data_4AYK # _entry.id 4AYK # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4AYK pdb_00004ayk 10.2210/pdb4ayk/pdb RCSB RCSB000424 ? ? WWPDB D_1000000424 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1999-06-05 2 'Structure model' 1 1 2007-10-16 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2019-10-30 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Data collection' 7 5 'Structure model' 'Database references' 8 5 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' citation 2 4 'Structure model' citation_author 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_assembly_prop 5 4 'Structure model' pdbx_struct_oper_list 6 5 'Structure model' chem_comp_atom 7 5 'Structure model' chem_comp_bond 8 5 'Structure model' database_2 9 5 'Structure model' pdbx_struct_conn_angle 10 5 'Structure model' struct_conn 11 5 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_abbrev' 2 4 'Structure model' '_citation.journal_volume' 3 4 'Structure model' '_citation.pdbx_database_id_DOI' 4 4 'Structure model' '_citation.pdbx_database_id_PubMed' 5 4 'Structure model' '_citation.title' 6 4 'Structure model' '_citation_author.name' 7 5 'Structure model' '_database_2.pdbx_DOI' 8 5 'Structure model' '_database_2.pdbx_database_accession' 9 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 10 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 11 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 12 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 13 5 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 14 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 17 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 18 5 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 19 5 'Structure model' '_pdbx_struct_conn_angle.value' 20 5 'Structure model' '_struct_conn.pdbx_dist_value' 21 5 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 22 5 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 23 5 'Structure model' '_struct_conn.ptnr1_label_asym_id' 24 5 'Structure model' '_struct_conn.ptnr1_label_atom_id' 25 5 'Structure model' '_struct_conn.ptnr1_label_comp_id' 26 5 'Structure model' '_struct_conn.ptnr1_label_seq_id' 27 5 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 28 5 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 29 5 'Structure model' '_struct_conn.ptnr2_label_asym_id' 30 5 'Structure model' '_struct_conn.ptnr2_label_atom_id' 31 5 'Structure model' '_struct_conn.ptnr2_label_comp_id' 32 5 'Structure model' '_struct_conn.ptnr2_label_seq_id' 33 5 'Structure model' '_struct_site.pdbx_auth_asym_id' 34 5 'Structure model' '_struct_site.pdbx_auth_comp_id' 35 5 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4AYK _pdbx_database_status.recvd_initial_deposition_date 1999-02-01 _pdbx_database_status.deposit_site BNL _pdbx_database_status.process_site RCSB _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Powers, R.' 1 'Moy, F.J.' 2 # loop_ _citation.id _citation.title _citation.journal_abbrev _citation.journal_volume _citation.page_first _citation.page_last _citation.year _citation.journal_id_ASTM _citation.country _citation.journal_id_ISSN _citation.journal_id_CSD _citation.book_publisher _citation.pdbx_database_id_PubMed _citation.pdbx_database_id_DOI primary ;NMR solution structure of the catalytic fragment of human fibroblast collagenase complexed with a sulfonamide derivative of a hydroxamic acid compound. ; Biochemistry 38 7085 7096 1999 BICHAW US 0006-2960 0033 ? 10353819 10.1021/bi982576v 1 ;High-resolution solution structure of the inhibitor-free catalytic fragment of human fibroblast collagenase determined by multidimensional NMR. ; Biochemistry 37 1495 1504 1998 BICHAW US 0006-2960 0033 ? 9484219 10.1021/bi972181w 2 'Assignments, secondary structure and dynamics of the inhibitor-free catalytic fragment of human fibroblast collagenase.' J.Biomol.Nmr 10 9 19 1997 JBNME9 NE 0925-2738 0800 ? 9335112 10.1023/a:1018362914316 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Moy, F.J.' 1 ? primary 'Chanda, P.K.' 2 ? primary 'Chen, J.M.' 3 ? primary 'Cosmi, S.' 4 ? primary 'Edris, W.' 5 ? primary 'Skotnicki, J.S.' 6 ? primary 'Wilhelm, J.' 7 ? primary 'Powers, R.' 8 ? 1 'Moy, F.J.' 9 ? 1 'Chanda, P.K.' 10 ? 1 'Cosmi, S.' 11 ? 1 'Pisano, M.R.' 12 ? 1 'Urbano, C.' 13 ? 1 'Wilhelm, J.' 14 ? 1 'Powers, R.' 15 ? 2 'Moy, F.J.' 16 ? 2 'Pisano, M.R.' 17 ? 2 'Chanda, P.K.' 18 ? 2 'Urbano, C.' 19 ? 2 'Killar, L.M.' 20 ? 2 'Sung, M.L.' 21 ? 2 'Powers, R.' 22 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'PROTEIN (COLLAGENASE)' 18865.541 1 3.4.24.7 ? 'CATALYTIC FRAGMENT' 'HETEROGEN: N-HYDROXY-2(R)-[[(4METHOXYPHENYL) SULFONYL](3-PICOLYL)AMINO]-3- METHYLBUTANAMIDE HYDROCHLORID' 2 non-polymer syn 'ZINC ION' 65.409 2 ? ? ? ? 3 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 4 non-polymer syn 'N-HYDROXY-2(R)-[[(4-METHOXYPHENYL)SULFONYL](3-PICOLYL)AMINO]-3-METHYLBUTANAMIDE HYDROCHLORIDE' 393.457 1 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'MMP-1, FIBROBLAST COLLAGENASE' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIY GRSQNPVQP ; _entity_poly.pdbx_seq_one_letter_code_can ;VLTEGNPRWEQTHLTYRIENYTPDLPRADVDHAIEKAFQLWSNVTPLTFTKVSEGQADIMISFVRGDHRDNSPFDGPGGN LAHAFQPGPGIGGDAHFDEDERWTNNFREYNLHRVAAHELGHSLGLSHSTDIGALMYPSYTFSGDVQLAQDDIDGIQAIY GRSQNPVQP ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'CALCIUM ION' CA 4 'N-HYDROXY-2(R)-[[(4-METHOXYPHENYL)SULFONYL](3-PICOLYL)AMINO]-3-METHYLBUTANAMIDE HYDROCHLORIDE' CGS # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 LEU n 1 3 THR n 1 4 GLU n 1 5 GLY n 1 6 ASN n 1 7 PRO n 1 8 ARG n 1 9 TRP n 1 10 GLU n 1 11 GLN n 1 12 THR n 1 13 HIS n 1 14 LEU n 1 15 THR n 1 16 TYR n 1 17 ARG n 1 18 ILE n 1 19 GLU n 1 20 ASN n 1 21 TYR n 1 22 THR n 1 23 PRO n 1 24 ASP n 1 25 LEU n 1 26 PRO n 1 27 ARG n 1 28 ALA n 1 29 ASP n 1 30 VAL n 1 31 ASP n 1 32 HIS n 1 33 ALA n 1 34 ILE n 1 35 GLU n 1 36 LYS n 1 37 ALA n 1 38 PHE n 1 39 GLN n 1 40 LEU n 1 41 TRP n 1 42 SER n 1 43 ASN n 1 44 VAL n 1 45 THR n 1 46 PRO n 1 47 LEU n 1 48 THR n 1 49 PHE n 1 50 THR n 1 51 LYS n 1 52 VAL n 1 53 SER n 1 54 GLU n 1 55 GLY n 1 56 GLN n 1 57 ALA n 1 58 ASP n 1 59 ILE n 1 60 MET n 1 61 ILE n 1 62 SER n 1 63 PHE n 1 64 VAL n 1 65 ARG n 1 66 GLY n 1 67 ASP n 1 68 HIS n 1 69 ARG n 1 70 ASP n 1 71 ASN n 1 72 SER n 1 73 PRO n 1 74 PHE n 1 75 ASP n 1 76 GLY n 1 77 PRO n 1 78 GLY n 1 79 GLY n 