data_4ZNZ # _entry.id 4ZNZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.392 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4ZNZ pdb_00004znz 10.2210/pdb4znz/pdb WWPDB D_1000209597 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-05-20 2 'Structure model' 1 1 2016-06-01 3 'Structure model' 1 2 2017-11-22 4 'Structure model' 1 3 2019-12-04 5 'Structure model' 1 4 2022-04-13 6 'Structure model' 1 5 2024-05-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' 'Derived calculations' 4 3 'Structure model' 'Refinement description' 5 4 'Structure model' 'Author supporting evidence' 6 5 'Structure model' 'Database references' 7 5 'Structure model' 'Structure summary' 8 6 'Structure model' 'Data collection' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' pdbx_struct_oper_list 3 3 'Structure model' software 4 4 'Structure model' pdbx_audit_support 5 5 'Structure model' audit_author 6 5 'Structure model' citation_author 7 5 'Structure model' database_2 8 6 'Structure model' chem_comp_atom 9 6 'Structure model' chem_comp_bond # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 4 'Structure model' '_pdbx_audit_support.funding_organization' 4 4 'Structure model' '_pdbx_audit_support.grant_number' 5 5 'Structure model' '_audit_author.identifier_ORCID' 6 5 'Structure model' '_citation_author.identifier_ORCID' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4ZNZ _pdbx_database_status.recvd_initial_deposition_date 2015-05-05 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Gasiorowska, O.A.' 1 ? 'Niedzialkowska, E.' 2 ? 'Porebski, P.J.' 3 ? 'Handing, K.B.' 4 ? 'Shabalin, I.G.' 5 ? 'Cymborowski, M.T.' 6 ? 'Minor, W.' 7 0000-0001-7075-7090 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Protein Sci.' _citation.journal_id_ASTM PRCIEI _citation.journal_id_CSD 0795 _citation.journal_id_ISSN 1469-896X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 25 _citation.language ? _citation.page_first 720 _citation.page_last 733 _citation.title 'Protein purification and crystallization artifacts: The tale usually not told.' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1002/pro.2861 _citation.pdbx_database_id_PubMed 26660914 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Niedzialkowska, E.' 1 ? primary 'Gasiorowska, O.' 2 ? primary 'Handing, K.B.' 3 ? primary 'Majorek, K.A.' 4 ? primary 'Porebski, P.J.' 5 ? primary 'Shabalin, I.G.' 6 ? primary 'Zasadzinska, E.' 7 ? primary 'Cymborowski, M.' 8 ? primary 'Minor, W.' 9 0000-0001-7075-7090 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer nat 'Carbonic anhydrase' 25130.779 1 4.2.1.1 ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 water nat water 18.015 26 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSV VQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGH STIMQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK ; _entity_poly.pdbx_seq_one_letter_code_can ;MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSV VQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGH STIMQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ASP n 1 4 ILE n 1 5 ASP n 1 6 THR n 1 7 LEU n 1 8 ILE n 1 9 SER n 1 10 ASN n 1 11 ASN n 1 12 ALA n 1 13 LEU n 1 14 TRP n 1 15 SER n 1 16 LYS n 1 17 MET n 1 18 LEU n 1 19 VAL n 1 20 GLU n 1 21 GLU n 1 22 ASP n 1 23 PRO n 1 24 GLY n 1 25 PHE n 1 26 PHE n 1 27 GLU n 1 28 LYS n 1 29 LEU n 1 30 ALA n 1 31 GLN n 1 32 ALA n 1 33 GLN n 1 34 LYS n 1 35 PRO n 1 36 ARG n 1 37 PHE n 1 38 LEU n 1 39 TRP n 1 40 ILE n 1 41 GLY n 1 42 CYS n 1 43 SER n 1 44 ASP n 1 45 SER n 1 46 ARG n 1 47 VAL n 1 48 PRO n 1 49 ALA n 1 50 GLU n 1 51 ARG n 1 52 LEU n 1 53 THR n 1 54 GLY n 1 55 LEU n 1 56 GLU n 1 57 PRO n 1 58 GLY n 1 59 GLU n 1 60 LEU n 1 61 PHE n 1 62 VAL n 