data_4ZN8 # _entry.id 4ZN8 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.319 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4ZN8 WWPDB D_1000209352 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 4NDJ unspecified PDB . 4NDK unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4ZN8 _pdbx_database_status.recvd_initial_deposition_date 2015-05-04 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Huang, P.-S.' 1 ? 'Thomas, L.M.' 2 ? 'Mayo, S.L.' 3 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 427 _citation.language ? _citation.page_first 2697 _citation.page_last 2706 _citation.title 'Using Molecular Dynamics Simulations as an Aid in the Prediction of Domain Swapping of Computationally Designed Protein Variants.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2015.06.006 _citation.pdbx_database_id_PubMed 26101839 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Mou, Y.' 1 ? primary 'Huang, P.S.' 2 ? primary 'Thomas, L.M.' 3 ? primary 'Mayo, S.L.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4ZN8 _cell.details ? _cell.formula_units_Z ? _cell.length_a 51.456 _cell.length_a_esd ? _cell.length_b 62.682 _cell.length_b_esd ? _cell.length_c 76.698 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 16 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4ZN8 _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'computationally modified engrailed homeodomain' 6687.403 4 ? ? ? ? 2 non-polymer syn 'POTASSIUM ION' 39.098 4 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code 'TEFSEEQKRTLDLLFLFDRR(MSE)TEERRRWLSQRLGLNEEQIERWFRRKEQQI' _entity_poly.pdbx_seq_one_letter_code_can TEFSEEQKRTLDLLFLFDRRMTEERRRWLSQRLGLNEEQIERWFRRKEQQI _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 THR n 1 2 GLU n 1 3 PHE n 1 4 SER n 1 5 GLU n 1 6 GLU n 1 7 GLN n 1 8 LYS n 1 9 ARG n 1 10 THR n 1 11 LEU n 1 12 ASP n 1 13 LEU n 1 14 LEU n 1 15 PHE n 1 16 LEU n 1 17 PHE n 1 18 ASP n 1 19 ARG n 1 20 ARG n 1 21 MSE n 1 22 THR n 1 23 GLU n 1 24 GLU n 1 25 ARG n 1 26 ARG n 1 27 ARG n 1 28 TRP n 1 29 LEU n 1 30 SER n 1 31 GLN n 1 32 ARG n 1 33 LEU n 1 34 GLY n 1 35 LEU n 1 36 ASN n 1 37 GLU n 1 38 GLU n 1 39 GLN n 1 40 ILE n 1 41 GLU n 1 42 ARG n 1 43 TRP n 1 44 PHE n 1 45 ARG n 1 46 ARG n 1 47 LYS n 1 48 GLU n 1 49 GLN n 1 50 GLN n 1 51 ILE n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 51 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Drosophila melanogaster' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 7227 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 4ZN8 _struct_ref.pdbx_db_accession 4ZN8 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin 1 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4ZN8 A 1 ? 51 ? 4ZN8 1 ? 51 ? 1 51 2 1 4ZN8 B 1 ? 51 ? 4ZN8 1 ? 51 ? 1 51 3 1 4ZN8 C 1 ? 51 ? 4ZN8 1 ? 51 ? 1 51 4 1 4ZN8 D 1 ? 51 ? 4ZN8 1 ? 51 ? 1 51 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 K non-polymer . 'POTASSIUM ION' ? 