1 80 ASN n 1 81 LEU n 1 82 ALA n 1 83 HIS n 1 84 ALA n 1 85 PHE n 1 86 GLN n 1 87 PRO n 1 88 GLY n 1 89 PRO n 1 90 GLY n 1 91 ILE n 1 92 GLY n 1 93 GLY n 1 94 ASP n 1 95 ALA n 1 96 HIS n 1 97 PHE n 1 98 ASP n 1 99 GLU n 1 100 ASP n 1 101 GLU n 1 102 ARG n 1 103 TRP n 1 104 THR n 1 105 ASN n 1 106 ASN n 1 107 PHE n 1 108 ARG n 1 109 GLU n 1 110 TYR n 1 111 ASN n 1 112 LEU n 1 113 HIS n 1 114 ARG n 1 115 VAL n 1 116 ALA n 1 117 ALA n 1 118 HIS n 1 119 GLU n 1 120 LEU n 1 121 GLY n 1 122 HIS n 1 123 SER n 1 124 LEU n 1 125 GLY n 1 126 LEU n 1 127 SER n 1 128 HIS n 1 129 SER n 1 130 THR n 1 131 ASP n 1 132 ILE n 1 133 GLY n 1 134 ALA n 1 135 LEU n 1 136 MET n 1 137 TYR n 1 138 PRO n 1 139 SER n 1 140 TYR n 1 141 THR n 1 142 PHE n 1 143 SER n 1 144 GLY n 1 145 ASP n 1 146 VAL n 1 147 GLN n 1 148 LEU n 1 149 ALA n 1 150 GLN n 1 151 ASP n 1 152 ASP n 1 153 ILE n 1 154 ASP n 1 155 GLY n 1 156 ILE n 1 157 GLN n 1 158 ALA n 1 159 ILE n 1 160 TYR n 1 161 GLY n 1 162 ARG n 1 163 SER n 1 164 GLN n 1 165 ASN n 1 166 PRO n 1 167 VAL n 1 168 GLN n 1 169 PRO n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'BL21 (DE3)' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus Escherichia _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species 'Escherichia coli' _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector 'PET-21A(+)' _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name PNOT-3A _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CGS non-polymer . 'N-HYDROXY-2(R)-[[(4-METHOXYPHENYL)SULFONYL](3-PICOLYL)AMINO]-3-METHYLBUTANAMIDE HYDROCHLORIDE' CGS-27023A 'C18 H23 N3 O5 S' 393.457 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 1 1 VAL VAL A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 GLY 5 5 5 GLY GLY A . n A 1 6 ASN 6 6 6 ASN ASN A . n A 1 7 PRO 7 7 7 PRO PRO A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 GLU 10 10 10 GLU GLU A . n A 1 11 GLN 11 11 11 GLN GLN A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 HIS 13 13 13 HIS HIS A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 THR 15 15 15 THR THR A . n A 1 16 TYR 16 16 16 TYR TYR A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 GLU 19 19 19 GLU GLU A . n A 1 20 ASN 20 20 20 ASN ASN A . n A 1 21 TYR 21 21 21 TYR TYR A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 ASP 24 24 24 ASP ASP A . n A 1 25 LEU 25 25 25 LEU LEU A . n A 1 26 PRO 26 26 26 PRO PRO A . n A 1 27 ARG 27 27 27 ARG ARG A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 VAL 30 30 30 VAL VAL A . n A 1 31 ASP 31 31 31 ASP ASP A . n A 1 32 HIS 32 32 32 HIS HIS A . n A 1 33 ALA 33 33 33 ALA ALA A . n A 1 34 ILE 34 34 34 ILE ILE A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 ALA 37 37 37 ALA ALA A . n A 1 38 PHE 38 38 38 PHE PHE A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 LEU 40 40 40 LEU LEU A . n A 1 41 TRP 41 41 41 TRP TRP A . n A 1 42 SER 42 42 42 SER SER A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 THR 45 45 45 THR THR A . n A 1 46 PRO 46 46 46 PRO PRO A . n A 1 47 LEU 47 47 47 LEU LEU A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 PHE 49 49 49 PHE PHE A . n A 1 50 THR 50 50 50 THR THR A . n A 1 51 LYS 51 51 51 LYS LYS A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 ASP 58 58 58 ASP ASP A . n A 1 59 ILE 59 59 59 ILE ILE A . n A 1 60 MET 60 60 60 MET MET A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 PHE 63 63 63 PHE PHE A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 ARG 65 65 65 ARG ARG A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ASP 67 67 67 ASP ASP A . n A 1 68 HIS 68 68 68 HIS HIS A . n A 1 69 ARG 69 69 69 ARG ARG A . n A 1 70 ASP 70 70 70 ASP ASP A . n A 1 71 ASN 71 71 71 ASN ASN A . n A 1 72 SER 72 72 72 SER SER A . n A 1 73 PRO 73 73 73 PRO PRO A . n A 1 74 PHE 74 74 74 PHE PHE A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLY 76 76 76 GLY GLY A . n A 1 77 PRO 77 77 77 PRO PRO A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 ASN 80 80 80 ASN ASN A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 HIS 83 83 83 HIS HIS A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 PHE 85 85 85 PHE PHE A . n A 1 86 GLN 86 86 86 GLN GLN A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 PRO 89 89 89 PRO PRO A . n A 1 90 GLY 90 90 90 GLY GLY A . n A 1 91 ILE 91 91 91 ILE ILE A . n A 1 92 GLY 92 92 92 GLY GLY A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ALA 95 95 95 ALA ALA A . n A 1 96 HIS 96 96 96 HIS HIS A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 GLU 99 99 99 GLU GLU A . n A 1 100 ASP 100 100 100 ASP ASP A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 ARG 102 102 102 ARG ARG A . n A 1 103 TRP 103 103 103 TRP TRP A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 ASN 105 105 105 ASN ASN A . n A 1 106 ASN 106 106 106 ASN ASN A . n A 1 107 PHE 107 107 107 PHE PHE A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 GLU 109 109 109 GLU GLU A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 ASN 111 111 111 ASN ASN A . n A 1 112 LEU 112 112 112 LEU LEU A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 ARG 114 114 114 ARG ARG A . n A 1 115 VAL 115 115 115 VAL VAL A . n A 1 116 ALA 116 116 116 ALA ALA A . n A 1 117 ALA 117 117 117 ALA ALA A . n A 1 118 HIS 118 118 118 HIS HIS A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 LEU 120 120 120 LEU LEU A . n A 1 121 GLY 121 121 121 GLY GLY A . n A 1 122 HIS 122 122 122 HIS HIS A . n A 1 123 SER 123 123 123 SER SER A . n A 1 124 LEU 124 124 124 LEU LEU A . n A 1 125 GLY 125 125 125 GLY GLY A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 SER 127 127 127 SER SER A . n A 1 128 HIS 128 128 128 HIS HIS A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 THR 130 130 130 THR THR A . n A 1 131 ASP 131 131 131 ASP ASP A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 GLY 133 133 133 GLY GLY A . n A 1 134 ALA 134 134 134 ALA ALA A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 MET 136 136 136 MET MET A . n A 1 137 TYR 137 137 137 TYR TYR A . n A 1 138 PRO 138 138 138 PRO PRO A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 TYR 140 140 140 TYR TYR A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 PHE 142 142 142 PHE PHE A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 GLY 144 144 144 GLY GLY A . n A 1 145 ASP 145 145 145 ASP ASP A . n A 1 146 VAL 146 146 146 VAL VAL A . n A 1 147 