data_4ER6 # _entry.id 4ER6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4ER6 pdb_00004er6 10.2210/pdb4er6/pdb RCSB RCSB071967 ? ? WWPDB D_1000071967 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-05-16 2 'Structure model' 1 1 2017-11-15 3 'Structure model' 1 2 2018-05-16 4 'Structure model' 1 3 2024-02-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Refinement description' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' 6 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' software 2 3 'Structure model' citation 3 3 'Structure model' citation_author 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_struct_conn_angle 8 4 'Structure model' struct_conn 9 4 'Structure model' struct_ref_seq_dif 10 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.country' 2 3 'Structure model' '_citation.journal_abbrev' 3 3 'Structure model' '_citation.journal_id_CSD' 4 3 'Structure model' '_citation.journal_id_ISSN' 5 3 'Structure model' '_citation.journal_volume' 6 3 'Structure model' '_citation.page_first' 7 3 'Structure model' '_citation.page_last' 8 3 'Structure model' '_citation.pdbx_database_id_DOI' 9 3 'Structure model' '_citation.pdbx_database_id_PubMed' 10 3 'Structure model' '_citation.title' 11 3 'Structure model' '_citation.year' 12 4 'Structure model' '_database_2.pdbx_DOI' 13 4 'Structure model' '_database_2.pdbx_database_accession' 14 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 15 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 16 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 17 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 18 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 19 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 20 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 21 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 22 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 23 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 24 4 'Structure model' '_pdbx_struct_conn_angle.value' 25 4 'Structure model' '_struct_conn.pdbx_dist_value' 26 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 27 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 28 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 29 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 30 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 31 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 32 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 33 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 34 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 35 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 36 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 37 4 'Structure model' '_struct_ref_seq_dif.details' 38 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 39 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 40 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 4ER6 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2012-04-19 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4EQZ . unspecified PDB 4ER0 . unspecified PDB 4ER3 . unspecified PDB 4ER5 . unspecified PDB 4ER7 . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wernimont, A.K.' 1 'Tempel, W.' 2 'Yu, W.' 3 'Scopton, A.' 4 'Li, Y.' 5 'Nguyen, K.T.' 6 'Vedadi, M.' 7 'Bradner, J.E.' 8 'Schapira, M.' 9 'Arrowsmith, C.H.' 10 'Edwards, A.M.' 11 'Bountra, C.' 12 'Brown, P.J.' 13 'Structural Genomics Consortium (SGC)' 14 # _citation.id primary _citation.title 'Catalytic site remodelling of the DOT1L methyltransferase by selective inhibitors.' _citation.journal_abbrev 'Nat Commun' _citation.journal_volume 3 _citation.page_first 1288 _citation.page_last 1288 _citation.year 2012 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 2041-1723 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23250418 _citation.pdbx_database_id_DOI 10.1038/ncomms2304 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Yu, W.' 1 ? primary 'Chory, E.J.' 2 ? primary 'Wernimont, A.K.' 3 ? primary 'Tempel, W.' 4 ? primary 'Scopton, A.' 5 ? primary 'Federation, A.' 6 ? primary 'Marineau, J.J.' 7 ? primary 'Qi, J.' 8 ? primary 'Barsyte-Lovejoy, D.' 9 ? primary 'Yi, J.' 10 ? primary 'Marcellus, R.' 11 ? primary 'Iacob, R.E.' 12 ? primary 'Engen, J.R.' 13 ? primary 'Griffin, C.' 14 ? primary 'Aman, A.' 15 ? primary 'Wienholds, E.' 16 ? primary 'Li, F.' 17 ? primary 'Pineda, J.' 18 ? primary 'Estiu, G.' 19 ? primary 'Shatseva, T.' 20 ? primary 'Hajian, T.' 21 ? primary 'Al-Awar, R.' 22 ? primary 'Dick, J.E.' 23 ? primary 'Vedadi, M.' 24 ? primary 'Brown, P.J.' 25 ? primary 'Arrowsmith, C.H.' 26 ? primary 'Bradner, J.E.' 27 ? primary 'Schapira, M.' 28 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Histone-lysine N-methyltransferase, H3 lysine-79 specific' 47050.539 1 2.1.1.43 ? ? ? 2 non-polymer syn 'BROMIDE ION' 79.904 1 ? ? ? ? 3 non-polymer syn ;5-bromo-7-{5-[(3-{[(4-tert-butylphenyl)carbamoyl]amino}propyl)(propan-2-yl)amino]-5-deoxy-beta-D-ribofuranosyl}-7H-pyrrolo[2,3-d]pyrimidin-4-amine ; 618.566 1 ? ? ? ? 4 non-polymer syn 'SODIUM ION' 22.990 1 ? ? ? ? 5 water nat water 18.015 25 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'DOT1-like protein, Histone H3-K79 methyltransferase, H3-K79-HMTase, Lysine N-methyltransferase 4' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GMGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYN RAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLF VDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIF VNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDR TILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGPEGKVAGPADAPMDSGAEEEKAGAATVKKPSPSKARKKKL NKKGRKMAGRKRG ; _entity_poly.pdbx_seq_one_letter_code_can ;GMGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYN RAIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLF VDLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIF VNNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDR TILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGPEGKVAGPADAPMDSGAEEEKAGAATVKKPSPSKARKKKL NKKGRKMAGRKRG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'BROMIDE ION' BR 3 ;5-bromo-7-{5-[(3-{[(4-tert-butylphenyl)carbamoyl]amino}propyl)(propan-2-yl)amino]-5-deoxy-beta-D-ribofuranosyl}-7H-pyrrolo[2,3-d]pyrimidin-4-amine ; AW2 4 'SODIUM ION' NA 5 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 MET n 1 3 GLY n 1 4 GLU n 1 5 LYS n 1 6 LEU n 1 7 