data_4ZNY # _entry.id 4ZNY # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4ZNY WWPDB D_1000209345 # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Crystallographic structure of human Tsg101 UEV domain' 2F0R unspecified PDB 'Structure Of The Tsg101 UEV Domain In Complex With an Ebola PTAP late Domain Peptide' 4EJE unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4ZNY _pdbx_database_status.recvd_initial_deposition_date 2015-05-05 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Camara-Artigas, A.' 1 'Bacarizo, J.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'to be published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title ;Structure of the human TSG101-UEV Domain in complex with the PTAP motif of the p19 gag protein of the Human T-cell Leukemia type I virus ; _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Camara-Artigas, A.' 1 primary 'Bacarizo, J.' 2 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 4ZNY _cell.details ? _cell.formula_units_Z ? _cell.length_a 78.622 _cell.length_a_esd ? _cell.length_b 119.743 _cell.length_b_esd ? _cell.length_c 41.641 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4ZNY _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Tumor susceptibility gene 101 protein' 16331.946 1 ? ? 'UEV domain' ? 2 polymer syn 'T-cell leukemia virus type I, partial gag gene; HTLV1 (human T-lymphotropic virus type I)' 1116.262 1 ? ? 'L-domain, UNP residues 105-114' ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 5 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'ESCRT-I complex subunit TSG101' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;SESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYN PPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP ; ;SESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYN PPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP ; A ? 2 'polypeptide(L)' no no YVEPTAPQVL YVEPTAPQVL B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 GLU n 1 3 SER n 1 4 GLN n 1 5 LEU n 1 6 LYS n 1 7 LYS n 1 8 MET n 1 9 VAL n 1 10 SER n 1 11 LYS n 1 12 TYR n 1 13 LYS n 1 14 TYR n 1 15 ARG n 1 16 ASP n 1 17 LEU n 1 18 THR n 1 19 VAL n 1 20 ARG n 1 21 GLU n 1 22 THR n 1 23 VAL n 1 24 ASN n 1 25 VAL n 1 26 ILE n 1 27 THR n 1 28 LEU n 1 29 TYR n 1 30 LYS n 1 31 ASP n 1 32 LEU n 1 33 LYS n 1 34 PRO n 1 35 VAL n 1 36 LEU n 1 37 ASP n 1 38 SER n 1 39 TYR n 1 40 VAL n 1 41 PHE n 1 42 ASN n 1 43 ASP n 1 44 GLY n 1 45 SER n 1 46 SER n 1 47 ARG n 1 48 GLU n 1 49 LEU n 1 50 MET n 1 51 ASN n 1 52 LEU n 1 53 THR n 1 54 GLY n 1 55 THR n 1 56 ILE n 1 57 PRO n 1 58 VAL n 1 59 PRO n 1 60 TYR n 1 61 ARG n 1 62 GLY n 1 63 ASN n 1 64 THR n 1 65 TYR n 1 66 ASN n 1 67 ILE n 1 68 PRO n 1 69 ILE n 1 70 CYS n 1 71 LEU n 1 72 TRP n 1 73 LEU n 1 74 LEU n 1 75 ASP n 1 76 THR n 1 77 TYR n 1 78 PRO n 1 79 TYR n 1 