GLN 147 147 147 GLN GLN A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 ASP 151 151 151 ASP ASP A . n A 1 152 ASP 152 152 152 ASP ASP A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 ILE 156 156 156 ILE ILE A . n A 1 157 GLN 157 157 157 GLN GLN A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 ARG 162 162 162 ARG ARG A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 GLN 164 164 164 GLN GLN A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 PRO 166 166 166 PRO PRO A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 GLN 168 168 168 GLN GLN A . n A 1 169 PRO 169 169 169 PRO PRO A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 170 170 ZN ZN A . C 2 ZN 1 171 171 ZN ZN A . D 3 CA 1 172 172 CA CA A . E 4 CGS 1 173 173 CGS CGS A . # _cell.entry_id 4AYK _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4AYK _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # _exptl.entry_id 4AYK _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _database_PDB_matrix.entry_id 4AYK _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _struct.entry_id 4AYK _struct.title 'CATALYTIC FRAGMENT OF HUMAN FIBROBLAST COLLAGENASE COMPLEXED WITH CGS-27023A, NMR, 30 STRUCTURES' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4AYK _struct_keywords.pdbx_keywords 'MATRIX METALLOPROTEINASE' _struct_keywords.text 'MATRIX METALLOPROTEINASE, HYDROLASE, METALLOPROTEASE, GLYCOPROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code MMP1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P03956 _struct_ref.pdbx_db_isoform ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_align_begin ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4AYK _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 169 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P03956 _struct_ref_seq.db_align_beg 101 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 269 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 169 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 910 ? 1 MORE -61 ? 1 'SSA (A^2)' 10070 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation ? _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ARG A 27 ? ASN A 43 ? ARG A 27 ASN A 43 1 ? 17 HELX_P HELX_P2 2 LEU A 112 ? SER A 123 ? LEU A 112 SER A 123 1 ? 12 HELX_P HELX_P3 3 GLN A 150 ? ILE A 159 ? GLN A 150 ILE A 159 1 ? 10 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A HIS 68 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 68 A ZN 171 1_555 ? ? ? ? ? ? ? 2.059 ? ? metalc2 metalc ? ? A GLY 76 O ? ? ? 1_555 D CA . CA ? ? A GLY 76 A CA 172 1_555 ? ? ? ? ? ? ? 3.014 ? ? metalc3 metalc ? ? A PRO 77 O ? ? ? 1_555 D CA . CA ? ? A PRO 77 A CA 172 1_555 ? ? ? ? ? ? ? 3.125 ? ? metalc4 metalc ? ? A GLY 78 O ? ? ? 1_555 D CA . CA ? ? A GLY 78 A CA 172 1_555 ? ? ? ? ? ? ? 2.996 ? ? metalc5 metalc ? ? A ASN 80 O ? ? ? 1_555 D CA . CA ? ? A ASN 80 A CA 172 1_555 ? ? ? ? ? ? ? 3.305 ? ? metalc6 metalc ? ? A HIS 83 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 83 A ZN 171 1_555 ? ? ? ? ? ? ? 2.183 ? ? metalc7 metalc ? ? A HIS 96 ND1 ? ? ? 1_555 C ZN . ZN ? ? A HIS 96 A ZN 171 1_555 ? ? ? ? ? ? ? 1.990 ? ? metalc8 metalc ? ? A ASP 98 OD2 ? ? ? 1_555 D CA . CA ? ? A ASP 98 A CA 172 1_555 ? ? ? ? ? ? ? 2.981 ? ? metalc9 metalc ? ? A GLU 101 OE2 ? ? ? 1_555 D CA . CA ? ? A GLU 101 A CA 172 1_555 ? ? ? ? ? ? ? 3.354 ? ? metalc10 metalc ? ? A HIS 118 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 118 A ZN 170 1_555 ? ? ? ? ? ? ? 2.083 ? ? metalc11 metalc ? ? A HIS 122 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 122 A ZN 170 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc12 metalc ? ? A HIS 128 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 128 A ZN 170 1_555 ? ? ? ? ? ? ? 2.038 ? ? metalc13 metalc ? ? B ZN . ZN ? ? ? 1_555 E CGS . O47 ? ? A ZN 170 A CGS 173 1_555 ? ? ? ? ? ? ? 2.090 ? ? metalc14 metalc ? ? B ZN . ZN ? ? ? 1_555 E CGS . O48 ? ? A ZN 170 A CGS 173 1_555 ? ? ? ? ? ? ? 2.071 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 119.1 ? 2 NE2 ? A HIS 68 ? A HIS 68 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 ND1 ? A HIS 96 ? A HIS 96 ? 1_555 122.1 ? 3 NE2 ? A HIS 83 ? A HIS 83 ? 1_555 ZN ? C ZN . ? A ZN 171 ? 1_555 ND1 ? A HIS 96 ? A HIS 96 ? 1_555 108.9 ? 4 O ? A GLY 76 ? A GLY 76 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 O ? A PRO 77 ? A PRO 77 ? 1_555 76.8 ? 5 O ? A GLY 76 ? A GLY 76 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 O ? A GLY 78 ? A GLY 78 ? 1_555 57.9 ? 6 O ? A PRO 77 ? A PRO 77 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 O ? A GLY 78 ? A GLY 78 ? 1_555 70.6 ? 7 O ? A GLY 76 ? A GLY 76 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 O ? A ASN 80 ? A ASN 80 ? 1_555 126.5 ? 8 O ? A PRO 77 ? A PRO 77 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 O ? A ASN 80 ? A ASN 80 ? 1_555 126.0 ? 9 O ? A GLY 78 ? A GLY 78 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 O ? A ASN 80 ? A ASN 80 ? 1_555 83.1 ? 10 O ? A GLY 76 ? A GLY 76 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OD2 ? A ASP 98 ? A ASP 98 ? 1_555 96.8 ? 11 O ? A PRO 77 ? A PRO 77 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OD2 ? A ASP 98 ? A ASP 98 ? 1_555 144.2 ? 12 O ? A GLY 78 ? A GLY 78 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OD2 ? A ASP 98 ? A ASP 98 ? 1_555 135.4 ? 13 O ? A ASN 80 ? A ASN 80 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OD2 ? A ASP 98 ? A ASP 98 ? 1_555 86.3 ? 14 O ? A GLY 76 ? A GLY 76 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OE2 ? A GLU 101 ? A GLU 101 ? 1_555 109.7 ? 15 O ? A PRO 77 ? A PRO 77 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OE2 ? A GLU 101 ? A GLU 101 ? 1_555 61.7 ? 16 O ? A GLY 78 ? A GLY 78 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OE2 ? A GLU 101 ? A GLU 101 ? 1_555 132.3 ? 17 O ? A ASN 80 ? A ASN 80 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OE2 ? A GLU 101 ? A GLU 101 ? 1_555 123.7 ? 18 OD2 ? A ASP 98 ? A ASP 98 ? 1_555 CA ? D CA . ? A CA 172 ? 1_555 OE2 ? A GLU 101 ? A GLU 101 ? 1_555 88.8 ? 19 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 ZN ? B ZN . ? A ZN 170 ? 1_555 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 84.3 ? 20 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 ZN ? B ZN . ? A ZN 170 ? 1_555 NE2 ? A HIS 128 ? A HIS 128 ? 1_555 104.6 ? 