GLU n 1 8 LEU n 1 9 ARG n 1 10 LEU n 1 11 LYS n 1 12 SER n 1 13 PRO n 1 14 VAL n 1 15 GLY n 1 16 ALA n 1 17 GLU n 1 18 PRO n 1 19 ALA n 1 20 VAL n 1 21 TYR n 1 22 PRO n 1 23 TRP n 1 24 PRO n 1 25 LEU n 1 26 PRO n 1 27 VAL n 1 28 TYR n 1 29 ASP n 1 30 LYS n 1 31 HIS n 1 32 HIS n 1 33 ASP n 1 34 ALA n 1 35 ALA n 1 36 HIS n 1 37 GLU n 1 38 ILE n 1 39 ILE n 1 40 GLU n 1 41 THR n 1 42 ILE n 1 43 ARG n 1 44 TRP n 1 45 VAL n 1 46 CYS n 1 47 GLU n 1 48 GLU n 1 49 ILE n 1 50 PRO n 1 51 ASP n 1 52 LEU n 1 53 LYS n 1 54 LEU n 1 55 ALA n 1 56 MET n 1 57 GLU n 1 58 ASN n 1 59 TYR n 1 60 VAL n 1 61 LEU n 1 62 ILE n 1 63 ASP n 1 64 TYR n 1 65 ASP n 1 66 THR n 1 67 LYS n 1 68 SER n 1 69 PHE n 1 70 GLU n 1 71 SER n 1 72 MET n 1 73 GLN n 1 74 ARG n 1 75 LEU n 1 76 CYS n 1 77 ASP n 1 78 LYS n 1 79 TYR n 1 80 ASN n 1 81 ARG n 1 82 ALA n 1 83 ILE n 1 84 ASP n 1 85 SER n 1 86 ILE n 1 87 HIS n 1 88 GLN n 1 89 LEU n 1 90 TRP n 1 91 LYS n 1 92 GLY n 1 93 THR n 1 94 THR n 1 95 GLN n 1 96 PRO n 1 97 MET n 1 98 LYS n 1 99 LEU n 1 100 ASN n 1 101 THR n 1 102 ARG n 1 103 PRO n 1 104 SER n 1 105 THR n 1 106 GLY n 1 107 LEU n 1 108 LEU n 1 109 ARG n 1 110 HIS n 1 111 ILE n 1 112 LEU n 1 113 GLN n 1 114 GLN n 1 115 VAL n 1 116 TYR n 1 117 ASN n 1 118 HIS n 1 119 SER n 1 120 VAL n 1 121 THR n 1 122 ASP n 1 123 PRO n 1 124 GLU n 1 125 LYS n 1 126 LEU n 1 127 ASN n 1 128 ASN n 1 129 TYR n 1 130 GLU n 1 131 PRO n 1 132 PHE n 1 133 SER n 1 134 PRO n 1 135 GLU n 1 136 VAL n 1 137 TYR n 1 138 GLY n 1 139 GLU n 1 140 THR n 1 141 SER n 1 142 PHE n 1 143 ASP n 1 144 LEU n 1 145 VAL n 1 146 ALA n 1 147 GLN n 1 148 MET n 1 149 ILE n 1 150 ASP n 1 151 GLU n 1 152 ILE n 1 153 LYS n 1 154 MET n 1 155 THR n 1 156 ASP n 1 157 ASP n 1 158 ASP n 1 159 LEU n 1 160 PHE n 1 161 VAL n 1 162 ASP n 1 163 LEU n 1 164 GLY n 1 165 SER n 1 166 GLY n 1 167 VAL n 1 168 GLY n 1 169 GLN n 1 170 VAL n 1 171 VAL n 1 172 LEU n 1 173 GLN n 1 174 VAL n 1 175 ALA n 1 176 ALA n 1 177 ALA n 1 178 THR n 1 179 ASN n 1 180 CYS n 1 181 LYS n 1 182 HIS n 1 183 HIS n 1 184 TYR n 1 185 GLY n 1 186 VAL n 1 187 GLU n 1 188 LYS n 1 189 ALA n 1 190 ASP n 1 191 ILE n 1 192 PRO n 1 193 ALA n 1 194 LYS n 1 195 TYR n 1 196 ALA n 1 197 GLU n 1 198 THR n 1 199 MET n 1 200 ASP n 1 201 ARG n 1 202 GLU n 1 203 PHE n 1 204 ARG n 1 205 LYS n 1 206 TRP n 1 207 MET n 1 208 LYS n 1 209 TRP n 1 210 TYR n 1 211 GLY n 1 212 LYS n 1 213 LYS n 1 214 HIS n 1 215 ALA n 1 216 GLU n 1 217 TYR n 1 218 THR n 1 219 LEU n 1 220 GLU n 1 221 ARG n 1 222 GLY n 1 223 ASP n 1 224 PHE n 1 225 LEU n 1 226 SER n 1 227 GLU n 1 228 GLU n 1 229 TRP n 1 230 ARG n 1 231 GLU n 1 232 ARG n 1 233 ILE n 1 234 ALA n 1 235 ASN n 1 236 THR n 1 237 SER n 1 238 VAL n 1 239 ILE n 1 240 PHE n 1 241 VAL n 1 242 ASN n 1 243 ASN n 1 244 PHE n 1 245 ALA n 1 246 PHE n 1 247 GLY n 1 248 PRO n 1 249 GLU n 1 250 VAL n 1 251 ASP n 1 252 HIS n 1 253 GLN n 1 254 LEU n 1 255 LYS n 1 256 GLU n 1 257 ARG n 1 258 PHE n 1 259 ALA n 1 260 ASN n 1 261 MET n 1 262 LYS n 1 263 GLU n 1 264 GLY n 1 265 GLY n 1 266 ARG n 1 267 ILE n 1 268 VAL n 1 269 SER n 1 270 SER n 1 271 LYS n 1 272 PRO n 1 273 PHE n 1 274 ALA n 1 275 PRO n 1 276 LEU n 1 277 ASN n 1 278 PHE n 1 279 ARG n 1 280 ILE n 1 281 ASN n 1 282 