'K 1' 39.098 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4ZN8 _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.44 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 49.67 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 296 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '14% PEG3350, 0.2 M potassium phosphate, 0.1 M Tris, pH 7.0' _exptl_crystal_grow.pdbx_pH_range 7.0 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2004-12-04 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9794 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9794 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4ZN8 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.00 _reflns.d_resolution_low 39.778 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 5289 _reflns.number_obs 5197 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F 2 _reflns.observed_criterion_sigma_I 2 _reflns.percent_possible_obs 98.2 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 7 _reflns.pdbx_Rmerge_I_obs 0.2 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 7.9 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4ZN8 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.000 _refine.ls_d_res_low 39 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5192 _refine.ls_number_reflns_R_free 251 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.17 _refine.ls_percent_reflns_R_free 4.83 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2527 _refine.ls_R_factor_R_free 0.3121 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2495 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.88 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.60 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.33 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1767 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1771 _refine_hist.d_res_high 3.000 _refine_hist.d_res_low 39 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1795 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.628 ? 2382 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.571 ? 736 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.022 ? 229 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 314 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.0000 3.7792 . . 113 2405 98.00 . . . 0.2995 . 0.2557 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7792 39.7751 . . 138 2536 98.00 . . . 0.3189 . 0.2454 . . . . . . . . . . # _struct.entry_id 4ZN8 _struct.title 'Using molecular dynamics simulations to predict domain swapping of computationally designed protein variants' _struct.pdbx_descriptor 'computationally modified engrailed homeodomain' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4ZN8 _struct_keywords.text 'computational protein design, domain-swapped dimer, DE NOVO PROTEIN' _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 4 ? GLN A 31 ? SER A 4 GLN A 31 1 ? 28 HELX_P HELX_P2 AA2 GLU A 38 ? GLN A 49 ? GLU A 38 GLN A 49 1 ? 12 HELX_P HELX_P3 AA3 SER B 4 ? GLY B 34 ? SER B 4 GLY B 34 1 ? 31 HELX_P HELX_P4 AA4 ASN B 36 ? PHE B 44 ? ASN B 36 PHE B 44 1 ? 9 HELX_P HELX_P5 AA5 GLU C 6 ? LEU C 33 ? GLU C 6 LEU C 33 1 ? 