21 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? B ZN . ? A ZN 170 ? 1_555 NE2 ? A HIS 128 ? A HIS 128 ? 1_555 99.4 ? 22 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 ZN ? B ZN . ? A ZN 170 ? 1_555 O47 ? E CGS . ? A CGS 173 ? 1_555 129.8 ? 23 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? B ZN . ? A ZN 170 ? 1_555 O47 ? E CGS . ? A CGS 173 ? 1_555 136.5 ? 24 NE2 ? A HIS 128 ? A HIS 128 ? 1_555 ZN ? B ZN . ? A ZN 170 ? 1_555 O47 ? E CGS . ? A CGS 173 ? 1_555 96.6 ? 25 NE2 ? A HIS 118 ? A HIS 118 ? 1_555 ZN ? B ZN . ? A ZN 170 ? 1_555 O48 ? E CGS . ? A CGS 173 ? 1_555 75.1 ? 26 NE2 ? A HIS 122 ? A HIS 122 ? 1_555 ZN ? B ZN . ? A ZN 170 ? 1_555 O48 ? E CGS . ? A CGS 173 ? 1_555 86.8 ? 27 NE2 ? A HIS 128 ? A HIS 128 ? 1_555 ZN ? B ZN . ? A ZN 170 ? 1_555 O48 ? E CGS . ? A CGS 173 ? 1_555 173.8 ? 28 O47 ? E CGS . ? A CGS 173 ? 1_555 ZN ? B ZN . ? A ZN 170 ? 1_555 O48 ? E CGS . ? A CGS 173 ? 1_555 79.2 ? # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 48 ? LYS A 51 ? THR A 48 LYS A 51 A 2 HIS A 13 ? ILE A 18 ? HIS A 13 ILE A 18 A 3 ILE A 59 ? VAL A 64 ? ILE A 59 VAL A 64 A 4 ALA A 95 ? ASP A 98 ? ALA A 95 ASP A 98 A 5 ALA A 82 ? ALA A 84 ? ALA A 82 ALA A 84 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O THR A 48 ? O THR A 48 N LEU A 14 ? N LEU A 14 A 2 3 O ARG A 17 ? O ARG A 17 N ILE A 59 ? N ILE A 59 A 3 4 O SER A 62 ? O SER A 62 N ALA A 95 ? N ALA A 95 A 4 5 O HIS A 96 ? O HIS A 96 N HIS A 83 ? N HIS A 83 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details ZNA Author ? ? ? ? 3 'ZN BINDING SITE.' ZNB Author ? ? ? ? 3 'ZN BINDING SITE.' CAB Author ? ? ? ? 3 'CA BINDING SITE.' CGS Author ? ? ? ? 12 'CGS-27023A BINDING SITE.' AC1 Software A ZN 170 ? 4 'BINDING SITE FOR RESIDUE ZN A 170' AC2 Software A ZN 171 ? 4 'BINDING SITE FOR RESIDUE ZN A 171' AC3 Software A CA 172 ? 6 'BINDING SITE FOR RESIDUE CA A 172' AC4 Software A CGS 173 ? 12 'BINDING SITE FOR RESIDUE CGS A 173' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 ZNA 3 HIS A 118 ? HIS A 118 . ? 1_555 ? 2 ZNA 3 HIS A 122 ? HIS A 122 . ? 1_555 ? 3 ZNA 3 HIS A 128 ? HIS A 128 . ? 1_555 ? 4 ZNB 3 HIS A 68 ? HIS A 68 . ? 1_555 ? 5 ZNB 3 HIS A 83 ? HIS A 83 . ? 1_555 ? 6 ZNB 3 HIS A 96 ? HIS A 96 . ? 1_555 ? 7 CAB 3 GLY A 76 ? GLY A 76 . ? 1_555 ? 8 CAB 3 GLY A 78 ? GLY A 78 . ? 1_555 ? 9 CAB 3 ASN A 80 ? ASN A 80 . ? 1_555 ? 10 CGS 12 ASN A 80 ? ASN A 80 . ? 1_555 ? 11 CGS 12 LEU A 81 ? LEU A 81 . ? 1_555 ? 12 CGS 12 ALA A 82 ? ALA A 82 . ? 1_555 ? 13 CGS 12 HIS A 83 ? HIS A 83 . ? 1_555 ? 14 CGS 12 ARG A 114 ? ARG A 114 . ? 1_555 ? 15 CGS 12 VAL A 115 ? VAL A 115 . ? 1_555 ? 16 CGS 12 HIS A 118 ? HIS A 118 . ? 1_555 ? 17 CGS 12 GLU A 119 ? GLU A 119 . ? 1_555 ? 18 CGS 12 LEU A 135 ? LEU A 135 . ? 1_555 ? 19 CGS 12 PRO A 138 ? PRO A 138 . ? 1_555 ? 20 CGS 12 TYR A 137 ? TYR A 137 . ? 1_555 ? 21 CGS 12 SER A 139 ? SER A 139 . ? 1_555 ? 22 AC1 4 HIS A 118 ? HIS A 118 . ? 1_555 ? 23 AC1 4 HIS A 122 ? HIS A 122 . ? 1_555 ? 24 AC1 4 HIS A 128 ? HIS A 128 . ? 1_555 ? 25 AC1 4 CGS E . ? CGS A 173 . ? 1_555 ? 26 AC2 4 VAL A 64 ? VAL A 64 . ? 1_555 ? 27 AC2 4 HIS A 68 ? HIS A 68 . ? 1_555 ? 28 AC2 4 HIS A 83 ? HIS A 83 . ? 1_555 ? 29 AC2 4 HIS A 96 ? HIS A 96 . ? 1_555 ? 30 AC3 6 GLY A 76 ? GLY A 76 . ? 1_555 ? 31 AC3 6 PRO A 77 ? PRO A 77 . ? 1_555 ? 32 AC3 6 GLY A 78 ? GLY A 78 . ? 1_555 ? 33 AC3 6 ASN A 80 ? ASN A 80 . ? 1_555 ? 34 AC3 6 ASP A 98 ? ASP A 98 . ? 1_555 ? 35 AC3 6 GLU A 101 ? GLU A 101 . ? 1_555 ? 36 AC4 12 ASN A 80 ? ASN A 80 . ? 1_555 ? 37 AC4 12 LEU A 81 ? LEU A 81 . ? 1_555 ? 38 AC4 12 ALA A 82 ? ALA A 82 . ? 1_555 ? 39 AC4 12 ARG A 114 ? ARG A 114 . ? 1_555 ? 40 AC4 12 HIS A 118 ? HIS A 118 . ? 1_555 ? 41 AC4 12 HIS A 122 ? HIS A 122 . ? 1_555 ? 42 AC4 12 HIS A 128 ? HIS A 128 . ? 1_555 ? 43 AC4 12 TYR A 137 ? TYR A 137 . ? 1_555 ? 44 AC4 12 PRO A 138 ? PRO A 138 . ? 1_555 ? 45 AC4 12 SER A 139 ? SER A 139 . ? 1_555 ? 46 AC4 12 TYR A 140 ? TYR A 140 . ? 1_555 ? 47 AC4 12 ZN B . ? ZN A 170 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 ZN A ZN 170 ? ? H50 A CGS 173 ? ? 1.21 2 2 O A TRP 41 ? ? HG1 A THR 45 ? ? 1.58 3 3 HG1 A THR 104 ? ? O A TYR 110 ? ? 1.46 4 3 O A ARG 27 ? ? H A ASP 31 ? ? 1.51 5 4 O A TRP 41 ? ? HG1 A THR 45 ? ? 1.60 6 5 HD1 A HIS 13 ? ? OG1 A THR 48 ? ? 1.51 7 5 O A HIS 32 ? ? H A LYS 36 ? ? 1.59 8 6 ZN A ZN 170 ? ? H50 A CGS 173 ? ? 1.33 9 6 O A ASP 31 ? ? H A GLU 35 ? ? 1.58 10 7 ZN A ZN 170 ? ? H50 A CGS 173 ? ? 1.27 11 7 HH22 A ARG 114 ? ? HH A TYR 140 ? ? 1.31 12 8 HG1 A THR 104 ? ? O A TYR 110 ? ? 1.45 13 8 OD1 A ASP 98 ? ? H A ASP 100 ? ? 1.57 14 12 HD1 A HIS 13 ? ? OG1 A THR 48 ? ? 1.42 15 12 HE1 A TRP 9 ? ? O A SER 123 ? ? 1.54 16 12 ZN A ZN 170 ? ? H50 A CGS 173 ? ? 1.55 17 13 O A ASP 98 ? ? HE1 A TRP 103 ? ? 1.55 18 13 OD1 A ASP 98 ? ? H A ASP 100 ? ? 1.57 19 13 HE A ARG 17 ? ? O A VAL 52 ? ? 1.58 20 14 HD21 A ASN 20 ? ? H A TYR 21 ? ? 1.28 21 14 ZN A ZN 170 ? ? H50 A CGS 173 ? ? 1.57 22 14 HE A ARG 17 ? ? O A VAL 52 ? ? 1.59 23 15 HD22 A ASN 106 ? ? HE A ARG 108 ? ? 1.26 24 15 O A SER 163 ? ? H A ASN 165 ? ? 1.54 25 15 OD1 A ASP 131 ? ? H A GLY 133 ? ? 1.55 26 15 O A LEU 135 ? ? H A TYR 137 ? ? 1.59 27 16 O A HIS 32 ? ? H A LYS 36 ? ? 1.58 28 18 OD1 A ASP 98 ? ? H A ASP 100 ? ? 1.48 29 18 O A HIS 32 ? ? H A LYS 36 ? ? 1.59 30 19 OD1 A ASP 98 ? ? H A ASP 100 ? ? 1.51 31 19 HG1 A THR 104 ? ? O A TYR 110 ? ? 1.52 32 20 HD22 A ASN 80 ? ? O A ALA 82 ? ? 1.47 33 20 O A ARG 27 ? ? H A ASP 31 ? ? 1.53 34 20 O A ASP 98 ? ? HE1 A TRP 103 ? ? 1.56 35 21 ZN A ZN 170 ? ? H50 A CGS 173 ? ? 1.54 36 21 O A HIS 32 ? ? H A LYS 36 ? ? 1.58 37 22 HD22 A ASN 106 ? ? HE A ARG 108 ? ? 1.24 38 22 HD1 A HIS 13 ? ? HG1 A THR 48 ? ? 1.30 39 22 HD1 A HIS 13 ? ? OG1 A THR 48 ? ? 1.42 40 22 OD1 A ASP 98 ? ? H A ASP 100 ? ? 1.60 41 23 O A HIS 32 ? ? H A LYS 36 ? ? 1.59 42 24 HD1 A HIS 13 ? ? OG1 A THR 48 ? ? 1.58 43 25 ZN A ZN 170 ? ? H50 A CGS 173 ? ? 1.35 44 25 OD1 A ASP 98 ? ? H A ASP 100 ? ? 1.59 45 26 HD22 A ASN 80 ? ? O A ALA 82 ? ? 1.53 46 27 HG1 A THR 104 ? ? O A TYR 110 ? ? 1.49 47 27 O A HIS 32 ? ? H A LYS 36 ? ? 1.53 48 27 O A ASP 31 ? ? H A GLU 35 ? ? 1.58 49 28 HE A ARG 114 ? ? OG A SER 143 ? ? 1.45 50 29 ZN A ZN 170 ? ? H50 A CGS 173 ? ? 1.37 51 29 O A PRO 138 ? ? HG A SER 139 ? ? 1.60 52 30 O A TRP 41 ? ? HG1 A THR 45 ? ? 1.47 53 30 OD1 A ASP 98 ? ? H A ASP 100 ? ? 