10 1 Y 1 A GLN 665 ? OE1 ? A GLN 88 OE1 11 1 Y 1 A GLN 665 ? NE2 ? A GLN 88 NE2 12 1 Y 1 A ASP 710 ? CG ? A ASP 133 CG 13 1 Y 1 A ASP 710 ? OD1 ? A ASP 133 OD1 14 1 Y 1 A ASP 710 ? OD2 ? A ASP 133 OD2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 578 ? A GLY 1 2 1 Y 1 A HIS 579 ? A HIS 2 3 1 Y 1 A MET 580 ? A MET 3 4 1 Y 1 A ALA 581 ? A ALA 4 5 1 Y 1 A VAL 582 ? A VAL 5 6 1 Y 1 A PRO 583 ? A PRO 6 7 1 Y 1 A ASP 584 ? A ASP 7 8 1 Y 1 A ASP 585 ? A ASP 8 9 1 Y 1 A ASP 586 ? A ASP 9 10 1 Y 1 A ASP 587 ? A ASP 10 11 1 Y 1 A ASP 588 ? A ASP 11 12 1 Y 1 A ASP 589 ? A ASP 12 13 1 Y 1 A ASP 590 ? A ASP 13 14 1 Y 1 A ASN 591 ? A ASN 14 15 1 Y 1 A SER 592 ? A SER 15 16 1 Y 1 A ASN 593 ? A ASN 16 17 1 Y 1 A ASP 594 ? A ASP 17 18 1 Y 1 A GLU 595 ? A GLU 18 19 1 Y 1 A SER 596 ? A SER 19 20 1 Y 1 A GLU 597 ? A GLU 20 21 1 Y 1 A TYR 598 ? A TYR 21 22 1 Y 1 A GLU 599 ? A GLU 22 23 1 Y 1 A SER 600 ? A SER 23 24 1 Y 1 A SER 601 ? A SER 24 25 1 Y 1 A GLN 602 ? A GLN 25 26 1 Y 1 A MET 603 ? A MET 26 27 1 Y 1 A ASP 604 ? A ASP 27 28 1 Y 1 A SER 605 ? A SER 28 29 1 Y 1 A GLU 606 ? A GLU 29 30 1 Y 1 A LYS 607 ? A LYS 30 31 1 Y 1 A ASN 608 ? A ASN 31 32 1 Y 1 A LYS 609 ? A LYS 32 33 1 Y 1 A GLY 610 ? A GLY 33 34 1 Y 1 A SER 611 ? A SER 34 35 1 Y 1 A ILE 612 ? A ILE 35 36 1 Y 1 A LYS 613 ? A LYS 36 37 1 Y 1 A ASN 614 ? A ASN 37 38 1 Y 1 A SER 615 ? A SER 38 39 1 Y 1 A ILE 730 ? A ILE 135 40 1 Y 1 A PRO 731 ? A PRO 136 41 1 Y 1 A TYR 732 ? A TYR 137 42 1 Y 1 A ALA 733 ? A ALA 138 43 1 Y 1 A ASN 734 ? A ASN 139 44 1 Y 1 A ASN 735 ? A ASN 140 45 1 Y 1 A GLN 736 ? A GLN 141 46 1 Y 1 A LYS 737 ? A LYS 142 47 1 Y 1 A GLU 738 ? A GLU 143 # _pdbx_audit_support.funding_organization 'EU Marie Curie ITN ParaMet' _pdbx_audit_support.country France _pdbx_audit_support.grant_number 290080 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #