data_4ZL7 # _entry.id 4ZL7 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4ZL7 pdb_00004zl7 10.2210/pdb4zl7/pdb WWPDB D_1000209473 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB '3H93 contains the wild type sequence of this protein' 3H93 unspecified PDB '2MBT contains the NMR solution structure of the wild type sequence of this protein' 2MBT unspecified PDB . 4ZL8 unspecified PDB . 4ZL9 unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4ZL7 _pdbx_database_status.recvd_initial_deposition_date 2015-05-01 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'McMahon, R.M.' 1 'Martin, J.L.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr. D Biol. Crystallogr.' _citation.journal_id_ASTM ABCRE6 _citation.journal_id_CSD ? _citation.journal_id_ISSN 1399-0047 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 71 _citation.language ? _citation.page_first 2386 _citation.page_last 2395 _citation.title ;Sent packing: protein engineering generates a new crystal form of Pseudomonas aeruginosa DsbA1 with increased catalytic surface accessibility. ; _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S1399004715018519 _citation.pdbx_database_id_PubMed 26627647 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'McMahon, R.M.' 1 ? primary 'Coincon, M.' 2 ? primary 'Tay, S.' 3 ? primary 'Heras, B.' 4 ? primary 'Morton, C.J.' 5 ? primary 'Scanlon, M.J.' 6 ? primary 'Martin, J.L.' 7 ? # _cell.length_a 35.340 _cell.length_b 62.310 _cell.length_c 41.620 _cell.angle_alpha 90.000 _cell.angle_beta 97.560 _cell.angle_gamma 90.000 _cell.entry_id 4ZL7 _cell.Z_PDB 2 _cell.pdbx_unique_axis ? # _symmetry.space_group_name_H-M 'P 1 21 1' _symmetry.entry_id 4ZL7 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 4 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Thiol:disulfide interchange protein DsbA' 21351.514 1 ? E82I 'UNP residues 22-211' 'The first three residues (SNA) derive from an expression tag' 2 non-polymer syn 'HEXAETHYLENE GLYCOL' 282.331 1 ? ? ? ? 3 water nat water 18.015 111 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNADDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLT LISMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNG KYRFDIGSAGGPEETLKLADYLIEKERAAAKK ; _entity_poly.pdbx_seq_one_letter_code_can ;SNADDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLT LISMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNG KYRFDIGSAGGPEETLKLADYLIEKERAAAKK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 ASP n 1 5 ASP n 1 6 TYR n 1 7 THR n 1 8 ALA n 1 9 GLY n 1 10 LYS n 1 11 GLU n 1 12 TYR n 1 13 VAL n 1 14 GLU n 1 15 LEU n 1 16 SER n 1 17 SER n 1 18 PRO n 1 19 VAL n 1 20 PRO n 1 21 VAL n 1 22 SER n 1 23 GLN n 1 24 PRO n 1 25 GLY n 1 26 LYS n 1 27 ILE n 1 28 GLU n 1 29 VAL n 1 30 VAL n 1 31 GLU n 1 32 LEU n 1 33 PHE n 1 34 TRP n 1 35 TYR n 1 36 GLY n 1 37 CYS n 1 38 PRO n 1 39 HIS n 1 40 CYS n 1 41 TYR n 1 42 ALA n 1 43 PHE n 1 44 GLU n 1 45 PRO n 1 46 THR n 1 47 ILE n 1 48 VAL n 1 49 PRO n 1 50 TRP n 1 51 SER n 1 52 GLU n 1 53 LYS n 1 54 LEU n 1 55 PRO n 1 56 ALA n 1 57 ASP n 1 58 VAL n 1 59 HIS n 1 60 PHE n 1 61 VAL n 1 62 ARG n 1 63 LEU n 1 64 PRO n 1 65 ALA n 1 66 LEU n 1 67 PHE n 1 68 GLY n 1 69 GLY n 1 70 ILE n 1 71 TRP n 1 72 ASN n 1 73 VAL n 1 74 HIS n 1 75 GLY n 1 76 GLN n 1 77 MET n 1 78 PHE n 1 79 LEU n 1 80 THR n 1 81 LEU n 1 82 ILE n 1 83 SER n 1 84 MET n 1 85 GLY n 1 86 VAL n 1 87 GLU n 1 88 HIS n 1 89 ASP n 1 90 VAL n 1 91 HIS n 1 92 ASN n 1 93 ALA n 1 94 VAL n 1 95 PHE n 1 96 GLU n 1 97 ALA n 1 98 ILE n 1 99 HIS n 1 100 LYS n 1 101 GLU n 1 102 HIS n 1 103 LYS n 1 104 LYS n 1 105 LEU n 1 106 ALA n 1 107 THR n 1 108 PRO n 1 109 GLU n 1 110 GLU n 1 111 MET n 1 112 ALA n 1 113 ASP n 1 114 PHE n 1 115 LEU n 1 116 ALA n 1 117 GLY n 1 118 LYS n 1 119 GLY n 1 120 VAL n 1 121 ASP n 1 122 LYS n 1 123 GLU n 1 124 LYS n 1 125 PHE n 1 126 LEU n 1 127 SER n 1 128 THR n 1 129 TYR n 1 130 ASN n 1 131 SER n 1 132 PHE n 1 133 ALA n 1 134 ILE n 1 135 LYS n 1 136 GLY n 1 137 GLN n 1 138 MET n 1 139 GLU n 1 140 LYS n 1 141 ALA n 1 142 LYS n 1 143 LYS n 1 144 LEU n 1 145 ALA n 1 146 MET n 1 147 ALA n 1 148 TYR n 1 149 GLN n 1 150 VAL n 1 151 THR n 1 152 GLY n 1 153 VAL n 1 154 PRO n 1 155 THR n 1 156 MET n 1 157 VAL n 1 158 VAL n 1 159 ASN n 1 160 GLY n 1 161 LYS n 1 162 TYR n 1 163 ARG n 1 164 PHE n 1 165 ASP n 1 166 ILE n 1 167 GLY n 1 168 SER n 1 169 ALA n 1 170 GLY n 1 171 GLY n 1 172 PRO n 1 173 GLU n 1 174 GLU n 1 175 THR n 1 176 LEU n 1 177 LYS n 1 178 LEU n 1 179 ALA n 1 180 ASP n 1 181 TYR n 1 182 LEU n 1 183 ILE n 1 184 GLU n 1 185 LYS n 1 186 GLU n 1 187 ARG n 1 188 ALA n 1 189 ALA n 1 190 ALA n 1 191 LYS n 1 192 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 192 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'dsbA, PA5489' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 15692 / PAO1 / 1C / PRS 101 / LMG 12228' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pseudomonas aeruginosa' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 208964 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3) pLysS' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DSBA_PSEAE _struct_ref.pdbx_db_accession P0C2B2 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ADDYTAGKEYVELSSPVPVSQPGKIEVVELFWYGCPHCYAFEPTIVPWSEKLPADVHFVRLPALFGGIWNVHGQMFLTLE SMGVEHDVHNAVFEAIHKEHKKLATPEEMADFLAGKGVDKEKFLSTYNSFAIKGQMEKAKKLAMAYQVTGVPTMVVNGKY RFDIGSAGGPEETLKLADYLIEKERAAAKK ; _struct_ref.pdbx_align_begin 22 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4ZL7 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 3 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 192 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P0C2B2 _struct_ref_seq.db_align_beg 22 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 211 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3 _struct_ref_seq.pdbx_auth_seq_align_end 192 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4ZL7 SER A 1 ? UNP P0C2B2 ? ? 'expression tag' 1 1 1 4ZL7 ASN A 2 ? UNP P0C2B2 ? ? 'expression tag' 2 2 1 4ZL7 ILE A 82 ? UNP P0C2B2 GLU 101 'engineered mutation' 82 3 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 P6G non-polymer . 'HEXAETHYLENE GLYCOL' 'POLYETHYLENE GLYCOL PEG400' 'C12 H26 O7' 282.331 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4ZL7 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.20 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.13 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '20-29 % PEG 1500, 0.1 M MES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-02-13 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.95370 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'AUSTRALIAN SYNCHROTRON BEAMLINE MX2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.95370 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline MX2 _diffrn_source.pdbx_synchrotron_site 'Australian Synchrotron' # _reflns.B_iso_Wilson_estimate 22.180 _reflns.entry_id 4ZL7 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.92 _reflns.d_resolution_low 41.67 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 19942 _reflns.number_obs 13668 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.6 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.081 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.096 _reflns.pdbx_Rpim_I_all 0.051 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 47377 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 1.920 2.030 ? 1.900 6746 ? ? 1981 ? 99.500 ? ? ? ? 0.405 ? ? ? ? ? ? ? ? 3.400 0.405 ? ? 2.800 ? 0.258 0 1 1 ? ? 2.030 2.150 ? 2.500 6656 ? ? 1883 ? 99.700 ? ? ? ? 0.279 ? ? ? ? ? ? ? ? 3.500 0.279 ? ? 4.500 ? 0.175 0 2 1 ? ? 2.150 2.300 ? 3.800 6287 ? ? 1773 ? 99.600 ? ? ? ? 0.192 ? ? ? ? ? ? ? ? 3.500 0.192 ? ? 6.200 ? 0.120 0 3 1 ? ? 2.300 2.480 ? 5.400 5841 ? ? 1652 ? 99.700 ? ? ? ? 0.138 ? ? ? ? ? ? ? ? 3.500 0.138 ? ? 8.000 ? 0.086 0 4 1 ? ? 2.480 2.720 ? 6.400 5296 ? ? 1507 ? 99.700 ? ? ? ? 0.112 ? ? ? ? ? ? ? ? 3.500 0.112 ? ? 9.700 ? 0.070 0 5 1 ? ? 2.720 3.040 ? 9.000 4779 ? ? 1362 ? 99.200 ? ? ? ? 0.077 ? ? ? ? ? ? ? ? 3.500 0.077 ? ? 12.700 ? 0.048 0 6 1 ? ? 3.040 3.510 ? 12.000 4195 ? ? 1224 ? 99.500 ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 3.400 0.053 ? ? 16.500 ? 0.034 0 7 1 ? ? 3.510 4.300 ? 11.200 3450 ? ? 1026 ? 99.900 ? ? ? ? 0.050 ? ? ? ? ? ? ? ? 3.400 0.050 ? ? 19.600 ? 0.032 0 8 1 ? ? 4.300 6.080 ? 9.900 2515 ? ? 802 ? 99.200 ? ? ? ? 0.056 ? ? ? ? ? ? ? ? 3.100 0.056 ? ? 19.400 ? 0.036 0 9 1 ? ? 6.080 41.258 ? 15.300 1612 ? ? 458 ? 99.800 ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 3.500 0.035 ? ? 20.400 ? 0.022 0 10 1 ? ? # _refine.entry_id 4ZL7 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_d_res_high 1.9220 _refine.ls_d_res_low 41.2580 _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.5000 _refine.ls_number_reflns_obs 13653 _refine.ls_number_reflns_all ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.ls_matrix_type ? _refine.pdbx_R_Free_selection_details ? _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1612 _refine.ls_R_factor_R_work 0.1590 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2021 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 5.0300 _refine.ls_number_reflns_R_free 687 _refine.ls_number_reflns_R_work 12966 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 19.3800 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.2100 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 3H93 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8740 _refine.B_iso_max 76.490 _refine.B_iso_min 7.250 _refine.pdbx_overall_phase_error 19.8400 _refine.occupancy_max ? _refine.occupancy_min ? _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_R_factor_R_free_error_details ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 1.9220 _refine_hist.d_res_low 41.2580 _refine_hist.pdbx_number_atoms_ligand 19 _refine_hist.number_atoms_solvent 111 _refine_hist.number_atoms_total 1583 _refine_hist.pdbx_number_residues_total 185 _refine_hist.pdbx_B_iso_mean_ligand 45.26 _refine_hist.pdbx_B_iso_mean_solvent 27.71 _refine_hist.pdbx_number_atoms_protein 1453 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' f_bond_d 1541 0.012 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 2087 1.341 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 222 0.073 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 265 0.006 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 576 14.856 ? ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_obs 1.922 2.0705 5 100.0000 2586 . 0.1836 0.2349 . 141 . 2727 . 'X-RAY DIFFRACTION' . 2.0705 2.2788 5 100.0000 2559 . 0.1594 0.2368 . 140 . 2699 . 'X-RAY DIFFRACTION' . 2.2788 2.6085 5 99.0000 2607 . 0.1564 0.2596 . 125 . 2732 . 'X-RAY DIFFRACTION' . 2.6085 3.2863 5 99.0000 2571 . 0.1608 0.2247 . 144 . 2715 . 'X-RAY DIFFRACTION' . 3.2863 41.2676 5 100.0000 2643 . 0.1537 0.1514 . 137 . 2780 . 'X-RAY DIFFRACTION' . # _struct.entry_id 4ZL7 _struct.title 'Crystal structure of Pseudomonas aeruginosa DsbA E82I: Crystal I' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4ZL7 _struct_keywords.text 'thioredoxin fold, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 CYS A 37 ? LYS A 53 ? CYS A 37 LYS A 53 1 ? 17 HELX_P HELX_P2 AA2 GLY A 69 ? MET A 84 ? GLY A 69 MET A 84 1 ? 16 HELX_P HELX_P3 AA3 VAL A 86 ? LYS A 100 ? VAL A 86 LYS A 100 1 ? 15 HELX_P HELX_P4 AA4 THR A 107 ? GLY A 117 ? THR A 107 GLY A 117 1 ? 11 HELX_P HELX_P5 AA5 ASP A 121 ? ASN A 130 ? ASP A 121 ASN A 130 1 ? 10 HELX_P HELX_P6 AA6 SER A 131 ? GLN A 149 ? SER A 131 GLN A 149 1 ? 19 HELX_P HELX_P7 AA7 ILE A 166 ? GLY A 170 ? ILE A 166 GLY A 170 1 ? 5 HELX_P HELX_P8 AA8 GLY A 171 ? ALA A 188 ? GLY A 171 ALA A 188 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id disulf1 _struct_conn.conn_type_id disulf _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id CYS _struct_conn.ptnr1_label_seq_id 37 _struct_conn.ptnr1_label_atom_id SG _struct_conn.pdbx_ptnr1_label_alt_id A _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id A _struct_conn.ptnr2_label_comp_id CYS _struct_conn.ptnr2_label_seq_id 40 _struct_conn.ptnr2_label_atom_id SG _struct_conn.pdbx_ptnr2_label_alt_id A _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id CYS _struct_conn.ptnr1_auth_seq_id 37 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CYS _struct_conn.ptnr2_auth_seq_id 40 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.023 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 153 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 153 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 154 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 154 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -6.25 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 13 ? GLU A 14 ? VAL A 13 GLU A 14 AA1 2 TYR A 162 ? ASP A 165 ? TYR A 162 ASP A 165 AA1 3 THR A 155 ? VAL A 158 ? THR A 155 VAL A 158 AA1 4 ILE A 27 ? PHE A 33 ? ILE A 27 PHE A 33 AA1 5 VAL A 58 ? PRO A 64 ? VAL A 58 PRO A 64 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 13 ? N VAL A 13 O ARG A 163 ? O ARG A 163 AA1 2 3 O PHE A 164 ? O PHE A 164 N MET A 156 ? N MET A 156 AA1 3 4 O VAL A 157 ? O VAL A 157 N VAL A 30 ? N VAL A 30 AA1 4 5 N VAL A 29 ? N VAL A 29 O VAL A 61 ? O VAL A 61 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id P6G _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'binding site for residue P6G A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 PRO A 49 ? PRO A 49 . ? 1_555 ? 2 AC1 3 TRP A 50 ? TRP A 50 . ? 1_555 ? 3 AC1 3 LYS A 53 ? LYS A 53 . ? 1_555 ? # _atom_sites.entry_id 4ZL7 _atom_sites.fract_transf_matrix[1][1] 0.028297 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.003755 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016049 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024238 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 1 ? ? ? A . n A 1 2 ASN 2 2 ? ? ? A . n A 1 3 ALA 3 3 ? ? ? A . n A 1 4 ASP 4 4 ? ? ? A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 TYR 6 6 6 TYR TYR A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 ALA 8 8 8 ALA ALA A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 LYS 10 10 10 LYS LYS A . n A 1 11 GLU 11 11 11 GLU GLU A . n A 1 12 TYR 12 12 12 TYR TYR A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 PRO 18 18 18 PRO PRO A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 PRO 20 20 20 PRO PRO A . n A 1 21 VAL 21 21 21 VAL VAL A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLN 23 23 23 GLN GLN A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 GLY 25 25 25 GLY GLY A . n A 1 26 LYS 26 26 26 LYS LYS A . n A 1 27 ILE 27 27 27 ILE ILE A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 VAL 29 29 29 VAL VAL A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 PHE 33 33 33 PHE PHE A . n A 1 34 TRP 34 34 34 TRP TRP A . n A 1 35 TYR 35 35 35 TYR TYR A . n A 1 36 GLY 36 36 36 GLY GLY A . n A 1 37 CYS 37 37 37 CYS CYS A . n A 1 38 PRO 38 38 38 PRO PRO A . n A 1 39 HIS 39 39 39 HIS HIS A . n A 1 40 CYS 40 40 40 CYS CYS A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 PHE 43 43 43 PHE PHE A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 PRO 45 45 45 PRO PRO A . n A 1 46 THR 46 46 46 THR THR A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 TRP 50 50 50 TRP TRP A . n A 1 51 SER 51 51 51 SER SER A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 LEU 54 54 54 LEU LEU A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 ALA 56 56 56 ALA ALA A . n A 1 57 ASP 57 57 57 ASP ASP A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 HIS 59 59 59 HIS HIS A . n A 1 60 PHE 60 60 60 PHE PHE A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 ALA 65 65 65 ALA ALA A . n A 1 66 LEU 66 66 66 LEU LEU A . n A 1 67 PHE 67 67 67 PHE PHE A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 GLY 69 69 69 GLY GLY A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 TRP 71 71 71 TRP TRP A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 HIS 74 74 74 HIS HIS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 MET 77 77 77 MET MET A . n A 1 78 PHE 78 78 78 PHE PHE A . n A 1 79 LEU 79 79 79 LEU LEU A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ILE 82 82 82 ILE ILE A . n A 1 83 SER 83 83 83 SER SER A . n A 1 84 MET 84 84 84 MET MET A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 GLU 87 87 87 GLU GLU A . n A 1 88 HIS 88 88 88 HIS HIS A . n A 1 89 ASP 89 89 89 ASP ASP A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 HIS 91 91 91 HIS HIS A . n A 1 92 ASN 92 92 92 ASN ASN A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 PHE 95 95 95 PHE PHE A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 LYS 100 100 100 LYS LYS A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 HIS 102 102 102 HIS HIS A . n A 1 103 LYS 103 103 103 LYS LYS A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 LEU 105 105 105 LEU LEU A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 PRO 108 108 108 PRO PRO A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 GLU 110 110 110 GLU GLU A . n A 1 111 MET 111 111 111 MET MET A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 ASP 113 113 113 ASP ASP A . n A 1 114 PHE 114 114 114 PHE PHE A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 