1.60 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 6 ? ? -150.19 66.61 2 1 PRO A 26 ? ? -63.88 -170.97 3 1 ASP A 75 ? ? -108.01 65.50 4 1 PRO A 77 ? ? -57.97 -8.52 5 1 PHE A 107 ? ? -83.00 31.76 6 1 ARG A 108 ? ? -75.91 -157.78 7 1 MET A 136 ? ? -71.44 45.58 8 1 PRO A 138 ? ? -48.57 -71.14 9 1 TYR A 160 ? ? -99.56 -64.86 10 1 GLN A 164 ? ? -76.57 33.69 11 1 ASN A 165 ? ? -154.46 72.75 12 2 LEU A 2 ? ? -56.66 -82.43 13 2 PRO A 89 ? ? -61.94 -169.62 14 2 ARG A 108 ? ? -76.16 -159.57 15 2 PRO A 138 ? ? -61.91 4.63 16 2 SER A 143 ? ? -176.56 122.43 17 2 TYR A 160 ? ? -95.31 -69.96 18 2 GLN A 164 ? ? -77.07 34.52 19 2 ASN A 165 ? ? -152.35 73.91 20 3 ASN A 6 ? ? -151.92 72.81 21 3 PRO A 7 ? ? -59.76 107.84 22 3 PRO A 26 ? ? -65.68 -175.93 23 3 ASP A 75 ? ? -106.27 70.75 24 3 PHE A 107 ? ? -84.89 32.01 25 3 ARG A 108 ? ? -76.14 -161.66 26 3 SER A 143 ? ? -90.02 -73.04 27 3 TYR A 160 ? ? -100.66 -67.79 28 3 ASN A 165 ? ? -155.02 83.19 29 4 PRO A 26 ? ? -59.69 -175.53 30 4 PRO A 77 ? ? -58.42 -5.15 31 4 PRO A 87 ? ? -58.01 104.85 32 4 PHE A 107 ? ? -81.11 33.38 33 4 ARG A 108 ? ? -76.58 -165.91 34 4 MET A 136 ? ? -72.31 44.95 35 4 TYR A 160 ? ? -97.35 -64.25 36 5 PRO A 7 ? ? -62.74 93.65 37 5 PRO A 26 ? ? -60.46 -174.77 38 5 PRO A 87 ? ? -56.44 102.14 39 5 PHE A 107 ? ? -59.97 10.35 40 5 GLU A 109 ? ? -4.89 -76.90 41 5 MET A 136 ? ? -79.02 40.11 42 5 TYR A 160 ? ? -98.52 -67.84 43 6 PRO A 26 ? ? -62.31 -171.77 44 6 ASP A 75 ? ? -103.23 67.42 45 6 ILE A 91 ? ? -50.14 -8.76 46 6 PHE A 107 ? ? -72.74 22.19 47 6 ARG A 108 ? ? -76.66 -163.65 48 6 GLU A 109 ? ? -25.20 -67.61 49 6 MET A 136 ? ? -74.42 47.76 50 6 TYR A 160 ? ? -101.08 -67.79 51 6 ASN A 165 ? ? -157.21 74.51 52 6 PRO A 166 ? ? -83.82 40.95 53 7 THR A 3 ? ? -99.27 -138.87 54 7 PRO A 26 ? ? -66.26 -176.56 55 7 ASP A 75 ? ? -110.36 67.88 56 7 HIS A 83 ? ? -162.50 114.99 57 7 PRO A 89 ? ? -62.67 -173.32 58 7 ARG A 108 ? ? -76.56 -163.56 59 7 MET A 136 ? ? -72.44 48.84 60 7 PRO A 138 ? ? -68.63 18.81 61 7 TYR A 160 ? ? -97.98 -74.02 62 8 PRO A 7 ? ? -67.80 -178.45 63 8 PRO A 26 ? ? -65.58 -177.51 64 8 ASP A 75 ? ? -102.94 62.33 65 8 PRO A 87 ? ? -58.69 103.12 66 8 PHE A 107 ? ? -80.25 31.53 67 8 ARG A 108 ? ? -76.82 -165.09 68 8 PRO A 138 ? ? -57.46 5.19 69 8 TYR A 160 ? ? -97.28 -67.60 70 8 ASN A 165 ? ? -157.91 -37.03 71 9 PRO A 26 ? ? -56.68 -178.80 72 9 ASP A 75 ? ? -108.39 72.67 73 9 PRO A 89 ? ? -66.96 -177.55 74 9 PHE A 107 ? ? -81.04 30.81 75 9 PRO A 138 ? ? -63.33 7.23 76 9 TYR A 160 ? ? -101.23 -61.26 77 10 ASN A 6 ? ? -153.46 72.34 78 10 PRO A 26 ? ? -58.65 -178.72 79 10 ASP A 75 ? ? -117.83 75.76 80 10 PRO A 87 ? ? -59.16 104.22 81 10 PRO A 89 ? ? -65.30 -175.63 82 10 ARG A 108 ? ? -73.70 -169.42 83 10 PRO A 138 ? ? -53.80 -3.90 84 10 THR A 141 ? ? -155.12 8.99 85 10 TYR A 160 ? ? -99.84 -63.08 86 10 ASN A 165 ? ? -156.63 76.44 87 11 ASN A 6 ? ? -152.87 70.05 88 11 PRO A 26 ? ? -62.35 -177.34 89 11 ASP A 75 ? ? -103.54 62.07 90 11 PRO A 89 ? ? -57.14 -172.27 91 11 ARG A 108 ? ? -76.11 -159.69 92 11 TYR A 160 ? ? -100.30 -60.68 93 11 GLN A 164 ? ? -63.44 76.53 94 12 PRO A 7 ? ? -53.94 -175.41 95 12 PRO A 26 ? ? -56.86 -176.65 96 12 HIS A 83 ? ? -161.63 116.92 97 12 PRO A 87 ? ? -57.58 104.37 98 12 PHE A 107 ? ? -71.12 22.39 99 12 ARG A 108 ? ? -75.80 -160.39 100 12 GLU A 109 ? ? -31.77 -78.09 101 12 TYR A 160 ? ? -97.50 -67.74 102 12 ASN A 165 ? ? -151.68 73.39 103 12 PRO A 166 ? ? -80.29 35.35 104 13 ASN A 6 ? ? -155.55 77.09 105 13 PRO A 26 ? ? -54.01 178.15 106 13 PRO A 46 ? ? -69.27 7.66 107 13 ASP A 75 ? ? -109.49 75.04 108 13 ARG A 108 ? ? -76.67 -164.07 109 13 MET A 136 ? ? -72.37 46.29 110 13 TYR A 160 ? ? -95.86 -67.48 111 14 ASN A 6 ? ? -152.18 76.66 112 14 PRO A 7 ? ? -54.48 -166.53 113 14 PRO A 26 ? ? -61.44 -178.76 114 14 PRO A 46 ? ? -66.49 5.68 115 14 ASP A 75 ? ? -104.71 66.49 116 14 PRO A 77 ? ? -53.76 -9.47 117 14 PRO A 87 ? ? -59.49 103.64 118 14 PRO A 89 ? ? -66.10 -177.95 119 14 PHE A 107 ? ? -80.87 32.05 120 14 ARG A 108 ? ? -76.01 -163.80 121 14 PRO A 138 ? ? -63.85 14.45 122 14 TYR A 160 ? ? -99.51 -65.31 123 14 GLN A 164 ? ? -81.26 34.53 124 14 ASN A 165 ? ? -154.16 75.53 125 15 PRO A 7 ? ? -58.69 -168.29 126 15 PRO A 26 ? ? -67.83 -173.34 127 15 PRO A 46 ? ? -69.58 7.81 128 15 ASP A 75 ? ? -104.69 67.85 129 15 PHE A 107 ? ? -83.01 31.69 130 15 ARG A 108 ? ? -76.34 -162.70 131 15 SER A 143 ? ? -88.32 -75.40 132 15 TYR A 160 ? ? -98.95 -61.33 133 15 SER A 163 ? ? -69.83 92.70 134 15 GLN A 164 ? ? -63.19 34.24 135 15 ASN A 165 ? ? -153.19 74.02 136 16 ASN A 6 ? ? -150.69 87.53 137 16 PRO A 87 ? ? -42.92 109.86 138 16 ILE A 91 ? ? -57.64 -9.59 139 16 PHE A 107 ? ? -84.54 33.87 140 16 ARG A 108 ? ? -76.76 -162.46 141 16 MET A 136 ? ? -70.54 35.86 142 16 TYR A 160 ? ? -98.08 -66.84 143 16 ASN A 165 ? ? -156.69 -34.87 144 17 LEU A 2 ? ? -152.41 66.05 145 17 PRO A 26 ? ? -60.69 -179.95 146 17 PRO A 46 ? ? -69.68 9.33 147 17 PRO A 87 ? ? -59.17 106.87 148 17 ARG A 108 ? ? -75.83 -165.73 149 17 GLU A 109 ? ? -11.16 -69.59 150 17 PRO A 138 ? ? -47.98 -71.90 151 17 THR A 141 ? ? -148.60 -141.91 152 17 TYR A 160 ? ? -97.02 -64.30 153 17 ASN A 165 ? ? -156.59 -35.01 154 17 PRO A 166 ? ? -80.41 48.59 155 18 PRO A 7 ? ? -62.35 -171.20 156 18 PRO A 26 ? ? -61.83 -177.77 157 18 PRO A 46 ? ? -69.32 4.82 158 18 ASP A 75 ? ? -102.23 68.40 159 18 HIS A 83 ? ? -161.96 117.34 160 18 PHE A 107 ? ? -90.70 32.69 161 18 ARG A 108 ? ? -75.57 -156.07 162 18 MET A 136 ? ? -73.17 46.98 163 18 TYR A 160 ? ? -98.10 -72.77 164 19 PRO A 26 ? ? -63.71 -178.70 165 19 PRO A 46 ? ? -68.12 5.30 166 19 PHE A 107 ? ? -84.31 33.87 167 19 ARG A 108 ? ? -76.57 -163.37 168 19 TYR A 160 ? ? -96.96 -71.01 169 19 ASN A 165 ? ? -154.50 75.48 170 20 PRO A 26 ? ? -66.03 -176.96 171 20 PRO A 46 ? ? -69.69 9.12 172 20 PHE A 107 ? ? -73.72 25.68 173 20 ARG A 108 ? ? -76.10 -168.06 174 20 PRO A 138 ? ? -65.84 4.03 175 20 TYR A 160 ? ? -96.51 -69.29 176 20 GLN A 164 ? ? -82.51 33.67 177 20 ASN A 165 ? ? -153.45 72.61 178 21 PRO A 26 ? ? -58.47 -177.94 179 21 ASP A 75 ? ? -105.05 70.33 180 21 PHE A 107 ? ? -92.66 34.04 181 21 ARG A 108 ? ? -76.23 -164.32 182 21 PRO A 138 ? ? -63.17 9.25 183 21 TYR A 160 ? ? -99.48 -62.20 184 21 ASN A 165 ? ? -156.33 78.91 185 21 PRO A 166 ? ? -80.46 41.02 186 22 ASN A 6 ? ? -154.37 69.45 187 22 PRO A 26 ? ? -62.94 -175.27 188 22 PRO A 87 ? ? -54.92 104.59 189 22 PRO A 89 ? ? -63.68 -179.76 190 22 PHE A 107 ? ? -80.68 31.58 191 22 ARG A 108 ? ? -74.57 -166.62 192 