80 ASN n 1 81 PRO n 1 82 PRO n 1 83 ILE n 1 84 CYS n 1 85 PHE n 1 86 VAL n 1 87 LYS n 1 88 PRO n 1 89 THR n 1 90 SER n 1 91 SER n 1 92 MET n 1 93 THR n 1 94 ILE n 1 95 LYS n 1 96 THR n 1 97 GLY n 1 98 LYS n 1 99 HIS n 1 100 VAL n 1 101 ASP n 1 102 ALA n 1 103 ASN n 1 104 GLY n 1 105 LYS n 1 106 ILE n 1 107 TYR n 1 108 LEU n 1 109 PRO n 1 110 TYR n 1 111 LEU n 1 112 HIS n 1 113 GLU n 1 114 TRP n 1 115 LYS n 1 116 HIS n 1 117 PRO n 1 118 GLN n 1 119 SER n 1 120 ASP n 1 121 LEU n 1 122 LEU n 1 123 GLY n 1 124 LEU n 1 125 ILE n 1 126 GLN n 1 127 VAL n 1 128 MET n 1 129 ILE n 1 130 VAL n 1 131 VAL n 1 132 PHE n 1 133 GLY n 1 134 ASP n 1 135 GLU n 1 136 PRO n 1 137 PRO n 1 138 VAL n 1 139 PHE n 1 140 SER n 1 141 ARG n 1 142 PRO n 2 1 TYR n 2 2 VAL n 2 3 GLU n 2 4 PRO n 2 5 THR n 2 6 ALA n 2 7 PRO n 2 8 GLN n 2 9 VAL n 2 10 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 142 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TSG101 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pRSETa _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 10 _pdbx_entity_src_syn.organism_scientific 'Human T-lymphotropic virus 1' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 11908 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP TS101_HUMAN Q99816 ? 1 ;SESQLKKMVSKYKYRDLTVRETVNVITLYKDLKPVLDSYVFNDGSSRELMNLTGTIPVPYRGNTYNIPICLWLLDTYPYN PPICFVKPTSSMTIKTGKHVDANGKIYLPYLHEWKHPQSDLLGLIQVMIVVFGDEPPVFSRP ; 4 2 UNP Q85594_9DELA Q85594 ? 2 YVEPTAPQVL 105 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4ZNY A 1 ? 142 ? Q99816 4 ? 145 ? 4 145 2 2 4ZNY B 1 ? 10 ? Q85594 105 ? 114 ? 105 114 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4ZNY _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.81 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 56.20 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG4k, 0.1 ammonium sulfate, 0.1 MES' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-06-28 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111) channel-cut crystal monochromator and a pair of KB mirrors' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9700 1.0 2 0.97779 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ESRF BEAMLINE ID23-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97779 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline ID23-1 _diffrn_source.pdbx_synchrotron_site ESRF # _reflns.B_iso_Wilson_estimate 54.960 _reflns.entry_id 4ZNY _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.400 _reflns.d_resolution_low 19.960 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8020 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.700 _reflns.pdbx_Rmerge_I_obs 0.032 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 34.600 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.017 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 37420 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.400 2.490 ? 