data_4ZID # _entry.id 4ZID # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4ZID pdb_00004zid 10.2210/pdb4zid/pdb WWPDB D_1000209340 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-02-10 2 'Structure model' 1 1 2016-02-24 3 'Structure model' 1 2 2020-02-19 4 'Structure model' 1 3 2023-11-08 5 'Structure model' 1 4 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Refinement description' 7 5 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' diffrn_source 2 3 'Structure model' pdbx_struct_oper_list 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 6 4 'Structure model' pdbx_initial_refinement_model 7 5 'Structure model' pdbx_entry_details 8 5 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 4 'Structure model' '_database_2.pdbx_DOI' 4 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4ZID _pdbx_database_status.recvd_initial_deposition_date 2015-04-28 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'The sample was prepared with a different method.' _pdbx_database_related.db_id 3VYM _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Hayashi, Y.' 1 'Yamanaka, M.' 2 'Nagao, S.' 3 'Komori, H.' 4 'Higuchi, Y.' 5 'Hirota, S.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 19334 _citation.page_last 19334 _citation.title 'Domain swapping oligomerization of thermostable c-type cytochrome in E. coli cells' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/srep19334 _citation.pdbx_database_id_PubMed 26838805 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Hayashi, Y.' 1 ? primary 'Yamanaka, M.' 2 ? primary 'Nagao, S.' 3 ? primary 'Komori, H.' 4 ? primary 'Higuchi, Y.' 5 ? primary 'Hirota, S.' 6 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Cytochrome c-552' 8586.015 1 ? ? 'UNP residues 19-98' ? 2 non-polymer syn 'HEME C' 618.503 1 ? ? ? ? 3 water nat water 18.015 29 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cytochrome c552' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVDYLAGKIKKGGSGVWGSVPMPPQNVTDAEAKQLAQWILSIK _entity_poly.pdbx_seq_one_letter_code_can NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVDYLAGKIKKGGSGVWGSVPMPPQNVTDAEAKQLAQWILSIK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'HEME C' HEC 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ASN n 1 2 GLU n 1 3 GLN n 1 4 LEU n 1 5 ALA n 1 6 LYS n 1 7 GLN n 1 8 LYS n 1 9 GLY n 1 10 CYS n 1 11 MET n 1 12 ALA n 1 13 CYS n 1 14 HIS n 1 15 ASP n 1 16 LEU n 1 17 LYS n 1 18 ALA n 1 19 LYS n 1 20 LYS n 1 21 VAL n 1 22 GLY n 1 23 PRO n 1 24 ALA n 1 25 TYR n 1 26 ALA n 1 27 ASP n 1 28 VAL n 1 29 ALA n 1 30 LYS n 1 31 LYS n 1 32 TYR n 1 33 ALA n 1 34 GLY n 1 35 ARG n 1 36 LYS n 1 37 ASP n 1 38 ALA n 1 39 VAL n 1 40 ASP n 1 41 TYR n 1 42 LEU n 1 43 ALA n 1 44 GLY n 1 45 LYS n 1 46 ILE n 1 47 LYS n 1 48 LYS n 1 49 GLY n 1 50 GLY n 1 51 SER n 1 52 GLY n 1 53 VAL n 1 54 TRP n 1 55 GLY n 1 56 SER n 1 57 VAL n 1 58 PRO n 1 59 MET n 1 60 PRO n 1 61 PRO n 1 62 GLN n 1 63 ASN n 1 64 VAL n 1 65 THR n 1 66 ASP n 1 67 ALA n 1 68 GLU n 1 69 ALA n 1 70 LYS n 1 71 GLN n 1 72 LEU n 1 73 ALA n 1 74 GLN n 1 75 TRP n 1 76 ILE n 1 77 LEU n 1 78 SER n 1 79 ILE n 1 80 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 80 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HTH_0988, Hydth_0984' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 6534 / IAM 12695 / TK-6' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Hydrogenobacter thermophilus (strain DSM 6534 / IAM 12695 / TK-6)' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 608538 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'ESCHERICHIA COLI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain JCB387 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pKO2 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HEC non-polymer . 'HEME C' ? 