1 63 HIS n 1 64 ARG n 1 65 ASN n 1 66 VAL n 1 67 ALA n 1 68 ASN n 1 69 LEU n 1 70 VAL n 1 71 ILE n 1 72 HIS n 1 73 THR n 1 74 ASP n 1 75 LEU n 1 76 ASN n 1 77 CYS n 1 78 LEU n 1 79 SER n 1 80 VAL n 1 81 VAL n 1 82 GLN n 1 83 TYR n 1 84 ALA n 1 85 VAL n 1 86 ASP n 1 87 VAL n 1 88 LEU n 1 89 GLU n 1 90 VAL n 1 91 GLU n 1 92 HIS n 1 93 ILE n 1 94 ILE n 1 95 ILE n 1 96 CYS n 1 97 GLY n 1 98 HIS n 1 99 TYR n 1 100 GLY n 1 101 CYS n 1 102 GLY n 1 103 GLY n 1 104 VAL n 1 105 GLN n 1 106 ALA n 1 107 ALA n 1 108 VAL n 1 109 GLU n 1 110 ASN n 1 111 PRO n 1 112 GLU n 1 113 LEU n 1 114 GLY n 1 115 LEU n 1 116 ILE n 1 117 ASN n 1 118 ASN n 1 119 TRP n 1 120 LEU n 1 121 LEU n 1 122 HIS n 1 123 ILE n 1 124 ARG n 1 125 ASP n 1 126 ILE n 1 127 TRP n 1 128 PHE n 1 129 LYS n 1 130 HIS n 1 131 SER n 1 132 SER n 1 133 LEU n 1 134 LEU n 1 135 GLY n 1 136 GLU n 1 137 MET n 1 138 PRO n 1 139 GLN n 1 140 GLU n 1 141 ARG n 1 142 ARG n 1 143 LEU n 1 144 ASP n 1 145 THR n 1 146 LEU n 1 147 CYS n 1 148 GLU n 1 149 LEU n 1 150 ASN n 1 151 VAL n 1 152 MET n 1 153 GLU n 1 154 GLN n 1 155 VAL n 1 156 TYR n 1 157 ASN n 1 158 LEU n 1 159 GLY n 1 160 HIS n 1 161 SER n 1 162 THR n 1 163 ILE n 1 164 MET n 1 165 GLN n 1 166 SER n 1 167 ALA n 1 168 TRP n 1 169 LYS n 1 170 ARG n 1 171 GLY n 1 172 GLN n 1 173 LYS n 1 174 VAL n 1 175 THR n 1 176 ILE n 1 177 HIS n 1 178 GLY n 1 179 TRP n 1 180 ALA n 1 181 TYR n 1 182 GLY n 1 183 ILE n 1 184 HIS n 1 185 ASP n 1 186 GLY n 1 187 LEU n 1 188 LEU n 1 189 ARG n 1 190 ASP n 1 191 LEU n 1 192 ASP n 1 193 VAL n 1 194 THR n 1 195 ALA n 1 196 THR n 1 197 ASN n 1 198 ARG n 1 199 GLU n 1 200 THR n 1 201 LEU n 1 202 GLU n 1 203 GLN n 1 204 ARG n 1 205 TYR n 1 206 ARG n 1 207 HIS n 1 208 GLY n 1 209 ILE n 1 210 SER n 1 211 ASN n 1 212 LEU n 1 213 LYS n 1 214 LEU n 1 215 LYS n 1 216 HIS n 1 217 ALA n 1 218 ASN n 1 219 HIS n 1 220 LYS n # _entity_src_nat.entity_id 1 _entity_src_nat.pdbx_src_id 1 _entity_src_nat.pdbx_alt_source_flag sample _entity_src_nat.pdbx_beg_seq_num 1 _entity_src_nat.pdbx_end_seq_num 220 _entity_src_nat.common_name ? _entity_src_nat.pdbx_organism_scientific 'Escherichia coli' _entity_src_nat.pdbx_ncbi_taxonomy_id 469008 _entity_src_nat.genus ? _entity_src_nat.species ? _entity_src_nat.strain 'BL21-CodonPlus(DE3)-RIL' _entity_src_nat.tissue ? _entity_src_nat.tissue_fraction ? _entity_src_nat.pdbx_secretion ? _entity_src_nat.pdbx_fragment ? _entity_src_nat.pdbx_variant ? _entity_src_nat.pdbx_cell_line ? _entity_src_nat.pdbx_atcc ? _entity_src_nat.pdbx_cellular_location ? _entity_src_nat.pdbx_organ ? _entity_src_nat.pdbx_organelle ? _entity_src_nat.pdbx_cell ? _entity_src_nat.pdbx_plasmid_name ? _entity_src_nat.pdbx_plasmid_details ? _entity_src_nat.details ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 2 LYS LYS A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 ILE 4 4 4 ILE ILE A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 THR 6 6 6 THR THR A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 ILE 8 8 8 ILE ILE A . n A 1 9 SER 9 9 9 SER SER A . n A 1 10 ASN 10 10 10 ASN ASN A . n A 1 11 ASN 11 11 11 ASN ASN A . n A 1 12 ALA 12 12 12 ALA ALA A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 TRP 14 14 14 TRP TRP A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 LYS 16 16 16 LYS LYS A . n A 1 17 MET 17 17 17 MET MET A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 VAL 19 19 19 VAL VAL A . n A 1 20 GLU 20 20 20 GLU GLU A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ASP 22 22 22 ASP ASP A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 PHE 25 25 25 PHE PHE A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLU 27 27 27 GLU GLU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 LEU 29 29 29 LEU LEU