GLY 117 117 117 GLY GLY A . n A 1 118 LYS 118 118 118 LYS LYS A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 VAL 120 120 120 VAL VAL A . n A 1 121 ASP 121 121 121 ASP ASP A . n A 1 122 LYS 122 122 122 LYS LYS A . n A 1 123 GLU 123 123 123 GLU GLU A . n A 1 124 LYS 124 124 124 LYS LYS A . n A 1 125 PHE 125 125 125 PHE PHE A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 THR 128 128 128 THR THR A . n A 1 129 TYR 129 129 129 TYR TYR A . n A 1 130 ASN 130 130 130 ASN ASN A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 ALA 133 133 133 ALA ALA A . n A 1 134 ILE 134 134 134 ILE ILE A . n A 1 135 LYS 135 135 135 LYS LYS A . n A 1 136 GLY 136 136 136 GLY GLY A . n A 1 137 GLN 137 137 137 GLN GLN A . n A 1 138 MET 138 138 138 MET MET A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 LYS 140 140 140 LYS LYS A . n A 1 141 ALA 141 141 141 ALA ALA A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 LEU 144 144 144 LEU LEU A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 MET 146 146 146 MET MET A . n A 1 147 ALA 147 147 147 ALA ALA A . n A 1 148 TYR 148 148 148 TYR TYR A . n A 1 149 GLN 149 149 149 GLN GLN A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 THR 151 151 151 THR THR A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 VAL 153 153 153 VAL VAL A . n A 1 154 PRO 154 154 154 PRO PRO A . n A 1 155 THR 155 155 155 THR THR A . n A 1 156 MET 156 156 156 MET MET A . n A 1 157 VAL 157 157 157 VAL VAL A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ASN 159 159 159 ASN ASN A . n A 1 160 GLY 160 160 160 GLY GLY A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 TYR 162 162 162 TYR TYR A . n A 1 163 ARG 163 163 163 ARG ARG A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 ASP 165 165 165 ASP ASP A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 GLY 167 167 167 GLY GLY A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 ALA 169 169 169 ALA ALA A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 PRO 172 172 172 PRO PRO A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 LEU 176 176 176 LEU LEU A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 LEU 178 178 178 LEU LEU A . n A 1 179 ALA 179 179 179 ALA ALA A . n A 1 180 ASP 180 180 180 ASP ASP A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 LEU 182 182 182 LEU LEU A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 ARG 187 187 187 ARG ARG A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ALA 189 189 189 ALA ALA A . n A 1 190 ALA 190 190 ? ? ? A . n A 1 191 LYS 191 191 ? ? ? A . n A 1 192 LYS 192 192 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 P6G 1 201 201 P6G P6G A . C 3 HOH 1 301 381 HOH HOH A . C 3 HOH 2 302 369 HOH HOH A . C 3 HOH 3 303 367 HOH HOH A . C 3 HOH 4 304 392 HOH HOH A . C 3 HOH 5 305 311 HOH HOH A . C 3 HOH 6 306 332 HOH HOH A . C 3 HOH 7 307 356 HOH HOH A . C 3 HOH 8 308 351 HOH HOH A . C 3 HOH 9 309 307 HOH HOH A . C 3 HOH 10 310 388 HOH HOH A . C 3 HOH 11 311 325 HOH HOH A . C 3 HOH 12 312 406 HOH HOH A . C 3 HOH 13 313 305 HOH HOH A . C 3 HOH 14 314 331 HOH HOH A . C 3 HOH 15 315 323 HOH HOH A . C 3 HOH 16 316 303 HOH HOH A . C 3 HOH 17 317 313 HOH HOH A . C 3 HOH 18 318 308 HOH HOH A . C 3 HOH 19 319 304 HOH HOH A . C 3 HOH 20 320 360 HOH HOH A . C 3 HOH 21 321 363 HOH HOH A . C 3 HOH 22 322 364 HOH HOH A . C 3 HOH 23 323 320 HOH HOH A . C 3 HOH 24 324 302 HOH HOH A . C 3 HOH 25 325 411 HOH HOH A . C 3 HOH 26 326 316 HOH HOH A . C 3 HOH 27 327 348 HOH HOH A . C 3 HOH 28 328 326 HOH HOH A . C 3 HOH 29 329 328 HOH HOH A . C 3 HOH 30 330 374 HOH HOH A . C 3 HOH 31 331 336 HOH HOH A . C 3 HOH 32 332 394 HOH HOH A . C 3 HOH 33 333 314 HOH HOH A . C 3 HOH 34 334 342 HOH HOH A . C 3 HOH 35 335 324 HOH HOH A . C 3 HOH 36 336 315 HOH HOH A . C 3 HOH 37 337 352 HOH HOH A . C 3 HOH 38 338 337 HOH HOH A . C 3 HOH 39 339 368 HOH HOH A . C 3 HOH 40 340 338 HOH HOH A . C 3 HOH 41 341 366 HOH HOH A . C 3 HOH 42 342 404 HOH HOH A . C 3 HOH 43 343 353 HOH HOH A . C 3 HOH 44 344 347 HOH HOH A . C 3 HOH 45 345 312 HOH HOH A . C 3 HOH 46 346 396 HOH HOH A . C 3 HOH 47 347 318 HOH HOH A . C 3 HOH 48 348 350 HOH HOH A . C 3 HOH 49 349 330 HOH HOH A . C 3 HOH 50 350 343 HOH HOH A . C 3 HOH 51 351 319 HOH HOH A . C 3 HOH 52 352 345 HOH HOH A . C 3 HOH 53 353 379 HOH HOH A . C 3 HOH 54 354 327 HOH HOH A . C 3 