9.700 4376 ? ? 830 ? 100.000 ? ? ? ? 0.279 ? ? ? ? ? ? ? ? 5.300 ? ? ? ? ? 0.134 0 1 1 0.977 ? 8.980 19.960 ? 62.600 635 ? ? 166 ? 91.200 ? ? ? ? 0.020 ? ? ? ? ? ? ? ? 3.800 ? ? ? ? ? 0.012 0 2 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 155.030 _refine.B_iso_mean 76.9750 _refine.B_iso_min 49.180 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'The statistics of the data collection are those of the non-anomalous data, while the structure was refined with the anomalous data.' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4ZNY _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4000 _refine.ls_d_res_low 19.9570 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14340 _refine.ls_number_reflns_R_free 750 _refine.ls_number_reflns_R_work 13590 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.5900 _refine.ls_percent_reflns_R_free 5.2300 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2306 _refine.ls_R_factor_R_free 0.2431 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2299 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4EJE _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.6200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.4000 _refine_hist.d_res_low 19.9570 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 1168 _refine_hist.pdbx_number_residues_total 152 _refine_hist.pdbx_B_iso_mean_ligand 67.00 _refine_hist.pdbx_B_iso_mean_solvent 57.56 _refine_hist.pdbx_number_atoms_protein 1158 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 1197 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.842 ? 1651 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.030 ? 196 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 206 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 9.253 ? 415 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4000 2.5850 2721 . 153 2568 91.0000 . . . 0.3851 . 0.3742 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.5850 2.8444 2809 . 146 2663 95.0000 . . . 0.4374 . 0.3700 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.8444 3.2545 2897 . 147 2750 98.0000 . . . 0.3582 . 0.3042 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.2545 4.0945 2939 . 143 2796 99.0000 . . . 0.2958 . 0.2266 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.0945 19.9578 2974 . 161 2813 100.0000 . . . 0.1488 . 0.1709 . . . . . . 5 . . . # _struct.entry_id 4ZNY _struct.title ;Structure of the human TSG101-UEV Domain in complex with the PTAP motif of the p19 gag protein of the Human T-cell Leukemia type I virus ; _struct.pdbx_descriptor 'TSG101-UEV Domain, PTAP motif of the p19 gag protein of the Human T-cell Leukemia type I virus; residues 121-130' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4ZNY _struct_keywords.text 'ESCRT-I COMPLEX SUBUNIT TSG101, protein transport' _struct_keywords.pdbx_keywords 'PROTEIN TRANSPORT' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 1 ? VAL A 9 ? SER A 4 VAL A 12 1 ? 