A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 GLN 31 31 31 GLN GLN A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 LYS 34 34 34 LYS LYS A . n A 1 35 PRO 35 35 35 PRO PRO A . n A 1 36 ARG 36 36 36 ARG ARG A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 TRP 39 39 39 TRP TRP A . n A 1 40 ILE 40 40 40 ILE ILE A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 CYS 42 42 42 CYS CYS A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 ASP 44 44 44 ASP ASP A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 PRO 48 48 48 PRO PRO A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 GLU 50 50 50 GLU GLU A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 LEU 55 55 55 LEU LEU A . n A 1 56 GLU 56 56 56 GLU GLU A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 GLY 58 58 58 GLY GLY A . n A 1 59 GLU 59 59 59 GLU GLU A . n A 1 60 LEU 60 60 60 LEU LEU A . n A 1 61 PHE 61 61 61 PHE PHE A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 HIS 63 63 63 HIS HIS A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 ASN 65 65 65 ASN ASN A . n A 1 66 VAL 66 66 66 VAL VAL A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 ASN 68 68 68 ASN ASN A . n A 1 69 LEU 69 69 69 LEU LEU A . n A 1 70 VAL 70 70 70 VAL VAL A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 HIS 72 72 72 HIS HIS A . n A 1 73 THR 73 73 73 THR THR A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 CYS 77 77 77 CYS CYS A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 SER 79 79 79 SER SER A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 TYR 83 83 83 TYR TYR A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ASP 86 86 86 ASP ASP A . n A 1 87 VAL 87 87 87 VAL VAL A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 VAL 90 90 90 VAL VAL A . n A 1 91 GLU 91 91 91 GLU GLU A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ILE 95 95 95 ILE ILE A . n A 1 96 CYS 96 96 96 CYS CYS A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 HIS 98 98 98 HIS HIS A . n A 1 99 TYR 99 99 99 TYR TYR A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 CYS 101 101 101 CYS CYS A . n A 1 102 GLY 102 102 102 GLY GLY A . n A 1 103 GLY 103 103 103 GLY GLY A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 GLN 105 105 105 GLN GLN A . n A 1 106 ALA 106 106 106 ALA ALA A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 VAL 108 108 108 VAL VAL A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 ASN 110 110 110 ASN ASN A . n A 1 111 PRO 111 111 111 PRO PRO A . n A 1 112 GLU 112 112 112 GLU GLU A . n A 1 113 LEU 113 113 113 LEU LEU A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 TRP 119 119 119 TRP TRP A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 ILE 123 123 123 ILE ILE A . n A 1 124 ARG 124 124 124 ARG ARG A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 ILE 126 126 126 ILE ILE A . n A 1 127 TRP 127 127 127 TRP TRP A . n A 1 128 PHE 128 128 128 PHE PHE A . n A 1 129 LYS 129 129 129 LYS LYS A . n A 1 130 HIS 130 130 130 HIS HIS A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 SER 132 132 132 SER SER A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 GLU 136 136 136 GLU GLU A . n A 1 137 MET 137 137 137 MET MET A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 GLN 139 139 139 GLN GLN A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 LEU 143 143 143 LEU LEU A . n A 1 144 ASP 144 144 144 ASP ASP A . n A 1 145 THR 145 145 145 THR THR A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 CYS 147 147 147 CYS CYS A . n A 1 148 GLU 148 148 148 GLU GLU A . n A 1 149 LEU 149 149 149 LEU LEU A . n A 1 150 ASN 150 150 150 ASN ASN A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 MET 152 152 152 MET MET A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 