HOH 55 355 341 HOH HOH A . C 3 HOH 56 356 370 HOH HOH A . C 3 HOH 57 357 408 HOH HOH A . C 3 HOH 58 358 385 HOH HOH A . C 3 HOH 59 359 358 HOH HOH A . C 3 HOH 60 360 376 HOH HOH A . C 3 HOH 61 361 333 HOH HOH A . C 3 HOH 62 362 349 HOH HOH A . C 3 HOH 63 363 359 HOH HOH A . C 3 HOH 64 364 334 HOH HOH A . C 3 HOH 65 365 306 HOH HOH A . C 3 HOH 66 366 362 HOH HOH A . C 3 HOH 67 367 321 HOH HOH A . C 3 HOH 68 368 378 HOH HOH A . C 3 HOH 69 369 310 HOH HOH A . C 3 HOH 70 370 373 HOH HOH A . C 3 HOH 71 371 398 HOH HOH A . C 3 HOH 72 372 335 HOH HOH A . C 3 HOH 73 373 393 HOH HOH A . C 3 HOH 74 374 322 HOH HOH A . C 3 HOH 75 375 399 HOH HOH A . C 3 HOH 76 376 357 HOH HOH A . C 3 HOH 77 377 382 HOH HOH A . C 3 HOH 78 378 389 HOH HOH A . C 3 HOH 79 379 402 HOH HOH A . C 3 HOH 80 380 317 HOH HOH A . C 3 HOH 81 381 377 HOH HOH A . C 3 HOH 82 382 339 HOH HOH A . C 3 HOH 83 383 329 HOH HOH A . C 3 HOH 84 384 380 HOH HOH A . C 3 HOH 85 385 361 HOH HOH A . C 3 HOH 86 386 301 HOH HOH A . C 3 HOH 87 387 397 HOH HOH A . C 3 HOH 88 388 372 HOH HOH A . C 3 HOH 89 389 407 HOH HOH A . C 3 HOH 90 390 409 HOH HOH A . C 3 HOH 91 391 346 HOH HOH A . C 3 HOH 92 392 371 HOH HOH A . C 3 HOH 93 393 387 HOH HOH A . C 3 HOH 94 394 344 HOH HOH A . C 3 HOH 95 395 403 HOH HOH A . C 3 HOH 96 396 405 HOH HOH A . C 3 HOH 97 397 390 HOH HOH A . C 3 HOH 98 398 384 HOH HOH A . C 3 HOH 99 399 391 HOH HOH A . C 3 HOH 100 400 375 HOH HOH A . C 3 HOH 101 401 395 HOH HOH A . C 3 HOH 102 402 365 HOH HOH A . C 3 HOH 103 403 400 HOH HOH A . C 3 HOH 104 404 386 HOH HOH A . C 3 HOH 105 405 355 HOH HOH A . C 3 HOH 106 406 410 HOH HOH A . C 3 HOH 107 407 401 HOH HOH A . C 3 HOH 108 408 340 HOH HOH A . C 3 HOH 109 409 383 HOH HOH A . C 3 HOH 110 410 309 HOH HOH A . C 3 HOH 111 411 354 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-09 2 'Structure model' 1 1 2018-04-18 3 'Structure model' 1 2 2020-01-01 4 'Structure model' 1 3 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Refinement description' 5 3 'Structure model' 'Author supporting evidence' 6 4 'Structure model' 'Data collection' 7 4 'Structure model' 'Database references' 8 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' diffrn_source 3 2 'Structure model' pdbx_struct_oper_list 4 2 'Structure model' refine 5 3 'Structure model' pdbx_audit_support 6 4 'Structure model' chem_comp_atom 7 4 'Structure model' chem_comp_bond 8 4 'Structure model' database_2 9 4 'Structure model' diffrn_radiation_wavelength 10 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_abbrev' 2 2 'Structure model' '_citation.pdbx_database_id_PubMed' 3 2 'Structure model' '_citation.title' 4 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 5 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 6 2 'Structure model' '_refine.pdbx_method_to_determine_struct' 7 3 'Structure model' '_pdbx_audit_support.funding_organization' 8 4 'Structure model' '_database_2.pdbx_DOI' 9 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined 77.4136 -11.6081 40.5682 0.1284 0.0777 0.1039 -0.0059 -0.0103 -0.0155 2.4219 1.4815 0.5189 -1.0813 -0.2342 -0.3158 -0.0611 -0.0226 0.0892 -0.0295 -0.1217 0.0683 -0.0637 0.0216 0.0241 'X-RAY DIFFRACTION' 2 ? refined 67.1435 -2.3514 53.8184 0.1048 0.0971 0.1165 0.0053 -0.0058 0.0114 1.6713 2.4164 3.4091 0.7058 -0.2026 0.2501 0.1272 -0.0421 -0.0639 -0.1441 0.0059 0.0328 0.2630 -0.0088 -0.0693 'X-RAY DIFFRACTION' 3 ? refined 79.1960 -14.7395 34.8755 0.1194 0.0894 0.0813 -0.0099 -0.0060 -0.0169 5.6973 4.0137 2.6858 0.1884 -0.3307 0.9482 0.1582 -0.0716 -0.0264 0.2150 -0.2948 0.1089 -0.2445 0.1200 0.0502 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 0 A 0 ;chain 'A' and (resid 5 through 68 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 0 A 0 ;chain 'A' and (resid 69 through 148 ) ; ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 0 A 0 ;chain 'A' and (resid 149 through 189 ) ; ? ? ? ? ? # _pdbx_phasing_MR.entry_id 4ZL7 _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 1.920 _pdbx_phasing_MR.d_res_low_rotation 41.260 _pdbx_phasing_MR.d_res_high_translation 1.920 _pdbx_phasing_MR.d_res_low_translation 41.260 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? MOSFLM ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALA ? ? ? 