'C34 H34 Fe N4 O4' 618.503 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ASN 1 1 1 ASN ASN A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 LYS 6 6 6 LYS LYS A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 CYS 10 10 10 CYS CYS A . n A 1 11 MET 11 11 11 MET MET A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 CYS 13 13 13 CYS CYS A . n A 1 14 HIS 14 14 14 HIS HIS A . n A 1 15 ASP 15 15 15 ASP ASP A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 LYS 17 17 17 LYS LYS A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 LYS 19 19 19 LYS LYS A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 GLY 22 22 22 GLY GLY A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 ASP 27 27 27 ASP ASP A . n A 1 28 VAL 28 28 28 VAL VAL A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 LYS 31 31 31 LYS LYS A . n A 1 32 TYR 32 32 32 TYR TYR A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 ARG 35 35 35 ARG ARG A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ALA 38 38 38 ALA ALA A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 LEU 42 42 42 LEU LEU A . n A 1 43 ALA 43 43 43 ALA ALA A . n A 1 44 GLY 44 44 44 GLY GLY A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ILE 46 46 46 ILE ILE A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 LYS 48 48 48 LYS LYS A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 GLY 50 50 50 GLY GLY A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 VAL 53 53 53 VAL VAL A . n A 1 54 TRP 54 54 54 TRP TRP A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 PRO 58 58 58 PRO PRO A . n A 1 59 MET 59 59 59 MET MET A . n A 1 60 PRO 60 60 60 PRO PRO A . n A 1 61 PRO 61 61 61 PRO PRO A . n A 1 62 GLN 62 62 62 GLN GLN A . n A 1 63 ASN 63 63 63 ASN ASN A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 THR 65 65 65 THR THR A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 GLN 71 71 71 GLN GLN A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 GLN 74 74 74 GLN GLN A . n A 1 75 TRP 75 75 75 TRP TRP A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 SER 78 78 78 SER SER A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 LYS 80 80 80 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HEC 1 101 101 HEC HEC A . C 3 HOH 1 201 25 HOH HOH A . C 3 HOH 2 202 16 HOH HOH A . C 3 HOH 3 203 24 HOH HOH A . C 3 HOH 4 204 20 HOH HOH A . C 3 HOH 5 205 18 HOH HOH A . C 3 HOH 6 206 4 HOH HOH A . C 3 HOH 7 207 14 HOH HOH A . C 3 HOH 8 208 1 HOH HOH A . C 3 HOH 9 209 23 HOH HOH A . C 3 HOH 10 210 28 HOH HOH A . C 3 HOH 11 211 12 HOH HOH A . C 3 HOH 12 212 17 HOH HOH A . C 3 HOH 13 213 10 HOH HOH A . C 3 HOH 14 214 9 HOH HOH A . C 3 HOH 15 215 7 HOH HOH A . C 3 HOH 16 216 29 HOH HOH A . C 3 HOH 17 217 3 HOH HOH A . C 3 HOH 18 218 27 HOH HOH A . C 3 HOH 19 219 19 HOH HOH A . C 3 HOH 20 220 11 HOH HOH A . C 3 HOH 21 221 2 HOH HOH A . C 3 HOH 22 222 8 HOH HOH A . C 3 HOH 23 223 22 HOH HOH A . C 3 HOH 24 224 15 HOH HOH A . C 3 HOH 25 225 26 HOH HOH A . C 3 HOH 26 226 13 HOH HOH A . C 3 HOH 27 227 6 HOH HOH A . C 3 HOH 28 228 5 HOH HOH A . C 3 HOH 29 229 21 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0107 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0107 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 4ZID _cell.details ? _cell.formula_units_Z ? _cell.length_a 45.808 _cell.length_a_esd ? _cell.length_b 45.808 _cell.length_b_esd ? _cell.length_c 78.304 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4ZID _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4ZID _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.76 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 55.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details 'room temperature' _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '1.6 M sodium citrate buffer' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-06-09 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL38B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL38B1 _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4ZID _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.80 _reflns.d_resolution_low 50.00 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9242 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I -3 _reflns.percent_possible_obs 99.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 9.7 _reflns.pdbx_Rmerge_I_obs 0.070 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 37.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.80 _reflns_shell.d_res_low 1.86 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 2.2 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 93.9 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.649 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 7.