9 HELX_P HELX_P2 AA2 TYR A 14 ? TYR A 29 ? TYR A 17 TYR A 32 1 ? 16 HELX_P HELX_P3 AA3 LEU A 108 ? GLU A 113 ? LEU A 111 GLU A 116 1 ? 6 HELX_P HELX_P4 AA4 ASP A 120 ? GLU A 135 ? ASP A 123 GLU A 138 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 TYR 77 A . ? TYR 80 A PRO 78 A ? PRO 81 A 1 4.67 2 HIS 116 A . ? HIS 119 A PRO 117 A ? PRO 120 A 1 2.90 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA2 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 32 ? VAL A 40 ? LEU A 35 VAL A 43 AA1 2 SER A 46 ? TYR A 60 ? SER A 49 TYR A 63 AA1 3 ASN A 63 ? LEU A 73 ? ASN A 66 LEU A 76 AA1 4 ILE A 83 ? VAL A 86 ? ILE A 86 VAL A 89 AA2 1 MET A 92 ? ILE A 94 ? MET A 95 ILE A 97 AA2 2 VAL A 138 ? SER A 140 ? VAL A 141 SER A 143 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 35 ? N VAL A 38 O ASN A 51 ? O ASN A 54 AA1 2 3 N TYR A 60 ? N TYR A 63 O ASN A 63 ? O ASN A 66 AA1 3 4 N CYS A 70 ? N CYS A 73 O PHE A 85 ? O PHE A 88 AA2 1 2 N THR A 93 ? N THR A 96 O PHE A 139 ? O PHE A 142 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 201 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue SO4 A 201' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 LYS A 13 ? LYS A 16 . ? 1_555 ? 2 AC1 4 ARG A 15 ? ARG A 18 . ? 1_555 ? 3 AC1 4 ARG A 15 ? ARG A 18 . ? 4_554 ? 4 AC1 4 ASP A 16 ? ASP A 19 . ? 1_555 ? # _atom_sites.entry_id 4ZNY _atom_sites.fract_transf_matrix[1][1] 0.012719 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008351 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.024015 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C H N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 4 4 SER SER A . n A 1 2 GLU 2 5 5 GLU GLU A . n A 1 3 SER 3 6 6 SER SER A . n A 1 4 GLN 4 7 7 GLN GLN A . n A 1 5 LEU 5 8 8 LEU LEU A . n A 1 6 LYS 6 9 9 LYS LYS A . n A 1 7 LYS 7 10 10 LYS LYS A . n A 1 8 MET 8 11 11 MET MET A . n A 1 9 VAL 9 12 12 VAL VAL A . n A 1 10 SER 10 13 13 SER SER A . n A 1 11 LYS 11 14 14 LYS LYS A . n A 1 12 TYR 12 15 15 TYR TYR A . n A 1 13 LYS 13 16 16 LYS LYS A . n A 1 14 TYR 14 17 17 TYR TYR A . n A 1 15 ARG 15 18 18 ARG ARG A . n A 1 16 ASP 16 19 19 ASP ASP A . n A 1 17 LEU 17 20 20 LEU LEU A . n A 1 18 THR 18 21 21 THR THR A . n A 1 19 VAL 19 22 22 VAL VAL A . n A 1 20 ARG 20 23 23 ARG ARG A . n A 1 21 GLU 21 24 24 GLU GLU A . n A 1 22 THR 22 25 25 THR THR A . n A 1 23 VAL 23 26 26 VAL VAL A . n A 1 24 ASN 24 27 27 ASN ASN A . n A 1 25 VAL 25 28 28 VAL VAL A . n A 1 26 ILE 26 29 29 ILE ILE A . n A 1 27 THR 27 30 30 THR THR A . n A 1 28 LEU 28 31 31 LEU LEU A . n A 1 29 TYR 29 32 32 TYR TYR A . n A 1 30 LYS 30 33 33 LYS LYS A . n A 1 31 ASP 31 34 34 ASP ASP A . n A 1 32 LEU 32 