28 HELX_P HELX_P6 AA6 ASN C 36 ? ARG C 46 ? ASN C 36 ARG C 46 1 ? 11 HELX_P HELX_P7 AA7 GLU D 6 ? GLY D 34 ? GLU D 6 GLY D 34 1 ? 29 HELX_P HELX_P8 AA8 ASN D 36 ? LYS D 47 ? ASN D 36 LYS D 47 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A ARG 20 C ? ? ? 1_555 A MSE 21 N ? ? A ARG 20 A MSE 21 1_555 ? ? ? ? ? ? ? 1.330 ? covale2 covale both ? A MSE 21 C ? ? ? 1_555 A THR 22 N ? ? A MSE 21 A THR 22 1_555 ? ? ? ? ? ? ? 1.330 ? covale3 covale both ? B ARG 20 C ? ? ? 1_555 B MSE 21 N ? ? B ARG 20 B MSE 21 1_555 ? ? ? ? ? ? ? 1.330 ? covale4 covale both ? B MSE 21 C ? ? ? 1_555 B THR 22 N ? ? B MSE 21 B THR 22 1_555 ? ? ? ? ? ? ? 1.328 ? covale5 covale both ? C ARG 20 C ? ? ? 1_555 C MSE 21 N ? ? C ARG 20 C MSE 21 1_555 ? ? ? ? ? ? ? 1.330 ? covale6 covale both ? C MSE 21 C ? ? ? 1_555 C THR 22 N ? ? C MSE 21 C THR 22 1_555 ? ? ? ? ? ? ? 1.330 ? metalc1 metalc ? ? C GLN 31 OE1 ? ? ? 1_555 F K . K ? ? C GLN 31 C K 101 1_555 ? ? ? ? ? ? ? 3.152 ? covale7 covale both ? D ARG 20 C ? ? ? 1_555 D MSE 21 N ? ? D ARG 20 D MSE 21 1_555 ? ? ? ? ? ? ? 1.329 ? covale8 covale both ? D MSE 21 C ? ? ? 1_555 D THR 22 N ? ? D MSE 21 D THR 22 1_555 ? ? ? ? ? ? ? 1.330 ? metalc2 metalc ? ? D ARG 46 O ? ? ? 1_555 H K . K ? ? D ARG 46 D K 101 1_555 ? ? ? ? ? ? ? 3.447 ? metalc3 metalc ? ? D ARG 27 O ? ? ? 1_555 F K . K ? ? D ARG 27 C K 101 3_655 ? ? ? ? ? ? ? 3.360 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A K 101 ? 1 'binding site for residue K A 101' AC2 Software C K 101 ? 3 'binding site for residue K C 101' AC3 Software D K 101 ? 2 'binding site for residue K D 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 ARG B 27 ? ARG B 27 . ? 3_655 ? 2 AC2 3 ARG B 20 ? ARG B 20 . ? 1_555 ? 3 AC2 3 GLN C 31 ? GLN C 31 . ? 1_555 ? 4 AC2 3 ARG D 27 ? ARG D 27 . ? 3_645 ? 5 AC3 2 ARG D 46 ? ARG D 46 . ? 1_555 ? 6 AC3 2 LYS D 47 ? LYS D 47 . ? 1_555 ? # _atom_sites.entry_id 4ZN8 _atom_sites.fract_transf_matrix[1][1] 0.019434 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015954 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013038 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C K N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 THR 1 1 1 THR ALA A . n A 1 2 GLU 2 2 2 GLU GLU A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 SER 4 4 4 SER SER A . n A 1 5 GLU 5 5 5 GLU GLU A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 LYS 8 8 8 LYS LYS A . n A 1 9 ARG 9 9 9 ARG ARG A . n A 1 10 THR 10 10 10 THR THR A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 PHE 15 15 15 PHE PHE A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 ARG 20 20 20 ARG ARG A . n A 1 21 MSE 21 21 21 MSE MSE A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 TRP 28 28 28 TRP TRP A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ARG 32 32 32 ARG ARG A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLY 34 34 34 GLY GLY A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 ASN 36 36 36 ASN ASN A . n A 1 37 GLU 37 37 37 GLU GLU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 TRP 43 43 43 TRP TRP A . n A 1 44 PHE 44 44 