3.3.20 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.0 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 391 ? ? O A HOH 405 ? ? 2.03 2 1 OH A TYR 41 ? ? NZ A LYS 100 ? ? 2.17 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id LYS _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 10 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -107.21 _pdbx_validate_torsion.psi -83.11 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 1 ? A SER 1 2 1 Y 1 A ASN 2 ? A ASN 2 3 1 Y 1 A ALA 3 ? A ALA 3 4 1 Y 1 A ASP 4 ? A ASP 4 5 1 Y 1 A ALA 190 ? A ALA 190 6 1 Y 1 A LYS 191 ? A LYS 191 7 1 Y 1 A LYS 192 ? A LYS 192 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 P6G O1 O N N 250 P6G C2 C N N 251 P6G C3 C N N 252 P6G O4 O N N 253 P6G C5 C N N 254 P6G C6 C N N 255 P6G O7 O N N 256 P6G C8 C N N 257 P6G C9 C N N 258 P6G O10 O N N 259 P6G C11 C N N 260 P6G C12 C N N 261 P6G O13 O N N 262 P6G C14 C N N 263 P6G C15 C N N 264 P6G O16 O N N 265 P6G C17 C N N 266 P6G C18 C N N 267 P6G O19 O N N 268 P6G H1 H N N 269 P6G H21 H N N 270 P6G H22 H N N 271 P6G H31 H N N 272 P6G H32 H N N 273 P6G H51 H N N 274 P6G H52 H N N 275 P6G H61 H N N 276 P6G H62 H N N 277 P6G H81 H N N 278 P6G H82 H N N 279 P6G H91 H N N 280 P6G H92 H N N 281 P6G H111 H N N 282 P6G H112 H N N 283 P6G H121 H N N 284 P6G H122 H N N 285 P6G H141 H N N 286 P6G H142 H N N 287 P6G H151 H N N 288 P6G H152 H N N 289 P6G H171 H N N 290 P6G H172 H N N 291 P6G H181 H N N 292 P6G H182 H N N 293 P6G H19 H N N 294 PHE N N N N 295 PHE CA C N S 296 PHE C C N N 297 PHE O O N N 298 PHE CB C N N 299 PHE CG C Y N 300 PHE CD1 C Y N 301 PHE CD2 C Y N 302 PHE CE1 C Y N 303 PHE CE2 C Y N 304 PHE CZ C Y N 305 PHE OXT O N N 306 PHE H H N N 307 PHE H2 H N N 308 PHE HA H N N 309 PHE HB2 H N N 310 PHE HB3 H N N 311 PHE HD1 H N N 312 PHE HD2 H N N 313 PHE HE1 H N N 314 PHE HE2 H N N 315 PHE HZ H N N 316 PHE HXT H N N 317 PRO N N N N 318 PRO CA C N S 319 PRO C C N N 320 PRO O O N N 321 PRO CB C N N 322 PRO CG C N N 323 PRO CD C N N 324 PRO OXT O N N 325 PRO H H N N 326 PRO HA H N N 327 PRO HB2 H N N 328 PRO HB3 H N N 329 PRO HG2 H N N 330 PRO HG3 H N N 331 PRO HD2 H N N 332 PRO HD3 H N N 333 PRO HXT H N N 334 SER N N N N 335 SER CA C N S 336 SER C C N N 337 SER O O N N 338 SER CB C N N 339 SER OG O N N 340 SER OXT O N N 341 SER H H N N 342 SER H2 H N N 343 SER HA H N N 344 SER HB2 H N N 345 SER HB3 H N N 346 SER HG H N N 347 SER HXT H N N 348 THR N N N N 349 THR CA C N S 350 THR C C N N 351 THR O O N N 352 THR CB C N R 353 THR OG1 O N N 354 THR CG2 C N N 355 THR OXT O N N 356 THR H H N N 357 THR H2 H N N 358 THR HA H N N 359 THR HB H N N 360 THR HG1 H N N 361 THR HG21 H N N 362 THR HG22 H N N 363 THR HG23 H N N 364 THR HXT H N N 365 TRP N N N N 366 TRP CA C N S 367 TRP C C N N 368 TRP O O N N 369 TRP CB C N N 370 TRP CG C Y N 371 TRP CD1 C Y N 372 TRP CD2 C Y N 373 TRP NE1 N Y N 374 TRP CE2 C Y N 375 TRP CE3 C Y N 376 TRP CZ2 C Y N 377 TRP CZ3 C Y N 378 TRP CH2 C Y N 379 TRP OXT O N N 380 TRP H H N N 381 TRP H2 H N N 382 TRP HA H N N 383 TRP HB2 H N N 384 TRP HB3 H N N 385 TRP HD1 H N N 386 TRP HE1 H N N 387 TRP HE3 H N N 388 TRP HZ2 H N N 389 TRP HZ3 H N N 390 TRP HH2 H N N 391 TRP HXT H N N 392 TYR N N N N 393 TYR CA C N S 394 TYR C C N N 395 TYR O O N N 396 TYR CB C N N 397 TYR CG C Y N 398 TYR CD1 C Y N 399 TYR CD2 C Y N 400 TYR CE1 C Y N 401 TYR CE2 C Y N 402 TYR CZ C Y N 403 TYR OH O N N 404 TYR OXT O N N 405 TYR H H N N 406 TYR H2 H N N 407 TYR HA H N N 408 TYR HB2 H N N 409 TYR HB3 H N N 410 TYR HD1 H N N 411 TYR HD2 H N N 412 TYR HE1 H N N 413 TYR HE2 H N N 414 TYR HH H N N 415 TYR HXT H N N 416 VAL N N N N 417 VAL CA C N S 418 VAL C C N N 419 VAL O O N N 420 VAL CB C N N 421 VAL CG1 C N N 422 VAL CG2 C N N 423 VAL OXT O N N 424 VAL H H N N 425 VAL H2 H N N 426 VAL HA H N N 427 VAL HB H N N 428 VAL HG11 H N N 429 VAL HG12 H N N 430 VAL HG13 H N N 431 VAL HG21 H N N 432 VAL HG22 H N N 433 VAL HG23 H N N 434 VAL HXT H N N 435 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 P6G O1 C2 sing N N 237 P6G O1 H1 sing N N 238 P6G C2 C3 sing N N 239 P6G C2 H21 sing N N 240 P6G C2 H22 sing N N 241 P6G C3 O4 sing N N 242 P6G C3 H31 sing N N 243 P6G C3 H32 sing N N 244 P6G O4 C5 sing N N 245 P6G C5 C6 sing N N 246 P6G C5 H51 sing N N 247 P6G C5 H52 sing N N 248 P6G C6 O7 sing N N 249 P6G C6 H61 sing N N 250 P6G C6 H62 sing N N 251 P6G O7 C8 sing N N 252 