35 35 LEU LEU A . n A 1 33 LYS 33 36 36 LYS LYS A . n A 1 34 PRO 34 37 37 PRO PRO A . n A 1 35 VAL 35 38 38 VAL VAL A . n A 1 36 LEU 36 39 39 LEU LEU A . n A 1 37 ASP 37 40 40 ASP ASP A . n A 1 38 SER 38 41 41 SER SER A . n A 1 39 TYR 39 42 42 TYR TYR A . n A 1 40 VAL 40 43 43 VAL VAL A . n A 1 41 PHE 41 44 44 PHE PHE A . n A 1 42 ASN 42 45 45 ASN ASN A . n A 1 43 ASP 43 46 46 ASP ASP A . n A 1 44 GLY 44 47 47 GLY GLY A . n A 1 45 SER 45 48 48 SER SER A . n A 1 46 SER 46 49 49 SER SER A . n A 1 47 ARG 47 50 50 ARG ARG A . n A 1 48 GLU 48 51 51 GLU GLU A . n A 1 49 LEU 49 52 52 LEU LEU A . n A 1 50 MET 50 53 53 MET MET A . n A 1 51 ASN 51 54 54 ASN ASN A . n A 1 52 LEU 52 55 55 LEU LEU A . n A 1 53 THR 53 56 56 THR THR A . n A 1 54 GLY 54 57 57 GLY GLY A . n A 1 55 THR 55 58 58 THR THR A . n A 1 56 ILE 56 59 59 ILE ILE A . n A 1 57 PRO 57 60 60 PRO PRO A . n A 1 58 VAL 58 61 61 VAL VAL A . n A 1 59 PRO 59 62 62 PRO PRO A . n A 1 60 TYR 60 63 63 TYR TYR A . n A 1 61 ARG 61 64 64 ARG ARG A . n A 1 62 GLY 62 65 65 GLY GLY A . n A 1 63 ASN 63 66 66 ASN ASN A . n A 1 64 THR 64 67 67 THR THR A . n A 1 65 TYR 65 68 68 TYR TYR A . n A 1 66 ASN 66 69 69 ASN ASN A . n A 1 67 ILE 67 70 70 ILE ILE A . n A 1 68 PRO 68 71 71 PRO PRO A . n A 1 69 ILE 69 72 72 ILE ILE A . n A 1 70 CYS 70 73 73 CYS CYS A . n A 1 71 LEU 71 74 74 LEU LEU A . n A 1 72 TRP 72 75 75 TRP TRP A . n A 1 73 LEU 73 76 76 LEU LEU A . n A 1 74 LEU 74 77 77 LEU LEU A . n A 1 75 ASP 75 78 78 ASP ASP A . n A 1 76 THR 76 79 79 THR THR A . n A 1 77 TYR 77 80 80 TYR TYR A . n A 1 78 PRO 78 81 81 PRO PRO A . n A 1 79 TYR 79 82 82 TYR TYR A . n A 1 80 ASN 80 83 83 ASN ASN A . n A 1 81 PRO 81 84 84 PRO PRO A . n A 1 82 PRO 82 85 85 PRO PRO A . n A 1 83 ILE 83 86 86 ILE ILE A . n A 1 84 CYS 84 87 87 CYS CYS A . n A 1 85 PHE 85 88 88 PHE PHE A . n A 1 86 VAL 86 89 89 VAL VAL A . n A 1 87 LYS 87 90 90 LYS LYS A . n A 1 88 PRO 88 91 91 PRO PRO A . n A 1 89 THR 89 92 92 THR THR A . n A 1 90 SER 90 93 93 SER SER A . n A 1 91 SER 91 94 94 SER SER A . n A 1 92 MET 92 95 95 MET MET A . n A 1 93 THR 93 96 96 THR THR A . n A 1 94 ILE 94 97 97 ILE ILE A . n A 1 95 LYS 95 98 98 LYS LYS A . n A 1 96 THR 96 99 99 THR THR A . n A 1 97 GLY 97 100 100 GLY GLY A . n A 1 98 LYS 98 101 101 LYS LYS A . n A 1 99 HIS 99 102 102 HIS HIS A . n A 1 100 VAL 100 103 103 VAL VAL A . n A 1 101 ASP 101 104 104 ASP ASP A . n A 1 102 ALA 102 105 105 ALA ALA A . n A 1 103 ASN 103 106 106 ASN ASN A . n A 1 104 GLY 104 107 107 GLY GLY A . n A 1 105 LYS 105 108 108 LYS LYS A . n A 1 106 ILE 106 109 109 ILE ILE A . n A 1 107 TYR 107 110 110 TYR TYR A . n A 1 108 LEU 108 111 111 LEU LEU A . n A 1 109 PRO 109 112 112 PRO PRO A . n A 1 110 TYR 110 113 113 TYR TYR A . n A 1 111 LEU 111 114 114 LEU LEU A . n A 1 112 HIS 112 115 115 HIS HIS A . n A 1 113 GLU 113 116 116 GLU GLU A . n A 