22 PRO A 138 ? ? -52.11 -1.43 193 22 TYR A 160 ? ? -97.84 -73.69 194 22 GLN A 164 ? ? -94.94 34.51 195 22 PRO A 166 ? ? -83.17 49.11 196 23 ASN A 6 ? ? -150.25 67.82 197 23 PRO A 26 ? ? -66.14 -175.92 198 23 PRO A 77 ? ? -53.05 -8.97 199 23 PHE A 107 ? ? -81.77 30.85 200 23 ARG A 108 ? ? -76.28 -164.36 201 23 PRO A 138 ? ? -62.83 7.09 202 23 TYR A 160 ? ? -96.77 -67.82 203 23 GLN A 164 ? ? -81.37 34.14 204 23 ASN A 165 ? ? -151.76 72.19 205 23 PRO A 166 ? ? -81.76 46.94 206 24 PRO A 26 ? ? -61.75 -175.07 207 24 PRO A 46 ? ? -68.93 8.15 208 24 ASP A 75 ? ? -101.76 60.24 209 24 PRO A 87 ? ? -53.22 104.25 210 24 ARG A 108 ? ? -76.71 -161.45 211 24 GLU A 109 ? ? -24.42 -68.70 212 24 MET A 136 ? ? -74.18 45.16 213 24 TYR A 160 ? ? -93.28 -70.10 214 24 ASN A 165 ? ? -153.83 75.28 215 24 PRO A 166 ? ? -82.57 47.37 216 25 PRO A 26 ? ? -63.69 -171.35 217 25 PRO A 46 ? ? -69.62 2.73 218 25 ARG A 108 ? ? -76.47 -167.85 219 25 GLU A 109 ? ? -4.51 -87.42 220 25 PRO A 138 ? ? -53.32 -1.99 221 25 TYR A 160 ? ? -98.33 -65.41 222 25 PRO A 166 ? ? -79.92 41.99 223 26 THR A 3 ? ? -145.61 -152.46 224 26 PRO A 7 ? ? -69.05 -171.24 225 26 PRO A 26 ? ? -62.05 -174.01 226 26 PRO A 46 ? ? -69.90 2.99 227 26 ASP A 75 ? ? -101.88 65.38 228 26 PRO A 87 ? ? -58.14 103.99 229 26 PRO A 89 ? ? -67.68 -178.42 230 26 ARG A 108 ? ? -75.84 -158.23 231 26 PRO A 138 ? ? -64.85 10.22 232 26 SER A 143 ? ? -147.32 -1.83 233 26 TYR A 160 ? ? -96.60 -73.78 234 26 GLN A 164 ? ? -93.55 35.44 235 27 THR A 3 ? ? -142.26 -150.14 236 27 PRO A 26 ? ? -59.61 -179.99 237 27 ASP A 75 ? ? -100.86 61.04 238 27 PRO A 87 ? ? -55.99 108.45 239 27 PHE A 107 ? ? -79.93 30.64 240 27 ARG A 108 ? ? -76.63 -164.48 241 27 MET A 136 ? ? -74.11 44.43 242 27 TYR A 160 ? ? -97.57 -69.98 243 27 GLN A 164 ? ? -80.87 35.14 244 28 PRO A 7 ? ? -68.99 -178.62 245 28 PRO A 26 ? ? -62.94 -177.04 246 28 PRO A 46 ? ? -67.99 8.88 247 28 ASP A 75 ? ? -110.74 74.28 248 28 PHE A 107 ? ? -79.72 34.73 249 28 ARG A 108 ? ? -76.85 -165.06 250 28 MET A 136 ? ? -73.21 38.63 251 28 TYR A 160 ? ? -100.47 -61.04 252 28 GLN A 164 ? ? -91.37 34.97 253 29 ASN A 6 ? ? -153.45 83.52 254 29 ARG A 108 ? ? -76.47 -157.14 255 29 GLU A 109 ? ? -24.31 -65.40 256 29 PRO A 138 ? ? -51.11 -2.10 257 29 TYR A 160 ? ? -101.41 -64.91 258 30 PRO A 26 ? ? -60.13 -175.44 259 30 ASP A 75 ? ? -102.42 65.63 260 30 PRO A 87 ? ? -68.09 96.50 261 30 PRO A 89 ? ? -65.10 -174.10 262 30 PHE A 107 ? ? -81.11 34.24 263 30 ARG A 108 ? ? -76.77 -166.32 264 30 MET A 136 ? ? -75.72 45.39 265 30 TYR A 160 ? ? -96.10 -70.90 # _pdbx_nmr_ensemble.entry_id 4AYK _pdbx_nmr_ensemble.conformers_calculated_total_number 100 _pdbx_nmr_ensemble.conformers_submitted_total_number 30 _pdbx_nmr_ensemble.conformer_selection_criteria 'LOWEST ENERGY, LOWEST VIOLATIONS, CONSISTENT FOLD' _pdbx_nmr_ensemble.average_constraints_per_residue ? _pdbx_nmr_ensemble.average_constraint_violations_per_residue ? _pdbx_nmr_ensemble.maximum_distance_constraint_violation ? _pdbx_nmr_ensemble.average_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_upper_distance_constraint_violation ? _pdbx_nmr_ensemble.maximum_lower_distance_constraint_violation ? _pdbx_nmr_ensemble.distance_constraint_violation_method ? _pdbx_nmr_ensemble.maximum_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.average_torsion_angle_constraint_violation ? _pdbx_nmr_ensemble.torsion_angle_constraint_violation_method ? # _pdbx_nmr_exptl_sample_conditions.conditions_id 1 _pdbx_nmr_exptl_sample_conditions.temperature 308.00 _pdbx_nmr_exptl_sample_conditions.pressure 1 _pdbx_nmr_exptl_sample_conditions.pH 6.50 _pdbx_nmr_exptl_sample_conditions.ionic_strength ? _pdbx_nmr_exptl_sample_conditions.pressure_units atm _pdbx_nmr_exptl_sample_conditions.temperature_units K # loop_ _pdbx_nmr_exptl.experiment_id _pdbx_nmr_exptl.conditions_id _pdbx_nmr_exptl.type _pdbx_nmr_exptl.solution_id 1 1 NOESY 1 2 1 COSY 1 3 1 TOCSY 1 4 1 TRIPLE-RESONANCE 1 5 1 ETC. 1 # _pdbx_nmr_details.entry_id 4AYK _pdbx_nmr_details.text 'THE STRUCTURE WAS DETERMINED USING TRIPLE-RESONANCE NMR SPECTROSCOPY ON 13C, 15N-LABELED MMP-1.' # _pdbx_nmr_refine.entry_id 4AYK _pdbx_nmr_refine.method 'HYBRID DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING METHOD' _pdbx_nmr_refine.details 'REFINEMENT DETAILS CAN BE FOUND IN THE JRNL CITATION ABOVE.' _pdbx_nmr_refine.software_ordinal 1 # loop_ _pdbx_nmr_software.classification _pdbx_nmr_software.name _pdbx_nmr_software.version _pdbx_nmr_software.authors _pdbx_nmr_software.ordinal refinement X-PLOR 3.84 BRUNGER 1 'structure solution' X-PLOR ? ? 2 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CGS N1 N N N 75 CGS CC C N N 76 CGS CA C N R 77 CGS S4 S N N 78 CGS C5 C Y N 79 CGS CD C Y N 80 CGS CE C Y N 81 CGS CZ C Y N 82 CGS N11 N Y N 83 CGS CY C Y N 84 CGS C17 C Y N 85 CGS CE2 C Y N 86 CGS CD2 C Y N 87 CGS C20 C Y N 88 CGS CD1 C Y N 89 CGS CE1 C Y N 90 CGS O27 O N N 91 CGS COM C N N 92 CGS O32 O N N 93 CGS O33 O N N 94 CGS C34 C N N 95 CGS N35 N N N 96 CGS CB C N N 97 CGS CG2 C N N 98 CGS CG1 C N N 99 CGS O47 O N N 100 CGS O48 O N N 101 CGS HC1 H N N 102 CGS HC2 H N N 103 CGS HA H N N 104 CGS HD H N N 105 CGS HE H N N 106 CGS HZ H N N 107 CGS HY H N N 108 CGS HE2 H N N 109 CGS HD2 H N N 110 CGS HD1 H N N 111 CGS HE1 H N N 112 CGS HOM1 H N N 113 CGS HOM2 H N N 114 CGS HOM3 H N N 115 CGS H49 H N N 116 CGS HB H N N 117 CGS HG21 H N N 118 CGS HG22 H N N 119 CGS HG23 H N N 120 CGS HG11 H N N 121 CGS HG12 H N N 122 CGS HG13 H N N 123 CGS H50 H N N 124 GLN N N N N 125 GLN CA C N S 126 GLN C C N N 127 GLN O O N N 128 GLN CB C N N 129 GLN CG C N N 130 GLN CD C N N 131 GLN OE1 O N N 132 GLN NE2 N N N 133 GLN OXT O N N 134 GLN H H N N 135 GLN H2 H N N 136 GLN HA H N N 137 GLN HB2 H N N 138 GLN HB3 H N N 139 GLN HG2 H N N 140 GLN HG3 H N N 141 GLN HE21 H N N 142 GLN HE22 H N N 143 GLN HXT H N N 144 GLU N N N N 145 GLU CA C N S 146 GLU C C N N 147 GLU O O N N 148 GLU CB C N N 149 GLU CG C N N 150 GLU CD C N N 151 GLU OE1 O N N 152 GLU OE2 O N N 153 GLU OXT O N N 154 GLU H H N N 155 GLU H2 H N N 156 GLU HA H N N 157 GLU HB2 H N N 158 GLU HB3 H N N 159 GLU HG2 H N N 160 GLU HG3 H N N 161 GLU HE2 H N N 162 GLU HXT H N N 163 GLY N N N N 164 GLY CA C N N 165 GLY C C N N 166 GLY O O N N 167 GLY OXT O N N 168 GLY H H N N 169 GLY H2 H N N 170 GLY HA2 H N N 171 GLY HA3 H N N 172 GLY HXT H N N 173 HIS N N N N 174 HIS CA C N S 175 HIS C C N N 176 