GLN 154 154 154 GLN GLN A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 TYR 156 156 156 TYR TYR A . n A 1 157 ASN 157 157 157 ASN ASN A . n A 1 158 LEU 158 158 158 LEU LEU A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 HIS 160 160 160 HIS HIS A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 THR 162 162 162 THR THR A . n A 1 163 ILE 163 163 163 ILE ILE A . n A 1 164 MET 164 164 164 MET MET A . n A 1 165 GLN 165 165 165 GLN GLN A . n A 1 166 SER 166 166 166 SER SER A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 TRP 168 168 168 TRP TRP A . n A 1 169 LYS 169 169 169 LYS LYS A . n A 1 170 ARG 170 170 170 ARG ARG A . n A 1 171 GLY 171 171 171 GLY GLY A . n A 1 172 GLN 172 172 172 GLN GLN A . n A 1 173 LYS 173 173 173 LYS LYS A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 ILE 176 176 176 ILE ILE A . n A 1 177 HIS 177 177 177 HIS HIS A . n A 1 178 GLY 178 178 178 GLY GLY A . n A 1 179 TRP 179 179 179 TRP TRP A . n A 1 180 ALA 180 180 180 ALA ALA A . n A 1 181 TYR 181 181 181 TYR TYR A . n A 1 182 GLY 182 182 182 GLY GLY A . n A 1 183 ILE 183 183 183 ILE ILE A . n A 1 184 HIS 184 184 184 HIS HIS A . n A 1 185 ASP 185 185 185 ASP ASP A . n A 1 186 GLY 186 186 186 GLY GLY A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 ASP 190 190 190 ASP ASP A . n A 1 191 LEU 191 191 191 LEU LEU A . n A 1 192 ASP 192 192 192 ASP ASP A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 THR 194 194 194 THR THR A . n A 1 195 ALA 195 195 195 ALA ALA A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 ASN 197 197 197 ASN ASN A . n A 1 198 ARG 198 198 198 ARG ARG A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 THR 200 200 200 THR THR A . n A 1 201 LEU 201 201 201 LEU LEU A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 GLN 203 203 203 GLN GLN A . n A 1 204 ARG 204 204 204 ARG ARG A . n A 1 205 TYR 205 205 205 TYR TYR A . n A 1 206 ARG 206 206 206 ARG ARG A . n A 1 207 HIS 207 207 207 HIS HIS A . n A 1 208 GLY 208 208 208 GLY GLY A . n A 1 209 ILE 209 209 209 ILE ILE A . n A 1 210 SER 210 210 210 SER SER A . n A 1 211 ASN 211 211 211 ASN ASN A . n A 1 212 LEU 212 212 212 LEU LEU A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 LEU 214 214 214 LEU LEU A . n A 1 215 LYS 215 215 215 LYS LYS A . n A 1 216 HIS 216 216 216 HIS HIS A . n A 1 217 ALA 217 217 ? ? ? A . n A 1 218 ASN 218 218 ? ? ? A . n A 1 219 HIS 219 219 ? ? ? A . n A 1 220 LYS 220 220 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 301 1 ZN ZN A . C 3 HOH 1 401 17 HOH HOH A . C 3 HOH 2 402 26 HOH HOH A . C 3 HOH 3 403 21 HOH HOH A . C 3 HOH 4 404 3 HOH HOH A . C 3 HOH 5 405 22 HOH HOH A . C 3 HOH 6 406 8 HOH HOH A . C 3 HOH 7 407 2 HOH HOH A . C 3 HOH 8 408 5 HOH HOH A . C 3 HOH 9 409 23 HOH HOH A . C 3 HOH 10 410 12 HOH HOH A . C 3 HOH 11 411 13 HOH HOH A . C 3 HOH 12 412 14 HOH HOH A . C 3 HOH 13 413 9 HOH HOH A . C 3 HOH 14 414 10 HOH HOH A . C 3 HOH 15 415 6 HOH HOH A . C 3 HOH 16 416 19 HOH HOH A . C 3 HOH 17 417 16 HOH HOH A . C 3 HOH 18 418 18 HOH HOH A . C 3 HOH 19 419 1 HOH HOH A . C 3 HOH 20 420 15 HOH HOH A . C 3 HOH 21 421 7 HOH HOH A . C 3 HOH 22 422 4 HOH HOH A . C 3 HOH 23 423 11 HOH HOH A . C 3 HOH 24 424 24 HOH HOH A . C 3 HOH 25 425 25 HOH HOH A . C 3 HOH 26 426 20 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 20 ? CD ? A GLU 20 CD 2 1 Y 1 A GLU 20 ? OE1 ? A GLU 20 OE1 3 1 Y 1 A GLU 20 ? OE2 ? A GLU 20 OE2 4 1 Y 1 A PHE 25 ? CG ? A PHE 25 CG 5 1 Y 1 A PHE 25 ? CD1 ? A PHE 25 CD1 6 1 Y 1 A PHE 25 ? CD2 ? A PHE 25 CD2 7 1 Y 1 A PHE 25 ? CE1 ? A PHE 25 CE1 8 1 Y 1 A PHE 25 ? CE2 ? A PHE 25 CE2 9 1 Y 1 A PHE 25 ? CZ ? A PHE 25 CZ 10 1 Y 1 A PHE 26 ? CG ? A PHE 26 CG 11 1 Y 1 A PHE 26 ? CD1 ? A PHE 26 CD1 12 1 Y 