1 114 TRP 114 117 117 TRP TRP A . n A 1 115 LYS 115 118 118 LYS LYS A . n A 1 116 HIS 116 119 119 HIS HIS A . n A 1 117 PRO 117 120 120 PRO PRO A . n A 1 118 GLN 118 121 121 GLN GLN A . n A 1 119 SER 119 122 122 SER SER A . n A 1 120 ASP 120 123 123 ASP ASP A . n A 1 121 LEU 121 124 124 LEU LEU A . n A 1 122 LEU 122 125 125 LEU LEU A . n A 1 123 GLY 123 126 126 GLY GLY A . n A 1 124 LEU 124 127 127 LEU LEU A . n A 1 125 ILE 125 128 128 ILE ILE A . n A 1 126 GLN 126 129 129 GLN GLN A . n A 1 127 VAL 127 130 130 VAL VAL A . n A 1 128 MET 128 131 131 MET MET A . n A 1 129 ILE 129 132 132 ILE ILE A . n A 1 130 VAL 130 133 133 VAL VAL A . n A 1 131 VAL 131 134 134 VAL VAL A . n A 1 132 PHE 132 135 135 PHE PHE A . n A 1 133 GLY 133 136 136 GLY GLY A . n A 1 134 ASP 134 137 137 ASP ASP A . n A 1 135 GLU 135 138 138 GLU GLU A . n A 1 136 PRO 136 139 139 PRO PRO A . n A 1 137 PRO 137 140 140 PRO PRO A . n A 1 138 VAL 138 141 141 VAL VAL A . n A 1 139 PHE 139 142 142 PHE PHE A . n A 1 140 SER 140 143 143 SER SER A . n A 1 141 ARG 141 144 144 ARG ARG A . n A 1 142 PRO 142 145 145 PRO PRO A . n B 2 1 TYR 1 105 121 TYR TYR B . n B 2 2 VAL 2 106 122 VAL VAL B . n B 2 3 GLU 3 107 123 GLU GLU B . n B 2 4 PRO 4 108 124 PRO PRO B . n B 2 5 THR 5 109 125 THR THR B . n B 2 6 ALA 6 110 126 ALA ALA B . n B 2 7 PRO 7 111 127 PRO PRO B . n B 2 8 GLN 8 112 128 GLN GLN B . n B 2 9 VAL 9 113 129 VAL VAL B . n B 2 10 LEU 10 114 130 LEU LEU B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 SO4 1 201 1 SO4 SO4 A . D 4 HOH 1 301 5 HOH HOH A . D 4 HOH 2 302 8 HOH HOH A . D 4 HOH 3 303 9 HOH HOH A . D 4 HOH 4 304 7 HOH HOH A . D 4 HOH 5 305 6 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1230 ? 1 MORE -20 ? 1 'SSA (A^2)' 8060 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2016-06-29 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 2.400 _diffrn_reflns.pdbx_d_res_low 19.960 _diffrn_reflns.pdbx_number_obs 8020 _diffrn_reflns.pdbx_Rmerge_I_obs 0.032 _diffrn_reflns.pdbx_Rsym_value ? _diffrn_reflns.pdbx_chi_squared ? _diffrn_reflns.pdbx_redundancy 4.70 _diffrn_reflns.pdbx_rejects ? _diffrn_reflns.pdbx_percent_possible_obs 99.80 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.number 37420 _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 2.40 2.49 ? ? 0.279 ? ? 5.30 ? 1 8.98 19.96 ? ? 0.020 ? ? 3.80 ? # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 18.3161 5.2283 -15.9105 1.2483 ? 0.0260 ? -0.1718 ? 1.1402 ? -0.1450 ? 0.9508 ? 0.1335 ? 0.0100 ? 0.0347 ? 0.0074 ? -0.0156 ? 0.0193 ? 1.1664 ? 1.0734 ? -1.0640 ? -1.1188 ? 0.0061 ? 0.1250 ? -0.1468 ? -0.4125 ? -0.0039 ? 2 'X-RAY DIFFRACTION' ? refined 29.6067 7.6970 -17.0403 1.4011 ? 0.1839 ? 0.2747 ? 0.8855 ? -0.0365 ? 0.7782 ? 0.0084 ? 0.0137 ? 0.0216 ? 0.0238 ? 0.0381 ? 0.0460 ? -0.3632 ? 0.6090 ? -0.1591 ? -0.7045 ? 0.4087 ? -0.5023 ? 