HIS O O N N 177 HIS CB C N N 178 HIS CG C Y N 179 HIS ND1 N Y N 180 HIS CD2 C Y N 181 HIS CE1 C Y N 182 HIS NE2 N Y N 183 HIS OXT O N N 184 HIS H H N N 185 HIS H2 H N N 186 HIS HA H N N 187 HIS HB2 H N N 188 HIS HB3 H N N 189 HIS HD1 H N N 190 HIS HD2 H N N 191 HIS HE1 H N N 192 HIS HE2 H N N 193 HIS HXT H N N 194 ILE N N N N 195 ILE CA C N S 196 ILE C C N N 197 ILE O O N N 198 ILE CB C N S 199 ILE CG1 C N N 200 ILE CG2 C N N 201 ILE CD1 C N N 202 ILE OXT O N N 203 ILE H H N N 204 ILE H2 H N N 205 ILE HA H N N 206 ILE HB H N N 207 ILE HG12 H N N 208 ILE HG13 H N N 209 ILE HG21 H N N 210 ILE HG22 H N N 211 ILE HG23 H N N 212 ILE HD11 H N N 213 ILE HD12 H N N 214 ILE HD13 H N N 215 ILE HXT H N N 216 LEU N N N N 217 LEU CA C N S 218 LEU C C N N 219 LEU O O N N 220 LEU CB C N N 221 LEU CG C N N 222 LEU CD1 C N N 223 LEU CD2 C N N 224 LEU OXT O N N 225 LEU H H N N 226 LEU H2 H N N 227 LEU HA H N N 228 LEU HB2 H N N 229 LEU HB3 H N N 230 LEU HG H N N 231 LEU HD11 H N N 232 LEU HD12 H N N 233 LEU HD13 H N N 234 LEU HD21 H N N 235 LEU HD22 H N N 236 LEU HD23 H N N 237 LEU HXT H N N 238 LYS N N N N 239 LYS CA C N S 240 LYS C C N N 241 LYS O O N N 242 LYS CB C N N 243 LYS CG C N N 244 LYS CD C N N 245 LYS CE C N N 246 LYS NZ N N N 247 LYS OXT O N N 248 LYS H H N N 249 LYS H2 H N N 250 LYS HA H N N 251 LYS HB2 H N N 252 LYS HB3 H N N 253 LYS HG2 H N N 254 LYS HG3 H N N 255 LYS HD2 H N N 256 LYS HD3 H N N 257 LYS HE2 H N N 258 LYS HE3 H N N 259 LYS HZ1 H N N 260 LYS HZ2 H N N 261 LYS HZ3 H N N 262 LYS HXT H N N 263 MET N N N N 264 MET CA C N S 265 MET C C N N 266 MET O O N N 267 MET CB C N N 268 MET CG C N N 269 MET SD S N N 270 MET CE C N N 271 MET OXT O N N 272 MET H H N N 273 MET H2 H N N 274 MET HA H N N 275 MET HB2 H N N 276 MET HB3 H N N 277 MET HG2 H N N 278 MET HG3 H N N 279 MET HE1 H N N 280 MET HE2 H N N 281 MET HE3 H N N 282 MET HXT H N N 283 PHE N N N N 284 PHE CA C N S 285 PHE C C N N 286 PHE O O N N 287 PHE CB C N N 288 PHE CG C Y N 289 PHE CD1 C Y N 290 PHE CD2 C Y N 291 PHE CE1 C Y N 292 PHE CE2 C Y N 293 PHE CZ C Y N 294 PHE OXT O N N 295 PHE H H N N 296 PHE H2 H N N 297 PHE HA H N N 298 PHE HB2 H N N 299 PHE HB3 H N N 300 PHE HD1 H N N 301 PHE HD2 H N N 302 PHE HE1 H N N 303 PHE HE2 H N N 304 PHE HZ H N N 305 PHE HXT H N N 306 PRO N N N N 307 PRO CA C N S 308 PRO C C N N 309 PRO O O N N 310 PRO CB C N N 311 PRO CG C N N 312 PRO CD C N N 313 PRO OXT O N N 314 PRO H H N N 315 PRO HA H N N 316 PRO HB2 H N N 317 PRO HB3 H N N 318 PRO HG2 H N N 319 PRO HG3 H N N 320 PRO HD2 H N N 321 PRO HD3 H N N 322 PRO HXT H N N 323 SER N N N N 324 SER CA C N S 325 SER C C N N 326 SER O O N N 327 SER CB C N N 328 SER OG O N N 329 SER OXT O N N 330 SER H H N N 331 SER H2 H N N 332 SER HA H N N 333 SER HB2 H N N 334 SER HB3 H N N 335 SER HG H N N 336 SER HXT H N N 337 THR N N N N 338 THR CA C N S 339 THR C C N N 340 THR O O N N 341 THR CB C N R 342 THR OG1 O N N 343 THR CG2 C N N 344 THR OXT O N N 345 THR H H N N 346 THR H2 H N N 347 THR HA H N N 348 THR HB H N N 349 THR HG1 H N N 350 THR HG21 H N N 351 THR HG22 H N N 352 THR HG23 H N N 353 THR HXT H N N 354 TRP N N N N 355 TRP CA C N S 356 TRP C C N N 357 TRP O O N N 358 TRP CB C N N 359 TRP CG C Y N 360 TRP CD1 C Y N 361 TRP CD2 C Y N 362 TRP NE1 N Y N 363 TRP CE2 C Y N 364 TRP CE3 C Y N 365 TRP CZ2 C Y N 366 TRP CZ3 C Y N 367 TRP CH2 C Y N 368 TRP OXT O N N 369 TRP H H N N 370 TRP H2 H N N 371 TRP HA H N N 372 TRP HB2 H N N 373 TRP HB3 H N N 374 TRP HD1 H N N 375 TRP HE1 H N N 376 TRP HE3 H N N 377 TRP HZ2 H N N 378 TRP HZ3 H N N 379 TRP HH2 H N N 380 TRP HXT H N N 381 TYR N N N N 382 TYR CA C N S 383 TYR C C N N 384 TYR O O N N 385 TYR CB C N N 386 TYR CG C Y N 387 TYR CD1 C Y N 388 TYR CD2 C Y N 389 TYR CE1 C Y N 390 TYR CE2 C Y N 391 TYR CZ C Y N 392 TYR OH O N N 393 TYR OXT O N N 394 TYR H H N N 395 TYR H2 H N N 396 TYR HA H N N 397 TYR HB2 H N N 398 TYR HB3 H N N 399 TYR HD1 H N N 400 TYR HD2 H N N 401 TYR HE1 H N N 402 TYR HE2 H N N 403 TYR HH H N N 404 TYR HXT H N N 405 VAL N N N N 406 VAL CA C N S 407 VAL C C N N 408 VAL O O N N 409 VAL CB C N N 410 VAL CG1 C N N 411 VAL CG2 C N N 412 VAL OXT O N N 413 VAL H H N N 414 VAL H2 H N N 415 VAL HA H N N 416 VAL HB H N N 417 VAL HG11 H N N 418 VAL HG12 H N N 419 VAL HG13 H N N 420 VAL HG21 H N N 421 VAL HG22 H N N 422 VAL HG23 H N N 423 VAL HXT H N N 424 ZN ZN ZN N N 425 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CGS N1 CC sing N N 70 CGS N1 CA sing N N 71 CGS N1 S4 sing N N 72 CGS CC C5 sing N N 73 CGS CC HC1 sing N N 74 CGS CC HC2 sing N N 75 CGS CA C34 sing N N 76 CGS CA CB sing N N 77 CGS CA HA sing N N 78 CGS S4 C17 sing N N 79 CGS S4 O32 doub N N 80 CGS S4 O33 doub N N 81 CGS C5 CD doub Y N 82 CGS C5 CY sing Y N 83 CGS CD CE sing Y N 84 CGS CD HD sing N N 85 CGS CE CZ doub Y N 86 CGS CE HE sing N N 87 CGS CZ N11 sing Y N 88 CGS CZ HZ sing N N 89 CGS N11 CY doub Y N 90 CGS CY HY sing N N 91 CGS C17 CE2 doub Y N 92 CGS C17 CE1 sing Y N 93 CGS CE2 CD2 sing Y N 94 CGS CE2 HE2 sing N N 95 CGS CD2 C20 doub Y N 96 CGS CD2 HD2 sing N N 97 CGS C20 CD1 sing Y N 98 CGS C20 O27 sing N N 99 CGS CD1 CE1 doub Y N 100 CGS CD1 HD1 sing N N 101 CGS CE1 HE1 sing N N 102 CGS O27 COM sing N N 103 CGS COM HOM1 sing N N 104 CGS COM HOM2 sing N N 105 CGS COM HOM3 sing N N 106 CGS C34 N35 sing N N 107 CGS C34 O47 doub N N 108 CGS N35 O48 sing N N 109 CGS N35 H49 sing N N 110 CGS CB CG2 sing N N 111 CGS CB CG1 sing N N 112 CGS CB HB sing N N 113 CGS CG2 HG21 sing N N 114 CGS CG2 HG22 sing N N 115 CGS CG2 HG23 sing N N 116 CGS CG1 HG11 sing N N 117 CGS CG1 HG12 sing N N 118 CGS CG1 HG13 sing N N 119 CGS O48 H50 sing N N 120 GLN N CA sing N N 121 GLN N H sing N N 122 GLN N H2 sing N N 123 GLN CA C sing N N 124 GLN CA CB sing N N 125 GLN CA HA sing N N 126 GLN C O doub N N 127 GLN C OXT sing N N 128 GLN CB CG sing N N 129 GLN CB HB2 sing N N 130 GLN CB HB3 sing N N 131 GLN CG CD sing N N 132 GLN CG HG2 sing N N 133 GLN CG HG3 sing N N 134 GLN CD OE1 doub N N 135 GLN CD NE2 sing N N 136 GLN NE2 HE21 sing N N 137 GLN NE2 HE22 sing N N 138 GLN OXT HXT sing N N 139 GLU N CA sing N N 140 GLU N H sing N N 141 GLU N H2 sing N N 142 GLU CA C sing N N 143 GLU CA CB sing N N 144 GLU CA HA sing N N 145 GLU C O doub N N 146 GLU C OXT sing N N 147 GLU CB CG sing N N 148 GLU CB HB2 sing N N 149 GLU CB HB3 sing N N 150 GLU CG CD sing N N 151 GLU CG HG2 sing N N 152 GLU CG HG3 sing N N 153 