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] 1.37 _refine.aniso_B[1][2] 0.69 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][2] 1.37 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] -4.45 _refine.B_iso_max ? _refine.B_iso_mean 39.799 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc 0.972 _refine.correlation_coeff_Fo_to_Fc_free 0.955 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4ZID _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.80 _refine.ls_d_res_low 39.67 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8721 _refine.ls_number_reflns_R_free 440 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.72 _refine.ls_percent_reflns_R_free 4.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.16880 _refine.ls_R_factor_R_free 0.20350 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.16709 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3VYM _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.103 _refine.pdbx_overall_ESU_R_Free 0.104 _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 3.982 _refine.overall_SU_ML 0.076 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 601 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 43 _refine_hist.number_atoms_solvent 29 _refine_hist.number_atoms_total 673 _refine_hist.d_res_high 1.80 _refine_hist.d_res_low 39.67 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.032 0.020 662 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 650 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 2.847 2.176 904 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 1.278 3.000 1501 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.136 5.000 79 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 37.829 26.190 21 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.757 15.000 116 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 8.048 15.000 1 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.177 0.200 87 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.019 0.021 742 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 125 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_nbtor_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_xyhbond_nbd_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_vdw_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_hbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_refined ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_symmetry_metal_ion_other ? ? 'X-RAY DIFFRACTION' ? 2.107 2.110 319 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 2.092 2.104 318 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 2.780 3.142 397 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 2.785 3.147 398 ? r_mcangle_other ? ? 'X-RAY DIFFRACTION' ? 3.113 2.427 341 ? r_scbond_it ? ? 'X-RAY DIFFRACTION' ? 3.088 2.425 337 ? r_scbond_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_scangle_it ? ? 'X-RAY DIFFRACTION' ? 4.476 3.512 505 ? r_scangle_other ? ? 'X-RAY DIFFRACTION' ? 6.127 18.303 794 ? r_long_range_B_refined ? ? 'X-RAY DIFFRACTION' ? 6.135 18.268 793 ? r_long_range_B_other ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_rigid_bond_restr ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_free ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? r_sphericity_bonded ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 1.799 _refine_ls_shell.d_res_low 1.846 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 30 _refine_ls_shell.number_reflns_R_work 586 _refine_ls_shell.percent_reflns_obs 91.94 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.292 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.256 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 4ZID _struct.title 'Dimeric Hydrogenobacter thermophilus cytochrome c552 obtained from Escherichia coli' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4ZID _struct_keywords.text 'ELECTRON TRANSPORT' _struct_keywords.pdbx_keywords 'ELECTRON TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CY552_HYDTT _struct_ref.pdbx_db_accession P15452 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVDYLAGKIKKGGSGVWGSVPMPPQNVTDAEAKQLAQWILSIK ; _struct_ref.pdbx_align_begin 19 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4ZID _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 80 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P15452 _struct_ref_seq.db_align_beg 19 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 98 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 80 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5440 ? 