44 PHE PHE A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 LYS 47 47 47 LYS LYS A . n A 1 48 GLU 48 48 48 GLU GLU A . n A 1 49 GLN 49 49 49 GLN GLN A . n A 1 50 GLN 50 50 50 GLN GLN A . n A 1 51 ILE 51 51 51 ILE ILE A . n B 1 1 THR 1 1 ? ? ? B . n B 1 2 GLU 2 2 2 GLU GLU B . n B 1 3 PHE 3 3 3 PHE PHE B . n B 1 4 SER 4 4 4 SER SER B . n B 1 5 GLU 5 5 5 GLU GLU B . n B 1 6 GLU 6 6 6 GLU GLU B . n B 1 7 GLN 7 7 7 GLN GLN B . n B 1 8 LYS 8 8 8 LYS LYS B . n B 1 9 ARG 9 9 9 ARG ARG B . n B 1 10 THR 10 10 10 THR THR B . n B 1 11 LEU 11 11 11 LEU LEU B . n B 1 12 ASP 12 12 12 ASP ASP B . n B 1 13 LEU 13 13 13 LEU LEU B . n B 1 14 LEU 14 14 14 LEU LEU B . n B 1 15 PHE 15 15 15 PHE PHE B . n B 1 16 LEU 16 16 16 LEU LEU B . n B 1 17 PHE 17 17 17 PHE PHE B . n B 1 18 ASP 18 18 18 ASP ASP B . n B 1 19 ARG 19 19 19 ARG ARG B . n B 1 20 ARG 20 20 20 ARG ARG B . n B 1 21 MSE 21 21 21 MSE MSE B . n B 1 22 THR 22 22 22 THR THR B . n B 1 23 GLU 23 23 23 GLU GLU B . n B 1 24 GLU 24 24 24 GLU GLU B . n B 1 25 ARG 25 25 25 ARG ARG B . n B 1 26 ARG 26 26 26 ARG ARG B . n B 1 27 ARG 27 27 27 ARG ARG B . n B 1 28 TRP 28 28 28 TRP TRP B . n B 1 29 LEU 29 29 29 LEU LEU B . n B 1 30 SER 30 30 30 SER SER B . n B 1 31 GLN 31 31 31 GLN GLN B . n B 1 32 ARG 32 32 32 ARG ARG B . n B 1 33 LEU 33 33 33 LEU LEU B . n B 1 34 GLY 34 34 34 GLY GLY B . n B 1 35 LEU 35 35 35 LEU LEU B . n B 1 36 ASN 36 36 36 ASN ASN B . n B 1 37 GLU 37 37 37 GLU GLU B . n B 1 38 GLU 38 38 38 GLU GLU B . n B 1 39 GLN 39 39 39 GLN GLN B . n B 1 40 ILE 40 40 40 ILE ILE B . n B 1 41 GLU 41 41 41 GLU GLU B . n B 1 42 ARG 42 42 42 ARG ARG B . n B 1 43 TRP 43 43 43 TRP TRP B . n B 1 44 PHE 44 44 44 PHE PHE B . n B 1 45 ARG 45 45 45 ARG ARG B . n B 1 46 ARG 46 46 46 ARG ARG B . n B 1 47 LYS 47 47 47 LYS LYS B . n B 1 48 GLU 48 48 48 GLU GLU B . n B 1 49 GLN 49 49 49 GLN GLN B . n B 1 50 GLN 50 50 50 GLN GLN B . n B 1 51 ILE 51 51 ? ? ? B . n C 1 1 THR 1 1 ? ? ? C . n C 1 2 GLU 2 2 ? ? ? C . n C 1 3 PHE 3 3 3 PHE PHE C . n C 1 4 SER 4 4 4 SER SER C . n C 1 5 GLU 5 5 5 GLU GLU C . n C 1 6 GLU 6 6 6 GLU GLU C . n C 1 7 GLN 7 7 7 GLN GLN C . n C 1 8 LYS 8 8 8 LYS LYS C . n C 1 9 ARG 9 9 9 ARG ARG C . n C 1 10 THR 10 10 10 THR THR C . n C 1 11 LEU 11 11 11 LEU LEU C . n C 1 12 ASP 12 12 12 ASP ASP C . n C 1 13 LEU 13 13 13 LEU LEU C . n C 1 14 LEU 14 14 14 LEU LEU C . n C 1 15 PHE 15 15 15 PHE PHE C . n C 1 16 LEU 16 16 16 LEU LEU C . n C 1 17 PHE 17 17 17 PHE PHE C . n C 1 18 ASP 18 18 18 ASP ASP C . n C 1 19 ARG 19 19 19 ARG ARG C . n C 1 20 ARG 20 20 20 ARG ARG C . n C 1 21 MSE 21 21 21 MSE MSE C . n C 1 22 THR 22 22 22 THR THR C . n C 1 23 GLU 23 23 23 GLU GLU C . n C 1 24 GLU 24 24 24 GLU GLU C . n C 1 25 ARG 25 25 25 ARG ARG C . n C 1 26 ARG 26 26 26 ARG ARG C . n C 1 27 ARG 27 27 27 ARG ARG C . n C 1 28 TRP 28 28 28 TRP TRP C . n C 1 29 LEU 29 29 29 LEU LEU C . n C 1 30 SER 30 30 30 SER SER C . n C 1 31 GLN 31 31 31 GLN GLN C . n C 1 32 ARG 32 32 32 ARG ARG C . n C 1 33 LEU 33 33 33 LEU LEU C . n C 1 34 GLY 34 34 34 GLY GLY C . n C 1 35 LEU 35 35 35 LEU LEU C . n C 1 36 ASN 36 36 36 ASN ASN C . n C 1 37 GLU 37 37 37 GLU GLU C . n C 1 38 GLU 38 38 38 GLU GLU C . n C 1 39 GLN 39 39 39 GLN GLN C . n C 1 40 ILE 40 40 40 ILE ILE C . n C 1 41 GLU 41 41 41 GLU GLU C . n C 1 42 ARG 42 42 42 ARG ARG C . n C 1 43 TRP 43 43 43 TRP TRP C . n C 1 44 PHE 44 44 44 PHE PHE C . n C 1 45 ARG 45 45 45 ARG ARG C . n C 1 46 ARG 46 46 46 ARG ARG C . n C 1 47 LYS 47 47 47 LYS LYS C . n C 1 48 GLU 48 48 48 GLU GLU C . n C 1 49 GLN 49 49 ? ? ? C . n C 1 50 GLN 50 50 ? ? ? C . n C 1 51 ILE 51 51 ? ? ? C . n D 1 1 THR 1 1 ? ? ? D . n D 1 2 GLU 2 2 2 GLU GLU D . n D 1 3 PHE 3 3 3 PHE PHE D . n D 1 4 SER 4 4 4 SER SER D . n D 1 5 GLU 5 5 5 GLU GLU D . n D 1 6 GLU 6 6 6 GLU GLU D . n D 1 7 GLN 7 7 7 GLN GLN D . n D 1 8 LYS 8 8 8 LYS LYS D . n D 1 9 ARG 9 9 9 ARG ARG D . n D 1 10 THR 10 10 10 THR THR D . n D 1 11 LEU 11 11 11 LEU LEU D . n D 1 12 ASP 12 12 12 ASP ASP D . n D 1 13 LEU 13 13 13 LEU LEU D . n D 1 14 LEU 14 14 14 LEU LEU D . n D 1 15 PHE 15 15 15 PHE PHE D . n D 1 16 LEU 16 16 16 LEU LEU D . n D 1 17 PHE 17 17 17 PHE PHE D . n D 1 18 ASP 18 18 18 ASP ASP D . n D 1 19 ARG 19 19 19 ARG ARG D . n D 1 20 ARG 20 20 20 ARG ARG D . n D 1 21 MSE 21 21 21 MSE MSE D . n D 1 22 THR 22 22 22 THR THR D . n D 1 23 GLU 23 23 23 GLU GLU D . n D 1 24 GLU 24 24 24 GLU GLU D . n D 1 25 ARG 25 25 25 ARG ARG D . n D 1 26 ARG 26 26 26 ARG ARG D . n D 1 27 ARG 27 27 27 ARG ARG D . n D 1 28 TRP 28 28 28 TRP TRP D . n D 1 29 LEU 29 29 29 LEU LEU D . n D 1 30 SER 30 30 30 SER SER D . n D 1 31 GLN 31 31 31 GLN GLN D . n D 1 32 ARG 32 32 32 ARG ARG D . n D 1 33 LEU 33 33 33 LEU LEU D . n D 1 34 GLY 34 34 34 GLY GLY D . n D 1 35 LEU 35 35 35 LEU LEU D . n D 1 36 ASN 36 36 36 ASN ASN D . n D 1 37 GLU 37 37 37 GLU GLU D . n D 1 38 GLU 38 38 38 GLU GLU D . n D 1 39 GLN 39 39 39 GLN GLN D . n D 1 40 ILE 40 40 40 ILE ILE D . n D 1 41 GLU 41 41 41 GLU GLU D . n D 1 42 ARG 42 42 42 ARG ARG D . n D 1 43 TRP 43 43 43 TRP TRP D . n D 1 44 PHE 44 44 44 PHE PHE D . n D 1 45 ARG 45 45 45 ARG ARG D . n D 1 46 ARG 46 46 46 ARG ARG D . n D 1 47 LYS 47 47 47 LYS LYS D . n D 1 48 GLU 48 48 ? ? ? D . n D 1 49 GLN 49 49 ? ? ? D . n D 1 50 GLN 50 50 ? ? ? D . n D 1 51 ILE 51 51 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 K 1 101 2 K K A . F 2 K 1 101 1 K K C . G 2 K 1 102 4 K K C . H 2 K 1 101 3 K K D . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 8160 ? 1 MORE -55 ? 1 'SSA (A^2)' 12110 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_struct_conn_angle.id 1 _pdbx_struct_conn_angle.ptnr1_label_atom_id OE1 _pdbx_struct_conn_angle.ptnr1_label_alt_id ? _pdbx_struct_conn_angle.ptnr1_label_asym_id C _pdbx_struct_conn_angle.ptnr1_label_comp_id GLN _pdbx_struct_conn_angle.ptnr1_label_seq_id 31 _pdbx_struct_conn_angle.ptnr1_auth_atom_id ? _pdbx_struct_conn_angle.ptnr1_auth_asym_id C _pdbx_struct_conn_angle.ptnr1_auth_comp_id GLN _pdbx_struct_conn_angle.ptnr1_auth_seq_id 31 _pdbx_struct_conn_angle.ptnr1_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr1_symmetry 1_555 _pdbx_struct_conn_angle.ptnr2_label_atom_id