1 A PHE 26 ? CD2 ? A PHE 26 CD2 13 1 Y 1 A PHE 26 ? CE1 ? A PHE 26 CE1 14 1 Y 1 A PHE 26 ? CE2 ? A PHE 26 CE2 15 1 Y 1 A PHE 26 ? CZ ? A PHE 26 CZ 16 1 Y 1 A GLU 27 ? CG ? A GLU 27 CG 17 1 Y 1 A GLU 27 ? CD ? A GLU 27 CD 18 1 Y 1 A GLU 27 ? OE1 ? A GLU 27 OE1 19 1 Y 1 A GLU 27 ? OE2 ? A GLU 27 OE2 20 1 Y 1 A LEU 29 ? CG ? A LEU 29 CG 21 1 Y 1 A LEU 29 ? CD1 ? A LEU 29 CD1 22 1 Y 1 A LEU 29 ? CD2 ? A LEU 29 CD2 23 1 Y 1 A GLN 31 ? CG ? A GLN 31 CG 24 1 Y 1 A GLN 31 ? CD ? A GLN 31 CD 25 1 Y 1 A GLN 31 ? OE1 ? A GLN 31 OE1 26 1 Y 1 A GLN 31 ? NE2 ? A GLN 31 NE2 27 1 Y 1 A GLN 33 ? CG ? A GLN 33 CG 28 1 Y 1 A GLN 33 ? CD ? A GLN 33 CD 29 1 Y 1 A GLN 33 ? OE1 ? A GLN 33 OE1 30 1 Y 1 A GLN 33 ? NE2 ? A GLN 33 NE2 31 1 Y 1 A GLU 109 ? CG ? A GLU 109 CG 32 1 Y 1 A GLU 109 ? CD ? A GLU 109 CD 33 1 Y 1 A GLU 109 ? OE1 ? A GLU 109 OE1 34 1 Y 1 A GLU 109 ? OE2 ? A GLU 109 OE2 35 1 Y 1 A ARG 141 ? CD ? A ARG 141 CD 36 1 Y 1 A ARG 141 ? NE ? A ARG 141 NE 37 1 Y 1 A ARG 141 ? CZ ? A ARG 141 CZ 38 1 Y 1 A ARG 141 ? NH1 ? A ARG 141 NH1 39 1 Y 1 A ARG 141 ? NH2 ? A ARG 141 NH2 40 1 Y 1 A SER 210 ? OG ? A SER 210 OG 41 1 Y 1 A LYS 213 ? CG ? A LYS 213 CG 42 1 Y 1 A LYS 213 ? CD ? A LYS 213 CD 43 1 Y 1 A LYS 213 ? CE ? A LYS 213 CE 44 1 Y 1 A LYS 213 ? NZ ? A LYS 213 NZ 45 1 Y 1 A LEU 214 ? CG ? A LEU 214 CG 46 1 Y 1 A LEU 214 ? CD1 ? A LEU 214 CD1 47 1 Y 1 A LEU 214 ? CD2 ? A LEU 214 CD2 48 1 Y 1 A LYS 215 ? CG ? A LYS 215 CG 49 1 Y 1 A LYS 215 ? CD ? A LYS 215 CD 50 1 Y 1 A LYS 215 ? CE ? A LYS 215 CE 51 1 Y 1 A LYS 215 ? NZ ? A LYS 215 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0107 1 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? MLPHARE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELX ? ? ? . 4 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 5 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-3000 ? ? ? . 6 ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? BLU-MAX ? ? ? . 7 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 8 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 4ZNZ _cell.details ? _cell.formula_units_Z ? _cell.length_a 67.909 _cell.length_a_esd ? _cell.length_b 67.909 _cell.length_b_esd ? _cell.length_c 84.930 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4ZNZ _symmetry.cell_setting ? _symmetry.Int_Tables_number 94 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 42 21 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4ZNZ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.95 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 36.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;0.3 ul of 7.4 mg/ml protein in 50 mM TRIS pH 7.9, 200 mM NaCl and 0.5 mM TCEP were mixed with the 0.3 ul of SaltRx condition #96 (60% v/v Tacsimate pH 7.0 and 0.1 M BIS-TRIS propane pH 7.0) and equilibrated against SaltRx condition #96 solution in 96 Well 3 drop Crystallization Plate (Swissci) ; _exptl_crystal_grow.pdbx_pH_range '7.0 - 7.9' # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details 'Bimorph K-B pair' _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-06-20 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator Kohzu _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.27822 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.27822 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 58.2 _reflns.entry_id 4ZNZ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.700 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 5907 _reflns.number_obs 5527 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.percent_possible_obs 93.