1 MORE -64 ? 1 'SSA (A^2)' 9290 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_465 y-1,x+1,-z -0.5000000000 0.8660254038 0.0000000000 -68.7120000000 0.8660254038 0.5000000000 0.0000000000 39.6708916966 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASN A 1 ? LYS A 8 ? ASN A 1 LYS A 8 1 ? 8 HELX_P HELX_P2 AA2 GLY A 9 ? CYS A 13 ? GLY A 9 CYS A 13 5 ? 5 HELX_P HELX_P3 AA3 ALA A 24 ? TYR A 32 ? ALA A 24 TYR A 32 1 ? 9 HELX_P HELX_P4 AA4 ASP A 37 ? GLY A 49 ? ASP A 37 GLY A 49 1 ? 13 HELX_P HELX_P5 AA5 THR A 65 ? SER A 78 ? THR A 65 SER A 78 1 ? 14 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale none ? A CYS 10 SG ? ? ? 1_555 B HEC . CAB ? ? A CYS 10 A HEC 101 1_555 ? ? ? ? ? ? ? 1.795 ? ? metalc1 metalc ? ? A HIS 14 NE2 ? ? ? 1_555 B HEC . FE ? ? A HIS 14 A HEC 101 1_555 ? ? ? ? ? ? ? 2.012 ? ? metalc2 metalc ? ? A MET 59 SD ? ? ? 1_555 B HEC . FE ? ? A MET 59 A HEC 101 4_465 ? ? ? ? ? ? ? 2.262 ? ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 14 ? A HIS 14 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NA ? B HEC . ? A HEC 101 ? 1_555 88.3 ? 2 NE2 ? A HIS 14 ? A HIS 14 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NB ? B HEC . ? A HEC 101 ? 1_555 90.4 ? 3 NA ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NB ? B HEC . ? A HEC 101 ? 1_555 88.0 ? 4 NE2 ? A HIS 14 ? A HIS 14 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NC ? B HEC . ? A HEC 101 ? 1_555 91.0 ? 5 NA ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NC ? B HEC . ? A HEC 101 ? 1_555 179.0 ? 6 NB ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 NC ? B HEC . ? A HEC 101 ? 1_555 92.7 ? 7 NE2 ? A HIS 14 ? A HIS 14 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 ND ? B HEC . ? A HEC 101 ? 1_555 89.0 ? 8 NA ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 ND ? B HEC . ? A HEC 101 ? 1_555 91.1 ? 9 NB ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 ND ? B HEC . ? A HEC 101 ? 1_555 178.9 ? 10 NC ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 ND ? B HEC . ? A HEC 101 ? 1_555 88.2 ? 11 NE2 ? A HIS 14 ? A HIS 14 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 SD ? A MET 59 ? A MET 59 ? 1_555 38.9 ? 12 NA ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 SD ? A MET 59 ? A MET 59 ? 1_555 80.1 ? 13 NB ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 SD ? A MET 59 ? A MET 59 ? 1_555 127.5 ? 14 NC ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 SD ? A MET 59 ? A MET 59 ? 1_555 98.9 ? 15 ND ? B HEC . ? A HEC 101 ? 1_555 FE ? B HEC . ? A HEC 101 ? 1_555 SD ? A MET 59 ? A MET 59 ? 1_555 51.6 ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id HEC _pdbx_modification_feature.label_asym_id B _pdbx_modification_feature.label_seq_id . _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id CYS _pdbx_modification_feature.modified_residue_label_asym_id A _pdbx_modification_feature.modified_residue_label_seq_id 10 _pdbx_modification_feature.modified_residue_label_alt_id ? _pdbx_modification_feature.auth_comp_id HEC _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 101 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id CYS _pdbx_modification_feature.modified_residue_auth_asym_id A _pdbx_modification_feature.modified_residue_auth_seq_id 10 _pdbx_modification_feature.modified_residue_PDB_ins_code ? _pdbx_modification_feature.modified_residue_symmetry 1_555 _pdbx_modification_feature.comp_id_linking_atom CAB _pdbx_modification_feature.modified_residue_id_linking_atom SG _pdbx_modification_feature.modified_residue_id CYS _pdbx_modification_feature.ref_pcm_id 2 _pdbx_modification_feature.ref_comp_id HEC _pdbx_modification_feature.type None _pdbx_modification_feature.category Heme/heme-like # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id HEC _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 18 _struct_site.details 'binding site for residue HEC A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 18 CYS A 10 ? CYS A 10 . ? 