1.1062 ? -0.3024 ? 0.0012 ? 3 'X-RAY DIFFRACTION' ? refined 23.5338 3.0368 -7.7410 0.9275 ? 0.0132 ? 0.1934 ? 0.7208 ? 0.0122 ? 0.9869 ? 1.2393 ? 0.2702 ? 0.0390 ? 0.0436 ? 0.0343 ? 0.5385 ? -0.1327 ? -0.2985 ? -1.5232 ? -0.4621 ? -0.9583 ? -0.7082 ? 0.8944 ? -0.1463 ? -0.0016 ? 4 'X-RAY DIFFRACTION' ? refined 20.5575 15.3984 -8.3409 0.9706 ? 0.1382 ? -0.0118 ? 0.9049 ? -0.0689 ? 0.6736 ? 0.2581 ? -0.3907 ? 0.2773 ? 0.5111 ? -0.4054 ? 0.2452 ? -0.1142 ? -0.0214 ? -0.1292 ? -1.2693 ? -0.5706 ? -0.0791 ? 0.1874 ? -0.4233 ? -0.0020 ? 5 'X-RAY DIFFRACTION' ? refined 34.7429 24.9438 -15.8106 0.9762 ? 0.2066 ? 0.4611 ? 0.9778 ? 0.2124 ? 1.2171 ? 0.4461 ? 0.1535 ? -0.1765 ? 0.1780 ? -0.0443 ? 0.0723 ? 0.6968 ? -1.2219 ? -0.0343 ? -0.0877 ? 0.3807 ? -0.3055 ? -0.1939 ? 1.5229 ? 0.0074 ? 6 'X-RAY DIFFRACTION' ? refined 20.0391 17.1463 1.1540 0.6596 ? 0.1473 ? 0.0362 ? 0.7095 ? 0.0365 ? 0.6190 ? 2.6617 ? 1.7029 ? -0.2529 ? 3.1610 ? 0.1573 ? 0.0974 ? -0.0177 ? -0.0751 ? -0.2331 ? -0.5132 ? -0.2167 ? -0.0346 ? 0.0603 ? -0.4953 ? -0.0008 ? 7 'X-RAY DIFFRACTION' ? refined 30.3267 17.2594 -0.9291 0.6684 ? 0.1785 ? 0.0699 ? 0.6556 ? 0.0906 ? 0.6798 ? 2.8934 ? 0.7246 ? -1.6568 ? 1.6888 ? -0.2383 ? 3.3712 ? -0.3237 ? -0.4570 ? 0.0163 ? -0.3824 ? -0.0110 ? -0.4047 ? 0.5090 ? 0.3517 ? 0.0001 ? 8 'X-RAY DIFFRACTION' ? refined 23.2785 18.0696 7.8206 0.5884 ? 0.2219 ? 0.0275 ? 0.8614 ? 0.1037 ? 0.6874 ? 1.1411 ? 0.4714 ? -0.8809 ? 0.4586 ? -0.4509 ? 1.3057 ? -0.3126 ? -0.6670 ? 0.0781 ? 0.4370 ? 0.1662 ? -0.3018 ? 0.5038 ? 0.3770 ? -0.0001 ? 9 'X-RAY DIFFRACTION' ? refined 12.4298 23.2107 7.7855 0.5951 ? 0.1141 ? -0.0197 ? 0.8524 ? -0.0133 ? 0.6930 ? 0.0559 ? 0.3010 ? -0.2165 ? 0.4508 ? -0.5329 ? 0.5929 ? -0.1714 ? -0.5344 ? -0.1234 ? -0.5720 ? -0.4501 ? 0.5090 ? -0.3406 ? -0.3261 ? -0.0073 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 4 through 11 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 12 through 17 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 18 through 31 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 32 through 43 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 44 through 48 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 49 through 75 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 76 through 123 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? A 0 ? ? A 0 ? ;chain 'A' and (resid 124 through 145 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? B 0 ? ? B 0 ? ;chain 'B' and (resid 121 through 130 ) ; # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.5.8 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 2 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 3 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 4 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 VAL A 12 ? ? -96.64 39.66 2 1 LYS A 14 ? ? -94.55 40.55 