SER n 1 283 ARG n 1 284 ASN n 1 285 LEU n 1 286 SER n 1 287 ASP n 1 288 ILE n 1 289 GLY n 1 290 THR n 1 291 ILE n 1 292 MET n 1 293 ARG n 1 294 VAL n 1 295 VAL n 1 296 GLU n 1 297 LEU n 1 298 SER n 1 299 PRO n 1 300 LEU n 1 301 LYS n 1 302 GLY n 1 303 SER n 1 304 VAL n 1 305 SER n 1 306 TRP n 1 307 THR n 1 308 GLY n 1 309 LYS n 1 310 PRO n 1 311 VAL n 1 312 SER n 1 313 TYR n 1 314 TYR n 1 315 LEU n 1 316 HIS n 1 317 THR n 1 318 ILE n 1 319 ASP n 1 320 ARG n 1 321 THR n 1 322 ILE n 1 323 LEU n 1 324 GLU n 1 325 ASN n 1 326 TYR n 1 327 PHE n 1 328 SER n 1 329 SER n 1 330 LEU n 1 331 LYS n 1 332 ASN n 1 333 PRO n 1 334 LYS n 1 335 LEU n 1 336 ARG n 1 337 GLU n 1 338 GLU n 1 339 GLN n 1 340 GLU n 1 341 ALA n 1 342 ALA n 1 343 ARG n 1 344 ARG n 1 345 ARG n 1 346 GLN n 1 347 GLN n 1 348 ARG n 1 349 GLU n 1 350 SER n 1 351 LYS n 1 352 SER n 1 353 ASN n 1 354 ALA n 1 355 ALA n 1 356 THR n 1 357 PRO n 1 358 THR n 1 359 LYS n 1 360 GLY n 1 361 PRO n 1 362 GLU n 1 363 GLY n 1 364 LYS n 1 365 VAL n 1 366 ALA n 1 367 GLY n 1 368 PRO n 1 369 ALA n 1 370 ASP n 1 371 ALA n 1 372 PRO n 1 373 MET n 1 374 ASP n 1 375 SER n 1 376 GLY n 1 377 ALA n 1 378 GLU n 1 379 GLU n 1 380 GLU n 1 381 LYS n 1 382 ALA n 1 383 GLY n 1 384 ALA n 1 385 ALA n 1 386 THR n 1 387 VAL n 1 388 LYS n 1 389 LYS n 1 390 PRO n 1 391 SER n 1 392 PRO n 1 393 SER n 1 394 LYS n 1 395 ALA n 1 396 ARG n 1 397 LYS n 1 398 LYS n 1 399 LYS n 1 400 LEU n 1 401 ASN n 1 402 LYS n 1 403 LYS n 1 404 GLY n 1 405 ARG n 1 406 LYS n 1 407 MET n 1 408 ALA n 1 409 GLY n 1 410 ARG n 1 411 LYS n 1 412 ARG n 1 413 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'DOT1L, KIAA1814, KMT4' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'Bl21 V2r Prare2' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET28-MHL _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 AW2 non-polymer . ;5-bromo-7-{5-[(3-{[(4-tert-butylphenyl)carbamoyl]amino}propyl)(propan-2-yl)amino]-5-deoxy-beta-D-ribofuranosyl}-7H-pyrrolo[2,3-d]pyrimidin-4-amine ; ? 'C28 H40 Br N7 O4' 618.566 BR non-polymer . 'BROMIDE ION' ? 'Br -1' 79.904 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NA non-polymer . 'SODIUM ION' ? 'Na 1' 22.990 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 MET 2 1 ? ? ? A . n A 1 3 GLY 3 2 ? ? ? A . n A 1 4 GLU 4 3 ? ? ? A . n A 1 5 LYS 5 4 4 LYS LYS A . n A 1 6 LEU 6 5 5 LEU LEU A . n A 1 7 GLU 7 6 6 GLU GLU A . n A 1 8 LEU 8 7 7 LEU LEU A . n A 1 9 ARG 9 8 8 ARG ARG A . n A 1 10 LEU 10 9 9 LEU LEU A . n A 1 11 LYS 11 10 10 LYS LYS A . n A 1 12 SER 12 11 11 SER SER A . n A 1 13 PRO 13 12 12 PRO PRO A . n A 1 14 VAL 14 13 13 VAL VAL A . n A 1 15 GLY 15 14 14 GLY GLY A . n A 1 16 ALA 16 15 15 ALA ALA A . n A 1 17 GLU 17 16 16 GLU GLU A . n A 1 18 PRO 18 17 17 PRO PRO A . n A 1 19 ALA 19 18 18 ALA ALA A . n A 1 20 VAL 20 19 19 VAL VAL A . n A 1 21 TYR 21 20 20 TYR TYR A . n A 1 22 PRO 22 21 21 PRO PRO A . n A 1 23 TRP 23 22 22 TRP TRP A . n A 1 24 PRO 24 23 23 PRO PRO A . n A 1 25 LEU 25 24 24 LEU LEU A . n A 1 26 PRO 26 25 25 PRO PRO A . n A 1 27 VAL 27 26 26 VAL VAL A . n A 1 28 TYR 28 27 27 TYR TYR A . n A 1 29 ASP 29 28 28 ASP ASP A . n A 1 30 LYS 30 29 29 LYS LYS A . n A 1 31 HIS 31 30 30 HIS HIS A . n A 