K _pdbx_struct_conn_angle.ptnr2_label_alt_id ? _pdbx_struct_conn_angle.ptnr2_label_asym_id F _pdbx_struct_conn_angle.ptnr2_label_comp_id K _pdbx_struct_conn_angle.ptnr2_label_seq_id . _pdbx_struct_conn_angle.ptnr2_auth_atom_id ? _pdbx_struct_conn_angle.ptnr2_auth_asym_id C _pdbx_struct_conn_angle.ptnr2_auth_comp_id K _pdbx_struct_conn_angle.ptnr2_auth_seq_id 101 _pdbx_struct_conn_angle.ptnr2_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr2_symmetry 1_555 _pdbx_struct_conn_angle.ptnr3_label_atom_id O _pdbx_struct_conn_angle.ptnr3_label_alt_id ? _pdbx_struct_conn_angle.ptnr3_label_asym_id D _pdbx_struct_conn_angle.ptnr3_label_comp_id ARG _pdbx_struct_conn_angle.ptnr3_label_seq_id 27 _pdbx_struct_conn_angle.ptnr3_auth_atom_id ? _pdbx_struct_conn_angle.ptnr3_auth_asym_id D _pdbx_struct_conn_angle.ptnr3_auth_comp_id ARG _pdbx_struct_conn_angle.ptnr3_auth_seq_id 27 _pdbx_struct_conn_angle.ptnr3_PDB_ins_code ? _pdbx_struct_conn_angle.ptnr3_symmetry 1_555 _pdbx_struct_conn_angle.value 68.1 _pdbx_struct_conn_angle.value_esd ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-05-27 2 'Structure model' 1 1 2015-07-08 3 'Structure model' 1 2 2015-08-19 4 'Structure model' 1 3 2017-09-06 5 'Structure model' 1 4 2019-11-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Author supporting evidence' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' diffrn_detector 3 4 'Structure model' pdbx_audit_support 4 4 'Structure model' pdbx_struct_oper_list 5 5 'Structure model' pdbx_audit_support # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_diffrn_detector.type' 3 4 'Structure model' '_pdbx_audit_support.funding_organization' 4 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? DENZO ? ? ? 1.97.7 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? 1.97.7 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SOLVE ? ? ? . 4 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE2 _pdbx_validate_close_contact.auth_asym_id_1 C _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 6 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 NH2 _pdbx_validate_close_contact.auth_asym_id_2 C _pdbx_validate_close_contact.auth_comp_id_2 ARG _pdbx_validate_close_contact.auth_seq_id_2 9 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.18 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 32 ? ? -140.36 -24.63 2 1 GLN A 49 ? ? -86.24 36.18 3 1 GLN A 50 ? ? 70.80 127.58 4 1 PHE B 3 ? ? -105.92 -132.84 5 1 ARG B 45 ? ? 59.29 2.48 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 1 ? OG1 ? A THR 1 OG1 2 1 Y 1 A THR 1 ? CG2 ? A THR 1 CG2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B THR 1 ? B THR 1 2 1 Y 1 B ILE 51 ? B ILE 51 3 1 Y 1 C THR 1 ? C THR 1 4 1 Y 1 C GLU 2 ? C GLU 2 5 1 Y 1 C GLN 49 ? C GLN 49 6 1 Y 1 C GLN 50 ? C GLN 50 7 1 Y 1 C ILE 51 ? C ILE 51 8 1 Y 1 D THR 1 ? D THR 1 9 1 Y 1 D GLU 48 ? D GLU 48 10 1 Y 1 D GLN 49 ? D GLN 49 11 1 Y 1 D GLN 50 ? D GLN 50 12 1 Y 1 D ILE 51 ? D ILE 51 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'POTASSIUM ION' _pdbx_entity_nonpoly.comp_id K #