1_555 ? 2 AC1 18 CYS A 13 ? CYS A 13 . ? 1_555 ? 3 AC1 18 HIS A 14 ? HIS A 14 . ? 1_555 ? 4 AC1 18 PRO A 23 ? PRO A 23 . ? 4_465 ? 5 AC1 18 TYR A 25 ? TYR A 25 . ? 4_465 ? 6 AC1 18 TYR A 32 ? TYR A 32 . ? 4_465 ? 7 AC1 18 TYR A 41 ? TYR A 41 . ? 4_465 ? 8 AC1 18 GLY A 50 ? GLY A 50 . ? 4_465 ? 9 AC1 18 SER A 51 ? SER A 51 . ? 4_465 ? 10 AC1 18 GLY A 52 ? GLY A 52 . ? 4_465 ? 11 AC1 18 VAL A 53 ? VAL A 53 . ? 4_465 ? 12 AC1 18 TRP A 54 ? TRP A 54 . ? 4_465 ? 13 AC1 18 GLY A 55 ? GLY A 55 . ? 4_465 ? 14 AC1 18 VAL A 57 ? VAL A 57 . ? 4_465 ? 15 AC1 18 MET A 59 ? MET A 59 . ? 4_465 ? 16 AC1 18 GLN A 62 ? GLN A 62 . ? 4_465 ? 17 AC1 18 HOH C . ? HOH A 208 . ? 1_555 ? 18 AC1 18 HOH C . ? HOH A 210 . ? 4_465 ? # _pdbx_entry_details.entry_id 4ZID _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 SG _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 CYS _pdbx_validate_close_contact.auth_seq_id_1 13 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 CAC _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HEC _pdbx_validate_close_contact.auth_seq_id_2 101 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.12 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CB A VAL 21 ? ? CG1 A VAL 21 ? ? 1.391 1.524 -0.133 0.021 N 2 1 CZ3 A TRP 54 ? ? CH2 A TRP 54 ? ? 1.505 1.396 0.109 0.016 N # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CB A ASP 37 ? ? CG A ASP 37 ? ? OD2 A ASP 37 ? ? 124.63 118.30 6.33 0.90 N 2 1 CB A ASP 66 ? ? CG A ASP 66 ? ? OD1 A ASP 66 ? ? 124.43 118.30 6.13 0.90 N 3 1 CB A ASP 66 ? ? CG A ASP 66 ? ? OD2 A ASP 66 ? ? 112.66 118.30 -5.64 0.90 N 4 1 CB A SER 78 ? ? CA A SER 78 ? ? C A SER 78 ? ? 97.76 110.10 -12.34 1.90 N # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined -51.1133 16.7267 4.4051 0.0756 ? -0.0326 ? -0.0064 ? 0.0910 ? 0.0928 ? 0.2188 ? 11.0560 ? 0.1797 ? -1.1326 ? 0.8433 ? 0.5198 ? 4.4426 ? 0.0904 ? -0.6666 ? -0.7968 ? 0.0857 ? 0.1017 ? 0.2186 ? 0.4272 ? -0.1897 ? -0.1921 ? 2 'X-RAY DIFFRACTION' ? refined -29.6519 15.5012 -5.1844 0.1080 ? 0.0340 ? -0.0415 ? 0.0949 ? -0.0256 ? 0.1573 ? 7.2283 ? -1.0484 ? -0.1349 ? 6.9424 ? -1.9663 ? 10.1763 ? -0.0915 ? 0.1496 ? 0.2014 ? -0.1062 ? 0.1350 ? 0.2758 ? -0.4208 ? -0.4194 ? -0.0435 ? 3 'X-RAY DIFFRACTION' ? refined -17.3925 18.0090 -11.3817 0.2151 ? -0.0776 ? -0.0077 ? 0.2316 ? 0.1426 ? 0.4166 ? 0.0517 ? 0.3110 ? -0.3480 ? 2.8570 ? -6.2334 ? 24.3935 ? -0.0563 ? 0.0469 ? 0.0405 ? -0.0208 ? 0.0060 ? 0.0342 ? -1.4031 ? 0.1343 ? 0.0503 ? 4 'X-RAY DIFFRACTION' ? refined -15.6537 11.2765 -1.9889 0.0749 ? -0.0133 ? 0.0111 ? 0.0948 ? -0.0006 ? 0.1275 ? 15.4406 ? 1.0489 ? 8.3696 ? 8.9280 ? 0.6344 ? 33.0388 ? -0.0861 ? -0.0475 ? 0.4141 ? 0.0569 ? -0.0620 ? -0.4791 ? -0.4739 ? 0.6292 ? 0.1481 ? 5 'X-RAY DIFFRACTION' ? refined -19.5641 11.0206 0.0340 0.0703 ? -0.0359 ? 0.0194 ? 0.0777 ? 0.0015 ? 0.1335 ? 2.5075 ? -1.8609 ? 1.9896 ? 4.7912 ? 1.1022 ? 6.0555 ? -0.1285 ? 0.0020 ? 0.0207 ? 0.0994 ? 0.1468 ? -0.0726 ? -0.0875 ? 0.3892 ? -0.0183 ? 6 'X-RAY DIFFRACTION' ? refined -25.1051 9.1245 -12.4622 0.1081 ? -0.0041 ? 0.0114 ? 0.1223 ? -0.0401 ? 0.0636 ? 10.6222 ? -0.4295 ? -1.6579 ? 8.2166 ? -2.6889 ? 9.7407 ? 0.0779 ? 0.5726 ? -0.1079 ? -0.3288 ? -0.0687 ? 0.2881 ? 0.2601 ? 0.0664 ? -0.0092 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 1 ? ? A 18 ? ? 2 'X-RAY DIFFRACTION' 2 ? ? A 19 ? ? A 33 ? ? 3 'X-RAY DIFFRACTION' 3 ? ? A 34 ? ? A 42 ? ? 4 'X-RAY DIFFRACTION' 4 ? ? A 43 ? ? A 48 ? ? 5 'X-RAY DIFFRACTION' 5 ? ? A 49 ? ? A 70 ? ? 6 'X-RAY DIFFRACTION' 6 ? ? A 71 ? ? A 80 ? ? # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HEC FE FE N N 137 HEC CHA C N N 138 HEC CHB C N N 139 HEC CHC C N N 140 HEC CHD C N N 141 HEC NA N Y N 142 HEC C1A C Y N 143 HEC C2A C Y N 144 HEC C3A C Y N 145 HEC C4A C Y N 146 HEC CMA C N N 147 HEC CAA C N N 148 HEC CBA C N N 149 HEC CGA C N N 150 HEC O1A O N N 151 HEC O2A O N N 152 HEC NB N Y N 153 HEC C1B C Y N 154 HEC C2B C Y N 155 HEC C3B C Y N 156 HEC C4B C Y N 157 HEC CMB C N N 158 HEC CAB C N N 159 HEC CBB C N N 160 HEC NC N Y N 161 HEC C1C C Y N 162 HEC C2C C Y N 163 HEC C3C C Y N 164 HEC C4C C Y N 165 HEC CMC C N N 166 HEC CAC C N N 167 HEC CBC C N N 168 HEC ND N Y N 169 HEC C1D C Y N 170 HEC C2D C Y N 171 HEC C3D C Y N 172 HEC C4D C Y N 173 HEC CMD C N N 174 