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.100 _reflns.pdbx_Rmerge_I_obs 0.122 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.122 _reflns.pdbx_netI_over_av_sigmaI 18.875 _reflns.pdbx_netI_over_sigmaI 6.500 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.069 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.130 _reflns.pdbx_Rpim_I_all 0.045 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 44824 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.700 2.750 ? 1.8 ? ? ? 276 ? 95.800 ? ? ? ? 0.926 ? ? ? ? ? ? ? ? 8.100 ? 0.644 ? ? 0.988 0.338 0 1 1 0.752 ? 2.750 2.800 ? ? ? ? ? 275 ? 96.200 ? ? ? ? 0.741 ? ? ? ? ? ? ? ? 8.100 ? 0.684 ? ? 0.790 0.270 0 2 1 0.847 ? 2.800 2.850 ? ? ? ? ? 282 ? 95.900 ? ? ? ? 0.737 ? ? ? ? ? ? ? ? 8.200 ? 0.733 ? ? 0.785 0.266 0 3 1 0.789 ? 2.850 2.910 ? ? ? ? ? 262 ? 96.000 ? ? ? ? 0.618 ? ? ? ? ? ? ? ? 8.300 ? 0.699 ? ? 0.659 0.224 0 4 1 0.811 ? 2.910 2.970 ? ? ? ? ? 272 ? 95.400 ? ? ? ? 0.574 ? ? ? ? ? ? ? ? 8.100 ? 0.722 ? ? 0.612 0.210 0 5 1 0.881 ? 2.970 3.040 ? ? ? ? ? 279 ? 94.900 ? ? ? ? 0.506 ? ? ? ? ? ? ? ? 8.100 ? 0.801 ? ? 0.540 0.183 0 6 1 0.892 ? 3.040 3.120 ? ? ? ? ? 272 ? 96.100 ? ? ? ? 0.422 ? ? ? ? ? ? ? ? 8.200 ? 0.778 ? ? 0.451 0.154 0 7 1 0.945 ? 3.120 3.200 ? ? ? ? ? 276 ? 94.800 ? ? ? ? 0.342 ? ? ? ? ? ? ? ? 8.200 ? 0.829 ? ? 0.365 0.124 0 8 1 0.962 ? 3.200 3.300 ? ? ? ? ? 268 ? 94.400 ? ? ? ? 0.277 ? ? ? ? ? ? ? ? 8.200 ? 0.866 ? ? 0.295 0.101 0 9 1 0.967 ? 3.300 3.400 ? ? ? ? ? 282 ? 94.000 ? ? ? ? 0.216 ? ? ? ? ? ? ? ? 8.100 ? 0.929 ? ? 0.230 0.079 0 10 1 0.973 ? 3.400 3.520 ? ? ? ? ? 258 ? 95.200 ? ? ? ? 0.176 ? ? ? ? ? ? ? ? 8.200 ? 0.970 ? ? 0.188 0.064 0 11 1 0.994 ? 3.520 3.660 ? ? ? ? ? 272 ? 93.500 ? ? ? ? 0.138 ? ? ? ? ? ? ? ? 8.300 ? 1.096 ? ? 0.147 0.051 0 12 1 0.992 ? 3.660 3.830 ? ? ? ? ? 275 ? 94.200 ? ? ? ? 0.121 ? ? ? ? ? ? ? ? 8.200 ? 1.159 ? ? 0.129 0.044 0 13 1 0.993 ? 3.830 4.030 ? ? ? ? ? 284 ? 93.700 ? ? ? ? 0.118 ? ? ? ? ? ? ? ? 8.100 ? 1.366 ? ? 0.126 0.043 0 14 1 0.993 ? 4.030 4.290 ? ? ? ? ? 269 ? 92.100 ? ? ? ? 0.095 ? ? ? ? ? ? ? ? 8.200 ? 1.335 ? ? 0.101 0.035 0 15 1 0.996 ? 4.290 4.620 ? ? ? ? ? 274 ? 92.900 ? ? ? ? 0.075 ? ? ? ? ? ? ? ? 8.200 ? 1.545 ? ? 0.080 0.028 0 16 1 0.995 ? 4.620 5.080 ? ? ? ? ? 278 ? 91.700 ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 8.100 ? 1.639 ? ? 0.065 0.023 0 17 1 0.997 ? 5.080 5.810 ? ? ? ? ? 283 ? 91.600 ? ? ? ? 0.065 ? ? ? ? ? ? ? ? 8.100 ? 1.386 ? ? 0.069 0.023 0 18 1 0.998 ? 5.810 7.320 ? ? ? ? ? 281 ? 90.100 ? ? ? ? 0.058 ? ? ? ? ? ? ? ? 7.900 ? 1.486 ? ? 0.062 0.021 0 19 1 0.999 ? 7.320 50.000 ? ? ? ? ? 309 ? 86.600 ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 7.300 ? 1.694 ? ? 0.042 0.015 0 20 1 0.998 ? # _refine.aniso_B[1][1] 0.6800 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] 0.6800 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -1.3500 _refine.B_iso_max 139.180 _refine.B_iso_mean 53.7750 _refine.B_iso_min 29.200 _refine.correlation_coeff_Fo_to_Fc 0.9660 _refine.correlation_coeff_Fo_to_Fc_free 0.9060 _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS U VALUES : REFINED INDIVIDUALLY' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4ZNZ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7000 _refine.ls_d_res_low 50.000 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5247 _refine.ls_number_reflns_R_free 255 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 93.8300 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1534 _refine.ls_R_factor_R_free 0.2575 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1488 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free 0.2318 _refine.ls_wR_factor_R_work 0.1348 _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free 0.4110 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI 0.4061 _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 11.7060 _refine.overall_SU_ML 