GLU CD OE1 doub N N 154 GLU CD OE2 sing N N 155 GLU OE2 HE2 sing N N 156 GLU OXT HXT sing N N 157 GLY N CA sing N N 158 GLY N H sing N N 159 GLY N H2 sing N N 160 GLY CA C sing N N 161 GLY CA HA2 sing N N 162 GLY CA HA3 sing N N 163 GLY C O doub N N 164 GLY C OXT sing N N 165 GLY OXT HXT sing N N 166 HIS N CA sing N N 167 HIS N H sing N N 168 HIS N H2 sing N N 169 HIS CA C sing N N 170 HIS CA CB sing N N 171 HIS CA HA sing N N 172 HIS C O doub N N 173 HIS C OXT sing N N 174 HIS CB CG sing N N 175 HIS CB HB2 sing N N 176 HIS CB HB3 sing N N 177 HIS CG ND1 sing Y N 178 HIS CG CD2 doub Y N 179 HIS ND1 CE1 doub Y N 180 HIS ND1 HD1 sing N N 181 HIS CD2 NE2 sing Y N 182 HIS CD2 HD2 sing N N 183 HIS CE1 NE2 sing Y N 184 HIS CE1 HE1 sing N N 185 HIS NE2 HE2 sing N N 186 HIS OXT HXT sing N N 187 ILE N CA sing N N 188 ILE N H sing N N 189 ILE N H2 sing N N 190 ILE CA C sing N N 191 ILE CA CB sing N N 192 ILE CA HA sing N N 193 ILE C O doub N N 194 ILE C OXT sing N N 195 ILE CB CG1 sing N N 196 ILE CB CG2 sing N N 197 ILE CB HB sing N N 198 ILE CG1 CD1 sing N N 199 ILE CG1 HG12 sing N N 200 ILE CG1 HG13 sing N N 201 ILE CG2 HG21 sing N N 202 ILE CG2 HG22 sing N N 203 ILE CG2 HG23 sing N N 204 ILE CD1 HD11 sing N N 205 ILE CD1 HD12 sing N N 206 ILE CD1 HD13 sing N N 207 ILE OXT HXT sing N N 208 LEU N CA sing N N 209 LEU N H sing N N 210 LEU N H2 sing N N 211 LEU CA C sing N N 212 LEU CA CB sing N N 213 LEU CA HA sing N N 214 LEU C O doub N N 215 LEU C OXT sing N N 216 LEU CB CG sing N N 217 LEU CB HB2 sing N N 218 LEU CB HB3 sing N N 219 LEU CG CD1 sing N N 220 LEU CG CD2 sing N N 221 LEU CG HG sing N N 222 LEU CD1 HD11 sing N N 223 LEU CD1 HD12 sing N N 224 LEU CD1 HD13 sing N N 225 LEU CD2 HD21 sing N N 226 LEU CD2 HD22 sing N N 227 LEU CD2 HD23 sing N N 228 LEU OXT HXT sing N N 229 LYS N CA sing N N 230 LYS N H sing N N 231 LYS N H2 sing N N 232 LYS CA C sing N N 233 LYS CA CB sing N N 234 LYS CA HA sing N N 235 LYS C O doub N N 236 LYS C OXT sing N N 237 LYS CB CG sing N N 238 LYS CB HB2 sing N N 239 LYS CB HB3 sing N N 240 LYS CG CD sing N N 241 LYS CG HG2 sing N N 242 LYS CG HG3 sing N N 243 LYS CD CE sing N N 244 LYS CD HD2 sing N N 245 LYS CD HD3 sing N N 246 LYS CE NZ sing N N 247 LYS CE HE2 sing N N 248 LYS CE HE3 sing N N 249 LYS NZ HZ1 sing N N 250 LYS NZ HZ2 sing N N 251 LYS NZ HZ3 sing N N 252 LYS OXT HXT sing N N 253 MET N CA sing N N 254 MET N H sing N N 255 MET N H2 sing N N 256 MET CA C sing N N 257 MET CA CB sing N N 258 MET CA HA sing N N 259 MET C O doub N N 260 MET C OXT sing N N 261 MET CB CG sing N N 262 MET CB HB2 sing N N 263 MET CB HB3 sing N N 264 MET CG SD sing N N 265 MET CG HG2 sing N N 266 MET CG HG3 sing N N 267 MET SD CE sing N N 268 MET CE HE1 sing N N 269 MET CE HE2 sing N N 270 MET CE HE3 sing N N 271 MET OXT HXT sing N N 272 PHE N CA sing N N 273 PHE N H sing N N 274 PHE N H2 sing N N 275 PHE CA C sing N N 276 PHE CA CB sing N N 277 PHE CA HA sing N N 278 PHE C O doub N N 279 PHE C OXT sing N N 280 PHE CB CG sing N N 281 PHE CB HB2 sing N N 282 PHE CB HB3 sing N N 283 PHE CG CD1 doub Y N 284 PHE CG CD2 sing Y N 285 PHE CD1 CE1 sing Y N 286 PHE CD1 HD1 sing N N 287 PHE CD2 CE2 doub Y N 288 PHE CD2 HD2 sing N N 289 PHE CE1 CZ doub Y N 290 PHE CE1 HE1 sing N N 291 PHE CE2 CZ sing Y N 292 PHE CE2 HE2 sing N N 293 PHE CZ HZ sing N N 294 PHE OXT HXT sing N N 295 PRO N CA sing N N 296 PRO N CD sing N N 297 PRO N H sing N N 298 PRO CA C sing N N 299 PRO CA CB sing N N 300 PRO CA HA sing N N 301 PRO C O doub N N 302 PRO C OXT sing N N 303 PRO CB CG sing N N 304 PRO CB HB2 sing N N 305 PRO CB HB3 sing N N 306 PRO CG CD sing N N 307 PRO CG HG2 sing N N 308 PRO CG HG3 sing N N 309 PRO CD HD2 sing N N 310 PRO CD HD3 sing N N 311 PRO OXT HXT sing N N 312 SER N CA sing N N 313 SER N H sing N N 314 SER N H2 sing N N 315 SER CA C sing N N 316 SER CA CB sing N N 317 SER CA HA sing N N 318 SER C O doub N N 319 SER C OXT sing N N 320 SER CB OG sing N N 321 SER CB HB2 sing N N 322 SER CB HB3 sing N N 323 SER OG HG sing N N 324 SER OXT HXT sing N N 325 THR N CA sing N N 326 THR N H sing N N 327 THR N H2 sing N N 328 THR CA C sing N N 329 THR CA CB sing N N 330 THR CA HA sing N N 331 THR C O doub N N 332 THR C OXT sing N N 333 THR CB OG1 sing N N 334 THR CB CG2 sing N N 335 THR CB HB sing N N 336 THR OG1 HG1 sing N N 337 THR CG2 HG21 sing N N 338 THR CG2 HG22 sing N N 339 THR CG2 HG23 sing N N 340 THR OXT HXT sing N N 341 TRP N CA sing N N 342 TRP N H sing N N 343 TRP N H2 sing N N 344 TRP CA C sing N N 345 TRP CA CB sing N N 346 TRP CA HA sing N N 347 TRP C O doub N N 348 TRP C OXT sing N N 349 TRP CB CG sing N N 350 TRP CB HB2 sing N N 351 TRP CB HB3 sing N N 352 TRP CG CD1 doub Y N 353 TRP CG CD2 sing Y N 354 TRP CD1 NE1 sing Y N 355 TRP CD1 HD1 sing N N 356 TRP CD2 CE2 doub Y N 357 TRP CD2 CE3 sing Y N 358 TRP NE1 CE2 sing Y N 359 TRP NE1 HE1 sing N N 360 TRP CE2 CZ2 sing Y N 361 TRP CE3 CZ3 doub Y N 362 TRP CE3 HE3 sing N N 363 TRP CZ2 CH2 doub Y N 364 TRP CZ2 HZ2 sing N N 365 TRP CZ3 CH2 sing Y N 366 TRP CZ3 HZ3 sing N N 367 TRP CH2 HH2 sing N N 368 TRP OXT HXT sing N N 369 TYR N CA sing N N 370 TYR N H sing N N 371 TYR N H2 sing N N 372 TYR CA C sing N N 373 TYR CA CB sing N N 374 TYR CA HA sing N N 375 TYR C O doub N N 376 TYR C OXT sing N N 377 TYR CB CG sing N N 378 TYR CB HB2 sing N N 379 TYR CB HB3 sing N N 380 TYR CG CD1 doub Y N 381 TYR CG CD2 sing Y N 382 TYR CD1 CE1 sing Y N 383 TYR CD1 HD1 sing N N 384 TYR CD2 CE2 doub Y N 385 TYR CD2 HD2 sing N N 386 TYR CE1 CZ doub Y N 387 TYR CE1 HE1 sing N N 388 TYR CE2 CZ sing Y N 389 TYR CE2 HE2 sing N N 390 TYR CZ OH sing N N 391 TYR OH HH sing N N 392 TYR OXT HXT sing N N 393 VAL N CA sing N N 394 VAL N H sing N N 395 VAL N H2 sing N N 396 VAL CA C sing N N 397 VAL CA CB sing N N 398 VAL CA HA sing N N 399 VAL C O doub N N 400 VAL C OXT sing N N 401 VAL CB CG1 sing N N 402 VAL CB CG2 sing N N 403 VAL CB HB sing N N 404 VAL CG1 HG11 sing N N 405 VAL CG1 HG12 sing N N 406 VAL CG1 HG13 sing N N 407 VAL CG2 HG21 sing N N 408 VAL CG2 HG22 sing N N 409 VAL CG2 HG23 sing N N 410 VAL OXT HXT sing N N 411 # _pdbx_nmr_spectrometer.spectrometer_id 1 _pdbx_nmr_spectrometer.model AMX2600 _pdbx_nmr_spectrometer.manufacturer Bruker _pdbx_nmr_spectrometer.field_strength 600 _pdbx_nmr_spectrometer.type ? # _atom_sites.entry_id 4AYK _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA H N O S ZN # loop_