HEC CAD C N N 175 HEC CBD C N N 176 HEC CGD C N N 177 HEC O1D O N N 178 HEC O2D O N N 179 HEC HHA H N N 180 HEC HHB H N N 181 HEC HHC H N N 182 HEC HHD H N N 183 HEC HMA1 H N N 184 HEC HMA2 H N N 185 HEC HMA3 H N N 186 HEC HAA1 H N N 187 HEC HAA2 H N N 188 HEC HBA1 H N N 189 HEC HBA2 H N N 190 HEC H2A H N N 191 HEC HMB1 H N N 192 HEC HMB2 H N N 193 HEC HMB3 H N N 194 HEC HAB H N N 195 HEC HBB1 H N N 196 HEC HBB2 H N N 197 HEC HBB3 H N N 198 HEC HMC1 H N N 199 HEC HMC2 H N N 200 HEC HMC3 H N N 201 HEC HAC H N N 202 HEC HBC1 H N N 203 HEC HBC2 H N N 204 HEC HBC3 H N N 205 HEC HMD1 H N N 206 HEC HMD2 H N N 207 HEC HMD3 H N N 208 HEC HAD1 H N N 209 HEC HAD2 H N N 210 HEC HBD1 H N N 211 HEC HBD2 H N N 212 HEC H2D H N N 213 HIS N N N N 214 HIS CA C N S 215 HIS C C N N 216 HIS O O N N 217 HIS CB C N N 218 HIS CG C Y N 219 HIS ND1 N Y N 220 HIS CD2 C Y N 221 HIS CE1 C Y N 222 HIS NE2 N Y N 223 HIS OXT O N N 224 HIS H H N N 225 HIS H2 H N N 226 HIS HA H N N 227 HIS HB2 H N N 228 HIS HB3 H N N 229 HIS HD1 H N N 230 HIS HD2 H N N 231 HIS HE1 H N N 232 HIS HE2 H N N 233 HIS HXT H N N 234 HOH O O N N 235 HOH H1 H N N 236 HOH H2 H N N 237 ILE N N N N 238 ILE CA C N S 239 ILE C C N N 240 ILE O O N N 241 ILE CB C N S 242 ILE CG1 C N N 243 ILE CG2 C N N 244 ILE CD1 C N N 245 ILE OXT O N N 246 ILE H H N N 247 ILE H2 H N N 248 ILE HA H N N 249 ILE HB H N N 250 ILE HG12 H N N 251 ILE HG13 H N N 252 ILE HG21 H N N 253 ILE HG22 H N N 254 ILE HG23 H N N 255 ILE HD11 H N N 256 ILE HD12 H N N 257 ILE HD13 H N N 258 ILE HXT H N N 259 LEU N N N N 260 LEU CA C N S 261 LEU C C N N 262 LEU O O N N 263 LEU CB C N N 264 LEU CG C N N 265 LEU CD1 C N N 266 LEU CD2 C N N 267 LEU OXT O N N 268 LEU H H N N 269 LEU H2 H N N 270 LEU HA H N N 271 LEU HB2 H N N 272 LEU HB3 H N N 273 LEU HG H N N 274 LEU HD11 H N N 275 LEU HD12 H N N 276 LEU HD13 H N N 277 LEU HD21 H N N 278 LEU HD22 H N N 279 LEU HD23 H N N 280 LEU HXT H N N 281 LYS N N N N 282 LYS CA C N S 283 LYS C C N N 284 LYS O O N N 285 LYS CB C N N 286 LYS CG C N N 287 LYS CD C N N 288 LYS CE C N N 289 LYS NZ N N N 290 LYS OXT O N N 291 LYS H H N N 292 LYS H2 H N N 293 LYS HA H N N 294 LYS HB2 H N N 295 LYS HB3 H N N 296 LYS HG2 H N N 297 LYS HG3 H N N 298 LYS HD2 H N N 299 LYS HD3 H N N 300 LYS HE2 H N N 301 LYS HE3 H N N 302 LYS HZ1 H N N 303 LYS HZ2 H N N 304 LYS HZ3 H N N 305 LYS HXT H N N 306 MET N N N N 307 MET CA C N S 308 MET C C N N 309 MET O O N N 310 MET CB C N N 311 MET CG C N N 312 MET SD S N N 313 MET CE C N N 314 MET OXT O N N 315 MET H H N N 316 MET H2 H N N 317 MET HA H N N 318 MET HB2 H N N 319 MET HB3 H N N 320 MET HG2 H N N 321 MET HG3 H N N 322 MET HE1 H N N 323 MET HE2 H N N 324 MET HE3 H N N 325 MET HXT H N N 326 PRO N N N N 327 PRO CA C N S 328 PRO C C N N 329 PRO O O N N 330 PRO CB C N N 331 PRO CG C N N 332 PRO CD C N N 333 PRO OXT O N N 334 PRO H H N N 335 PRO HA H N N 336 PRO HB2 H N N 337 PRO HB3 H N N 338 PRO HG2 H N N 339 PRO HG3 H N N 340 PRO HD2 H N N 341 PRO HD3 H N N 342 PRO HXT H N N 343 SER N N N N 344 SER CA C N S 345 SER C C N N 346 SER O O N N 347 SER CB C N N 348 SER OG O N N 349 SER OXT O N N 350 SER H H N N 351 SER H2 H N N 352 SER HA H N N 353 SER HB2 H N N 354 SER HB3 H N N 355 SER HG H N N 356 SER HXT H N N 357 THR N N N N 358 THR CA C N S 359 THR C C N N 360 THR O O N N 361 THR CB C N R 362 THR OG1 O N N 363 THR CG2 C N N 364 THR OXT O N N 365 THR H H N N 366 THR H2 H N N 367 THR HA H N N 368 THR HB H N N 369 THR HG1 H N N 370 THR HG21 H N N 371 THR HG22 H N N 372 THR HG23 H N N 373 THR HXT H N N 374 TRP N N N N 375 TRP CA C N S 376 TRP C C N N 377 TRP O O N N 378 TRP CB C N N 379 TRP CG C Y N 380 TRP CD1 C Y N 381 TRP CD2 C Y N 382 TRP NE1 N Y N 383 TRP CE2 C Y N 384 TRP CE3 C Y N 385 TRP CZ2 C Y N 386 TRP CZ3 C Y N 387 TRP CH2 C Y N 388 TRP OXT O N N 389 TRP H H N N 390 TRP H2 H N N 391 TRP HA H N N 392 TRP HB2 H N N 393 TRP HB3 H N N 394 TRP HD1 H N N 395 TRP HE1 H N N 396 TRP HE3 H N N 397 TRP HZ2 H N N 398 TRP HZ3 H N N 399 TRP HH2 H N N 400 TRP HXT H N N 401 TYR N N N N 402 TYR CA C N S 403 TYR C C N N 404 TYR O O N N 405 TYR CB C N N 406 TYR CG C Y N 407 TYR CD1 C Y N 408 TYR CD2 C Y N 409 TYR CE1 C Y N 410 TYR CE2 C Y N 411 TYR CZ C Y N 412 TYR OH O N N 413 TYR OXT O N N 414 TYR H H N N 415 TYR H2 H N N 416 TYR