0.2370 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free 0.4107 _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.8745 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.7000 _refine_hist.d_res_low 50.000 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 1701 _refine_hist.pdbx_number_residues_total 215 _refine_hist.pdbx_B_iso_mean_ligand 42.81 _refine_hist.pdbx_B_iso_mean_solvent 46.16 _refine_hist.pdbx_number_atoms_protein 1674 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 0.019 1710 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 0.003 0.020 1619 ? r_bond_other_d ? ? 'X-RAY DIFFRACTION' ? 1.591 1.936 2326 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 0.998 3.000 3695 ? r_angle_other_deg ? ? 'X-RAY DIFFRACTION' ? 6.888 5.000 214 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 37.181 24.051 79 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 15.992 15.000 282 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 18.761 15.000 11 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.079 0.200 264 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 0.020 1956 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 0.002 0.020 405 ? r_gen_planes_other ? ? 'X-RAY DIFFRACTION' ? 4.165 5.374 859 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 4.129 5.370 858 ? r_mcbond_other ? ? 'X-RAY DIFFRACTION' ? 6.404 8.054 1072 ? r_mcangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.7000 _refine_ls_shell.d_res_low 2.7700 _refine_ls_shell.number_reflns_all 401 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 13 _refine_ls_shell.number_reflns_R_work 388 _refine_ls_shell.percent_reflns_obs 96.1600 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3800 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.1850 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 4ZNZ _struct.title 'Crystal structure of Escherichia coli carbonic anhydrase (YadF) in complex with Zn - artifact of purification' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4ZNZ _struct_keywords.text 'carbonic anhydrase, YadF, crystallization artifact, zinc binding, LYASE' _struct_keywords.pdbx_keywords LYASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code C6EAT1_ECOBD _struct_ref.pdbx_db_accession C6EAT1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKDIDTLISNNALWSKMLVEEDPGFFEKLAQAQKPRFLWIGCSDSRVPAERLTGLEPGELFVHRNVANLVIHTDLNCLSV VQYAVDVLEVEHIIICGHYGCGGVQAAVENPELGLINNWLLHIRDIWFKHSSLLGEMPQERRLDTLCELNVMEQVYNLGH STIMQSAWKRGQKVTIHGWAYGIHDGLLRDLDVTATNRETLEQRYRHGISNLKLKHANHK ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4ZNZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 220 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession C6EAT1 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 220 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 220 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 15130 ? 1 MORE -92 ? 1 'SSA (A^2)' 32600 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_555 -x,-y,z -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 7_555 y,x,-z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 4 'crystal symmetry operation' 8_555 -y,-x,-z 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 3 ? ASP A 22 ? ASP A 3 ASP A 22 1 ? 20 HELX_P HELX_P2 AA2 PRO A 23 ? GLN A 31 ? PRO A 23 GLN A 31 1 ? 9 HELX_P HELX_P3 AA3 PRO A 48 ? GLY A 54 ? PRO A 48 GLY A 54 1 ? 7 HELX_P HELX_P4 AA4 ASP A 74 ? VAL A 87 ? ASP A 74 VAL A 87 1 ? 14 HELX_P HELX_P5 AA5 CYS A 101 ? ASN A 110 ? CYS A 101 ASN A 110 1 ? 10 HELX_P HELX_P6 AA6 LEU A 115 ? HIS A 130 ? LEU A 115 HIS A 130 1 ? 16 HELX_P HELX_P7 AA7 HIS A 130 ? GLU A 136 ? HIS A 130 GLU A 136 1 ? 7 HELX_P HELX_P8 AA8 MET A 137 ? GLU A 140 ? MET A 137 GLU A 140 5 ? 