P6G C8 C9 sing N N 253 P6G C8 H81 sing N N 254 P6G C8 H82 sing N N 255 P6G C9 O10 sing N N 256 P6G C9 H91 sing N N 257 P6G C9 H92 sing N N 258 P6G O10 C11 sing N N 259 P6G C11 C12 sing N N 260 P6G C11 H111 sing N N 261 P6G C11 H112 sing N N 262 P6G C12 O13 sing N N 263 P6G C12 H121 sing N N 264 P6G C12 H122 sing N N 265 P6G O13 C14 sing N N 266 P6G C14 C15 sing N N 267 P6G C14 H141 sing N N 268 P6G C14 H142 sing N N 269 P6G C15 O16 sing N N 270 P6G C15 H151 sing N N 271 P6G C15 H152 sing N N 272 P6G O16 C17 sing N N 273 P6G C17 C18 sing N N 274 P6G C17 H171 sing N N 275 P6G C17 H172 sing N N 276 P6G C18 O19 sing N N 277 P6G C18 H181 sing N N 278 P6G C18 H182 sing N N 279 P6G O19 H19 sing N N 280 PHE N CA sing N N 281 PHE N H sing N N 282 PHE N H2 sing N N 283 PHE CA C sing N N 284 PHE CA CB sing N N 285 PHE CA HA sing N N 286 PHE C O doub N N 287 PHE C OXT sing N N 288 PHE CB CG sing N N 289 PHE CB HB2 sing N N 290 PHE CB HB3 sing N N 291 PHE CG CD1 doub Y N 292 PHE CG CD2 sing Y N 293 PHE CD1 CE1 sing Y N 294 PHE CD1 HD1 sing N N 295 PHE CD2 CE2 doub Y N 296 PHE CD2 HD2 sing N N 297 PHE CE1 CZ doub Y N 298 PHE CE1 HE1 sing N N 299 PHE CE2 CZ sing Y N 300 PHE CE2 HE2 sing N N 301 PHE CZ HZ sing N N 302 PHE OXT HXT sing N N 303 PRO N CA sing N N 304 PRO N CD sing N N 305 PRO N H sing N N 306 PRO CA C sing N N 307 PRO CA CB sing N N 308 PRO CA HA sing N N 309 PRO C O doub N N 310 PRO C OXT sing N N 311 PRO CB CG sing N N 312 PRO CB HB2 sing N N 313 PRO CB HB3 sing N N 314 PRO CG CD sing N N 315 PRO CG HG2 sing N N 316 PRO CG HG3 sing N N 317 PRO CD HD2 sing N N 318 PRO CD HD3 sing N N 319 PRO OXT HXT sing N N 320 SER N CA sing N N 321 SER N H sing N N 322 SER N H2 sing N N 323 SER CA C sing N N 324 SER CA CB sing N N 325 SER CA HA sing N N 326 SER C O doub N N 327 SER C OXT sing N N 328 SER CB OG sing N N 329 SER CB HB2 sing N N 330 SER CB HB3 sing N N 331 SER OG HG sing N N 332 SER OXT HXT sing N N 333 THR N CA sing N N 334 THR N H sing N N 335 THR N H2 sing N N 336 THR CA C sing N N 337 THR CA CB sing N N 338 THR CA HA sing N N 339 THR C O doub N N 340 THR C OXT sing N N 341 THR CB OG1 sing N N 342 THR CB CG2 sing N N 343 THR CB HB sing N N 344 THR OG1 HG1 sing N N 345 THR CG2 HG21 sing N N 346 THR CG2 HG22 sing N N 347 THR CG2 HG23 sing N N 348 THR OXT HXT sing N N 349 TRP N CA sing N N 350 TRP N H sing N N 351 TRP N H2 sing N N 352 TRP CA C sing N N 353 TRP CA CB sing N N 354 TRP CA HA sing N N 355 TRP C O doub N N 356 TRP C OXT sing N N 357 TRP CB CG sing N N 358 TRP CB HB2 sing N N 359 TRP CB HB3 sing N N 360 TRP CG CD1 doub Y N 361 TRP CG CD2 sing Y N 362 TRP CD1 NE1 sing Y N 363 TRP CD1 HD1 sing N N 364 TRP CD2 CE2 doub Y N 365 TRP CD2 CE3 sing Y N 366 TRP NE1 CE2 sing Y N 367 TRP NE1 HE1 sing N N 368 TRP CE2 CZ2 sing Y N 369 TRP CE3 CZ3 doub Y N 370 TRP CE3 HE3 sing N N 371 TRP CZ2 CH2 doub Y N 372 TRP CZ2 HZ2 sing N N 373 TRP CZ3 CH2 sing Y N 374 TRP CZ3 HZ3 sing N N 375 TRP CH2 HH2 sing N N 376 TRP OXT HXT sing N N 377 TYR N CA sing N N 378 TYR N H sing N N 379 TYR N H2 sing N N 380 TYR CA C sing N N 381 TYR CA CB sing N N 382 TYR CA HA sing N N 383 TYR C O doub N N 384 TYR C OXT sing N N 385 TYR CB CG sing N N 386 TYR CB HB2 sing N N 387 TYR CB HB3 sing N N 388 TYR CG CD1 doub Y N 389 TYR CG CD2 sing Y N 390 TYR CD1 CE1 sing Y N 391 TYR CD1 HD1 sing N N 392 TYR CD2 CE2 doub Y N 393 TYR CD2 HD2 sing N N 394 TYR CE1 CZ doub Y N 395 TYR CE1 HE1 sing N N 396 TYR CE2 CZ sing Y N 397 TYR CE2 HE2 sing N N 398 TYR CZ OH sing N N 399 TYR OH HH sing N N 400 TYR OXT HXT sing N N 401 VAL N CA sing N N 402 VAL N H sing N N 403 VAL N H2 sing N N 404 VAL CA C sing N N 405 VAL CA CB sing N N 406 VAL CA HA sing N N 407 VAL C O doub N N 408 VAL C OXT sing N N 409 VAL CB CG1 sing N N 410 VAL CB CG2 sing N N 411 VAL CB HB sing N N 412 VAL CG1 HG11 sing N N 413 VAL CG1 HG12 sing N N 414 VAL CG1 HG13 sing N N 415 VAL CG2 HG21 sing N N 416 VAL CG2 HG22 sing N N 417 VAL CG2 HG23 sing N N 418 VAL OXT HXT sing N N 419 # _pdbx_audit_support.funding_organization 'Australian Research Council (ARC)' _pdbx_audit_support.country Australia _pdbx_audit_support.grant_number LP0990166 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'HEXAETHYLENE GLYCOL' P6G 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3H93 _pdbx_initial_refinement_model.details ? #