HA H N N 417 TYR HB2 H N N 418 TYR HB3 H N N 419 TYR HD1 H N N 420 TYR HD2 H N N 421 TYR HE1 H N N 422 TYR HE2 H N N 423 TYR HH H N N 424 TYR HXT H N N 425 VAL N N N N 426 VAL CA C N S 427 VAL C C N N 428 VAL O O N N 429 VAL CB C N N 430 VAL CG1 C N N 431 VAL CG2 C N N 432 VAL OXT O N N 433 VAL H H N N 434 VAL H2 H N N 435 VAL HA H N N 436 VAL HB H N N 437 VAL HG11 H N N 438 VAL HG12 H N N 439 VAL HG13 H N N 440 VAL HG21 H N N 441 VAL HG22 H N N 442 VAL HG23 H N N 443 VAL HXT H N N 444 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HEC FE NA sing N N 129 HEC FE NB sing N N 130 HEC FE NC sing N N 131 HEC FE ND sing N N 132 HEC CHA C1A doub N N 133 HEC CHA C4D sing N N 134 HEC CHA HHA sing N N 135 HEC CHB C4A doub N N 136 HEC CHB C1B sing N N 137 HEC CHB HHB sing N N 138 HEC CHC C4B doub N N 139 HEC CHC C1C sing N N 140 HEC CHC HHC sing N N 141 HEC CHD C4C doub N N 142 HEC CHD C1D sing N N 143 HEC CHD HHD sing N N 144 HEC NA C1A sing Y N 145 HEC NA C4A sing Y N 146 HEC C1A C2A sing Y N 147 HEC C2A C3A doub Y N 148 HEC C2A CAA sing N N 149 HEC C3A C4A sing Y N 150 HEC C3A CMA sing N N 151 HEC CMA HMA1 sing N N 152 HEC CMA HMA2 sing N N 153 HEC CMA HMA3 sing N N 154 HEC CAA CBA sing N N 155 HEC CAA HAA1 sing N N 156 HEC CAA HAA2 sing N N 157 HEC CBA CGA sing N N 158 HEC CBA HBA1 sing N N 159 HEC CBA HBA2 sing N N 160 HEC CGA O1A doub N N 161 HEC CGA O2A sing N N 162 HEC O2A H2A sing N N 163 HEC NB C1B sing Y N 164 HEC NB C4B sing Y N 165 HEC C1B C2B doub Y N 166 HEC C2B C3B sing Y N 167 HEC C2B CMB sing N N 168 HEC C3B C4B sing Y N 169 HEC C3B CAB doub N E 170 HEC CMB HMB1 sing N N 171 HEC CMB HMB2 sing N N 172 HEC CMB HMB3 sing N N 173 HEC CAB CBB sing N N 174 HEC CAB HAB sing N N 175 HEC CBB HBB1 sing N N 176 HEC CBB HBB2 sing N N 177 HEC CBB HBB3 sing N N 178 HEC NC C1C sing Y N 179 HEC NC C4C sing Y N 180 HEC C1C C2C doub Y N 181 HEC C2C C3C sing Y N 182 HEC C2C CMC sing N N 183 HEC C3C C4C sing Y N 184 HEC C3C CAC doub N E 185 HEC CMC HMC1 sing N N 186 HEC CMC HMC2 sing N N 187 HEC CMC HMC3 sing N N 188 HEC CAC CBC sing N N 189 HEC CAC HAC sing N N 190 HEC CBC HBC1 sing N N 191 HEC CBC HBC2 sing N N 192 HEC CBC HBC3 sing N N 193 HEC ND C1D sing Y N 194 HEC ND C4D sing Y N 195 HEC C1D C2D doub Y N 196 HEC C2D C3D sing Y N 197 HEC C2D CMD sing N N 198 HEC C3D C4D doub Y N 199 HEC C3D CAD sing N N 200 HEC CMD HMD1 sing N N 201 HEC CMD HMD2 sing N N 202 HEC CMD HMD3 sing N N 203 HEC CAD CBD sing N N 204 HEC CAD HAD1 sing N N 205 HEC CAD HAD2 sing N N 206 HEC CBD CGD sing N N 207 HEC CBD HBD1 sing N N 208 HEC CBD HBD2 sing N N 209 HEC CGD O1D doub N N 210 HEC CGD O2D sing N N 211 HEC O2D H2D sing N N 212 HIS N CA sing N N 213 HIS N H sing N N 214 HIS N H2 sing N N 215 HIS CA C sing N N 216 HIS CA CB sing N N 217 HIS CA HA sing N N 218 HIS C O doub N N 219 HIS C OXT sing N N 220 HIS CB CG sing N N 221 HIS CB HB2 sing N N 222 HIS CB HB3 sing N N 223 HIS CG ND1 sing Y N 224 HIS CG CD2 doub Y N 225 HIS ND1 CE1 doub Y N 226 HIS ND1 HD1 sing N N 227 HIS CD2 NE2 sing Y N 228 HIS CD2 HD2 sing N N 229 HIS CE1 NE2 sing Y N 230 HIS CE1 HE1 sing N N 231 HIS NE2 HE2 sing N N 232 HIS OXT HXT sing N N 233 HOH O H1 sing N N 234 HOH O H2 sing N N 235 ILE N CA sing N N 236 ILE N H sing N N 237 ILE N H2 sing N N 238 ILE CA C sing N N 239 ILE CA CB sing N N 240 ILE CA HA sing N N 241 ILE C O doub N N 242 ILE C OXT sing N N 243 ILE CB CG1 sing N N 244 ILE CB CG2 sing N N 245 ILE CB HB sing N N 246 ILE CG1 CD1 sing N N 247 ILE CG1 HG12 sing N N 248 ILE CG1 HG13 sing N N 249 ILE CG2 HG21 sing N N 250 ILE CG2 HG22 sing N N 251 ILE CG2 HG23 sing N N 252 ILE CD1 HD11 sing N N 253 ILE CD1 HD12 sing N N 254 ILE CD1 HD13 sing N N 255 ILE OXT HXT sing N N 256 LEU N CA sing N N 257 LEU N H sing N N 258 LEU N H2 sing N N 259 LEU CA C sing N N 260 LEU CA CB sing N N 261 LEU CA HA sing N N 262 LEU C O doub N N 263 LEU C OXT sing N N 264 LEU CB CG sing N N 265 LEU CB HB2 sing N N 266 LEU CB HB3 sing N N 267 LEU CG CD1 sing N N 268 LEU CG CD2 sing N N 269 LEU CG HG sing N N 270 LEU CD1 HD11 sing N N 271 LEU CD1 HD12 sing N N 272 LEU CD1 HD13 sing N N 273 LEU CD2 HD21 sing N N 274 LEU CD2 HD22 sing N N 275 LEU CD2 HD23 sing N N 276 LEU OXT HXT sing N N 277 LYS N CA sing N N 278 LYS N H sing N N 279 LYS N H2 sing N