4 HELX_P HELX_P9 AA9 ARG A 141 ? SER A 161 ? ARG A 141 SER A 161 1 ? 21 HELX_P HELX_P10 AB1 SER A 161 ? GLY A 171 ? SER A 161 GLY A 171 1 ? 11 HELX_P HELX_P11 AB2 ASN A 197 ? HIS A 216 ? ASN A 197 HIS A 216 1 ? 20 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 42 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 42 A ZN 301 1_555 ? ? ? ? ? ? ? 2.339 ? ? metalc2 metalc ? ? A ASP 44 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 44 A ZN 301 1_555 ? ? ? ? ? ? ? 2.218 ? ? metalc3 metalc ? ? A HIS 98 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 98 A ZN 301 1_555 ? ? ? ? ? ? ? 2.162 ? ? metalc4 metalc ? ? A CYS 101 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 101 A ZN 301 1_555 ? ? ? ? ? ? ? 2.417 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 42 ? A CYS 42 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 OD2 ? A ASP 44 ? A ASP 44 ? 1_555 104.0 ? 2 SG ? A CYS 42 ? A CYS 42 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 98 ? A HIS 98 ? 1_555 102.7 ? 3 OD2 ? A ASP 44 ? A ASP 44 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 98 ? A HIS 98 ? 1_555 123.1 ? 4 SG ? A CYS 42 ? A CYS 42 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 101 ? A CYS 101 ? 1_555 103.2 ? 5 OD2 ? A ASP 44 ? A ASP 44 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 101 ? A CYS 101 ? 1_555 116.8 ? 6 NE2 ? A HIS 98 ? A HIS 98 ? 1_555 ZN ? B ZN . ? A ZN 301 ? 1_555 SG ? A CYS 101 ? A CYS 101 ? 1_555 104.5 ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLN 31 A . ? GLN 31 A ALA 32 A ? ALA 32 A 1 6.23 2 ALA 32 A . ? ALA 32 A GLN 33 A ? GLN 33 A 1 -11.35 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 60 ? ASN A 65 ? LEU A 60 ASN A 65 AA1 2 PHE A 37 ? CYS A 42 ? PHE A 37 CYS A 42 AA1 3 HIS A 92 ? HIS A 98 ? HIS A 92 HIS A 98 AA1 4 THR A 175 ? TYR A 181 ? THR A 175 TYR A 181 AA1 5 ARG A 189 ? ASP A 190 ? ARG A 189 ASP A 190 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O HIS A 63 ? O HIS A 63 N GLY A 41 ? N GLY A 41 AA1 2 3 N LEU A 38 ? N LEU A 38 O ILE A 94 ? O ILE A 94 AA1 3 4 N ILE A 95 ? N ILE A 95 O TRP A 179 ? O TRP A 179 AA1 4 5 N ALA A 180 ? N ALA A 180 O ARG A 189 ? O ARG A 189 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue ZN A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 42 ? CYS A 42 . ? 1_555 ? 2 AC1 4 ASP A 44 ? ASP A 44 . ? 1_555 ? 3 AC1 4 HIS A 98 ? HIS A 98 . ? 1_555 ? 4 AC1 4 CYS A 101 ? CYS A 101 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 22 ? ? -163.18 90.44 2 1 LEU A 214 ? ? -90.71 -61.39 # _pdbx_validate_peptide_omega.id 1 _pdbx_validate_peptide_omega.PDB_model_num 1 _pdbx_validate_peptide_omega.auth_comp_id_1 GLY _pdbx_validate_peptide_omega.auth_asym_id_1 A _pdbx_validate_peptide_omega.auth_seq_id_1 58 _pdbx_validate_peptide_omega.PDB_ins_code_1 ? _pdbx_validate_peptide_omega.label_alt_id_1 ? _pdbx_validate_peptide_omega.auth_comp_id_2 GLU _pdbx_validate_peptide_omega.auth_asym_id_2 A _pdbx_validate_peptide_omega.auth_seq_id_2 59 _pdbx_validate_peptide_omega.PDB_ins_code_2 ? _pdbx_validate_peptide_omega.label_alt_id_2 ? _pdbx_validate_peptide_omega.omega 145.35 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A ALA 217 ? A ALA 217 3 1 Y 1 A ASN 218 ? A ASN 218 4 1 Y 1 A HIS 219 ? A HIS 219 5 1 Y 1 A LYS 220 ? A LYS 220 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 ZN ZN ZN N N 391 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number U54-GM094662 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 4ZNZ _atom_sites.fract_transf_matrix[1][1] 0.014726 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014726 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011774 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S ZN # loop_