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 5 ? CG ? A GLU 2 CG 2 1 Y 1 A GLU 5 ? CD ? A GLU 2 CD 3 1 Y 1 A GLU 5 ? OE1 ? A GLU 2 OE1 4 1 Y 1 A GLU 5 ? OE2 ? A GLU 2 OE2 5 1 Y 1 A GLN 7 ? CG ? A GLN 4 CG 6 1 Y 1 A GLN 7 ? CD ? A GLN 4 CD 7 1 Y 1 A GLN 7 ? OE1 ? A GLN 4 OE1 8 1 Y 1 A GLN 7 ? NE2 ? A GLN 4 NE2 9 1 Y 1 A LYS 9 ? CG ? A LYS 6 CG 10 1 Y 1 A LYS 9 ? CD ? A LYS 6 CD 11 1 Y 1 A LYS 9 ? CE ? A LYS 6 CE 12 1 Y 1 A LYS 9 ? NZ ? A LYS 6 NZ 13 1 Y 1 A LYS 10 ? CG ? A LYS 7 CG 14 1 Y 1 A LYS 10 ? CD ? A LYS 7 CD 15 1 Y 1 A LYS 10 ? CE ? A LYS 7 CE 16 1 Y 1 A LYS 10 ? NZ ? A LYS 7 NZ 17 1 Y 1 A LYS 14 ? CG ? A LYS 11 CG 18 1 Y 1 A LYS 14 ? CD ? A LYS 11 CD 19 1 Y 1 A LYS 14 ? CE ? A LYS 11 CE 20 1 Y 1 A LYS 14 ? NZ ? A LYS 11 NZ 21 1 Y 1 A LYS 16 ? CG ? A LYS 13 CG 22 1 Y 1 A LYS 16 ? CD ? A LYS 13 CD 23 1 Y 1 A LYS 16 ? CE ? A LYS 13 CE 24 1 Y 1 A LYS 16 ? NZ ? A LYS 13 NZ 25 1 Y 1 A ASP 19 ? CG ? A ASP 16 CG 26 1 Y 1 A ASP 19 ? OD1 ? A ASP 16 OD1 27 1 Y 1 A ASP 19 ? OD2 ? A ASP 16 OD2 28 1 Y 1 A LYS 33 ? CG ? A LYS 30 CG 29 1 Y 1 A LYS 33 ? CD ? A LYS 30 CD 30 1 Y 1 A LYS 33 ? CE ? A LYS 30 CE 31 1 Y 1 A LYS 33 ? NZ ? A LYS 30 NZ 32 1 Y 1 A LYS 36 ? CG ? A LYS 33 CG 33 1 Y 1 A LYS 36 ? CD ? A LYS 33 CD 34 1 Y 1 A LYS 36 ? CE ? A LYS 33 CE 35 1 Y 1 A LYS 36 ? NZ ? A LYS 33 NZ 36 1 Y 1 A ASN 45 ? CG ? A ASN 42 CG 37 1 Y 1 A ASN 45 ? OD1 ? A ASN 42 OD1 38 1 Y 1 A ASN 45 ? ND2 ? A ASN 42 ND2 39 1 Y 1 A SER 48 ? OG ? A SER 45 OG 40 1 Y 1 A ARG 50 ? CG ? A ARG 47 CG 41 1 Y 1 A ARG 50 ? CD ? A ARG 47 CD 42 1 Y 1 A ARG 50 ? NE ? A ARG 47 NE 43 1 Y 1 A ARG 50 ? CZ ? A ARG 47 CZ 44 1 Y 1 A ARG 50 ? NH1 ? A ARG 47 NH1 45 1 Y 1 A ARG 50 ? NH2 ? A ARG 47 NH2 46 1 Y 1 A LYS 98 ? CG ? A LYS 95 CG 47 1 Y 1 A LYS 98 ? CD ? A LYS 95 CD 48 1 Y 1 A LYS 98 ? CE ? A LYS 95 CE 49 1 Y 1 A LYS 98 ? NZ ? A LYS 95 NZ 50 1 Y 1 A LYS 101 ? CG ? A LYS 98 CG 51 1 Y 1 A LYS 101 ? CD ? A LYS 98 CD 52 1 Y 1 A LYS 101 ? CE ? A LYS 98 CE 53 1 Y 1 A LYS 101 ? NZ ? A LYS 98 NZ 54 1 Y 1 A GLN 121 ? CG ? A GLN 118 CG 55 1 Y 1 A GLN 121 ? CD ? A GLN 118 CD 56 1 Y 1 A GLN 121 ? OE1 ? A GLN 118 OE1 57 1 Y 1 A GLN 121 ? NE2 ? A GLN 118 NE2 58 1 Y 1 A GLN 129 ? CG ? A GLN 126 CG 59 1 Y 1 A GLN 129 ? CD ? A GLN 126 CD 60 1 Y 1 A GLN 129 ? OE1 ? A GLN 126 OE1 61 1 Y 1 A GLN 129 ? NE2 ? A GLN 126 NE2 62 1 Y 1 A GLU 138 ? CG ? A GLU 135 CG 63 1 Y 1 A GLU 138 ? CD ? A GLU 135 CD 64 1 Y 1 A GLU 138 ? OE1 ? A GLU 135 OE1 65 1 Y 1 A GLU 138 ? OE2 ? A GLU 135 OE2 66 1 Y 1 B GLU 107 ? CG ? B GLU 3 CG 67 1 Y 1 B GLU 107 ? CD ? B GLU 3 CD 68 1 Y 1 B GLU 107 ? OE1 ? B GLU 3 OE1 69 1 Y 1 B GLU 107 ? OE2 ? B GLU 3 OE2 # _pdbx_audit_support.funding_organization MINECO _pdbx_audit_support.country Spain _pdbx_audit_support.grant_number BIO2012-39922-C02-02 _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'SULFATE ION' SO4 4 water HOH #