N 280 LYS CA C sing N N 281 LYS CA CB sing N N 282 LYS CA HA sing N N 283 LYS C O doub N N 284 LYS C OXT sing N N 285 LYS CB CG sing N N 286 LYS CB HB2 sing N N 287 LYS CB HB3 sing N N 288 LYS CG CD sing N N 289 LYS CG HG2 sing N N 290 LYS CG HG3 sing N N 291 LYS CD CE sing N N 292 LYS CD HD2 sing N N 293 LYS CD HD3 sing N N 294 LYS CE NZ sing N N 295 LYS CE HE2 sing N N 296 LYS CE HE3 sing N N 297 LYS NZ HZ1 sing N N 298 LYS NZ HZ2 sing N N 299 LYS NZ HZ3 sing N N 300 LYS OXT HXT sing N N 301 MET N CA sing N N 302 MET N H sing N N 303 MET N H2 sing N N 304 MET CA C sing N N 305 MET CA CB sing N N 306 MET CA HA sing N N 307 MET C O doub N N 308 MET C OXT sing N N 309 MET CB CG sing N N 310 MET CB HB2 sing N N 311 MET CB HB3 sing N N 312 MET CG SD sing N N 313 MET CG HG2 sing N N 314 MET CG HG3 sing N N 315 MET SD CE sing N N 316 MET CE HE1 sing N N 317 MET CE HE2 sing N N 318 MET CE HE3 sing N N 319 MET OXT HXT sing N N 320 PRO N CA sing N N 321 PRO N CD sing N N 322 PRO N H sing N N 323 PRO CA C sing N N 324 PRO CA CB sing N N 325 PRO CA HA sing N N 326 PRO C O doub N N 327 PRO C OXT sing N N 328 PRO CB CG sing N N 329 PRO CB HB2 sing N N 330 PRO CB HB3 sing N N 331 PRO CG CD sing N N 332 PRO CG HG2 sing N N 333 PRO CG HG3 sing N N 334 PRO CD HD2 sing N N 335 PRO CD HD3 sing N N 336 PRO OXT HXT sing N N 337 SER N CA sing N N 338 SER N H sing N N 339 SER N H2 sing N N 340 SER CA C sing N N 341 SER CA CB sing N N 342 SER CA HA sing N N 343 SER C O doub N N 344 SER C OXT sing N N 345 SER CB OG sing N N 346 SER CB HB2 sing N N 347 SER CB HB3 sing N N 348 SER OG HG sing N N 349 SER OXT HXT sing N N 350 THR N CA sing N N 351 THR N H sing N N 352 THR N H2 sing N N 353 THR CA C sing N N 354 THR CA CB sing N N 355 THR CA HA sing N N 356 THR C O doub N N 357 THR C OXT sing N N 358 THR CB OG1 sing N N 359 THR CB CG2 sing N N 360 THR CB HB sing N N 361 THR OG1 HG1 sing N N 362 THR CG2 HG21 sing N N 363 THR CG2 HG22 sing N N 364 THR CG2 HG23 sing N N 365 THR OXT HXT sing N N 366 TRP N CA sing N N 367 TRP N H sing N N 368 TRP N H2 sing N N 369 TRP CA C sing N N 370 TRP CA CB sing N N 371 TRP CA HA sing N N 372 TRP C O doub N N 373 TRP C OXT sing N N 374 TRP CB CG sing N N 375 TRP CB HB2 sing N N 376 TRP CB HB3 sing N N 377 TRP CG CD1 doub Y N 378 TRP CG CD2 sing Y N 379 TRP CD1 NE1 sing Y N 380 TRP CD1 HD1 sing N N 381 TRP CD2 CE2 doub Y N 382 TRP CD2 CE3 sing Y N 383 TRP NE1 CE2 sing Y N 384 TRP NE1 HE1 sing N N 385 TRP CE2 CZ2 sing Y N 386 TRP CE3 CZ3 doub Y N 387 TRP CE3 HE3 sing N N 388 TRP CZ2 CH2 doub Y N 389 TRP CZ2 HZ2 sing N N 390 TRP CZ3 CH2 sing Y N 391 TRP CZ3 HZ3 sing N N 392 TRP CH2 HH2 sing N N 393 TRP OXT HXT sing N N 394 TYR N CA sing N N 395 TYR N H sing N N 396 TYR N H2 sing N N 397 TYR CA C sing N N 398 TYR CA CB sing N N 399 TYR CA HA sing N N 400 TYR C O doub N N 401 TYR C OXT sing N N 402 TYR CB CG sing N N 403 TYR CB HB2 sing N N 404 TYR CB HB3 sing N N 405 TYR CG CD1 doub Y N 406 TYR CG CD2 sing Y N 407 TYR CD1 CE1 sing Y N 408 TYR CD1 HD1 sing N N 409 TYR CD2 CE2 doub Y N 410 TYR CD2 HD2 sing N N 411 TYR CE1 CZ doub Y N 412 TYR CE1 HE1 sing N N 413 TYR CE2 CZ sing Y N 414 TYR CE2 HE2 sing N N 415 TYR CZ OH sing N N 416 TYR OH HH sing N N 417 TYR OXT HXT sing N N 418 VAL N CA sing N N 419 VAL N H sing N N 420 VAL N H2 sing N N 421 VAL CA C sing N N 422 VAL CA CB sing N N 423 VAL CA HA sing N N 424 VAL C O doub N N 425 VAL C OXT sing N N 426 VAL CB CG1 sing N N 427 VAL CB CG2 sing N N 428 VAL CB HB sing N N 429 VAL CG1 HG11 sing N N 430 VAL CG1 HG12 sing N N 431 VAL CG1 HG13 sing N N 432 VAL CG2 HG21 sing N N 433 VAL CG2 HG22 sing N N 434 VAL CG2 HG23 sing N N 435 VAL OXT HXT sing N N 436 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Japan Society for the Promotion of Science' Japan 'No. 26288080' 1 'Japan Society for the Promotion of Science' Japan 'No. 15K13744' 2 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3VYM _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 4ZID _atom_sites.fract_transf_matrix[1][1] 0.021830 _atom_sites.fract_transf_matrix[1][2] 0.012604 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.025207 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012771 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C FE N O S # loop_