1 32 HIS 32 31 31 HIS HIS A . n A 1 33 ASP 33 32 32 ASP ASP A . n A 1 34 ALA 34 33 33 ALA ALA A . n A 1 35 ALA 35 34 34 ALA ALA A . n A 1 36 HIS 36 35 35 HIS HIS A . n A 1 37 GLU 37 36 36 GLU GLU A . n A 1 38 ILE 38 37 37 ILE ILE A . n A 1 39 ILE 39 38 38 ILE ILE A . n A 1 40 GLU 40 39 39 GLU GLU A . n A 1 41 THR 41 40 40 THR THR A . n A 1 42 ILE 42 41 41 ILE ILE A . n A 1 43 ARG 43 42 42 ARG ARG A . n A 1 44 TRP 44 43 43 TRP TRP A . n A 1 45 VAL 45 44 44 VAL VAL A . n A 1 46 CYS 46 45 45 CYS CYS A . n A 1 47 GLU 47 46 46 GLU GLU A . n A 1 48 GLU 48 47 47 GLU GLU A . n A 1 49 ILE 49 48 48 ILE ILE A . n A 1 50 PRO 50 49 49 PRO PRO A . n A 1 51 ASP 51 50 50 ASP ASP A . n A 1 52 LEU 52 51 51 LEU LEU A . n A 1 53 LYS 53 52 52 LYS LYS A . n A 1 54 LEU 54 53 53 LEU LEU A . n A 1 55 ALA 55 54 54 ALA ALA A . n A 1 56 MET 56 55 55 MET MET A . n A 1 57 GLU 57 56 56 GLU GLU A . n A 1 58 ASN 58 57 57 ASN ASN A . n A 1 59 TYR 59 58 58 TYR TYR A . n A 1 60 VAL 60 59 59 VAL VAL A . n A 1 61 LEU 61 60 60 LEU LEU A . n A 1 62 ILE 62 61 61 ILE ILE A . n A 1 63 ASP 63 62 62 ASP ASP A . n A 1 64 TYR 64 63 63 TYR TYR A . n A 1 65 ASP 65 64 64 ASP ASP A . n A 1 66 THR 66 65 65 THR THR A . n A 1 67 LYS 67 66 66 LYS LYS A . n A 1 68 SER 68 67 67 SER SER A . n A 1 69 PHE 69 68 68 PHE PHE A . n A 1 70 GLU 70 69 69 GLU GLU A . n A 1 71 SER 71 70 70 SER SER A . n A 1 72 MET 72 71 71 MET MET A . n A 1 73 GLN 73 72 72 GLN GLN A . n A 1 74 ARG 74 73 73 ARG ARG A . n A 1 75 LEU 75 74 74 LEU LEU A . n A 1 76 CYS 76 75 75 CYS CYS A . n A 1 77 ASP 77 76 76 ASP ASP A . n A 1 78 LYS 78 77 77 LYS LYS A . n A 1 79 TYR 79 78 78 TYR TYR A . n A 1 80 ASN 80 79 79 ASN ASN A . n A 1 81 ARG 81 80 80 ARG ARG A . n A 1 82 ALA 82 81 81 ALA ALA A . n A 1 83 ILE 83 82 82 ILE ILE A . n A 1 84 ASP 84 83 83 ASP ASP A . n A 1 85 SER 85 84 84 SER SER A . n A 1 86 ILE 86 85 85 ILE ILE A . n A 1 87 HIS 87 86 86 HIS HIS A . n A 1 88 GLN 88 87 87 GLN GLN A . n A 1 89 LEU 89 88 88 LEU LEU A . n A 1 90 TRP 90 89 89 TRP TRP A . n A 1 91 LYS 91 90 90 LYS LYS A . n A 1 92 GLY 92 91 91 GLY GLY A . n A 1 93 THR 93 92 92 THR THR A . n A 1 94 THR 94 93 93 THR THR A . n A 1 95 GLN 95 94 94 GLN GLN A . n A 1 96 PRO 96 95 95 PRO PRO A . n A 1 97 MET 97 96 96 MET MET A . n A 1 98 LYS 98 97 97 LYS LYS A . n A 1 99 LEU 99 98 98 LEU LEU A . n A 1 100 ASN 100 99 99 ASN ASN A . n A 1 101 THR 101 100 100 THR THR A . n A 1 102 ARG 102 101 101 ARG ARG A . n A 1 103 PRO 103 102 102 PRO PRO A . n A 1 104 SER 104 103 103 SER SER A . n A 1 105 THR 105 104 104 THR THR A . n A 1 106 GLY 106 105 105 GLY GLY A . n A 1 107 LEU 107 106 106 LEU LEU A . n A 1 108 LEU 108 107 107 LEU LEU A . n A 1 109 ARG 109 108 108 ARG ARG A . n A 1 110 HIS 110 109 109 HIS HIS A . n A 1 111 ILE 111 110 110 ILE ILE A . n A 1 112 LEU 112 111 111 LEU LEU A . n A 1 113 GLN 113 112 112 GLN GLN A . n A 1 114 GLN 114 113 113 GLN GLN A . n A 1 115 VAL 115 114 114 VAL VAL A . n A 1 116 TYR 116 115 115 TYR TYR A . n A 1 117 ASN 117 116 116 ASN ASN A . n A 1 118 HIS 118 117 117 HIS HIS A . n A 1 119 SER 119 118 118 SER SER A . n A 1 120 VAL 120 119 119 VAL VAL A . n A 1 121 THR 121 120 120 THR THR A . n A 1 122 ASP 122 121 121 ASP ASP A . n A 1 123 PRO 123 122 122 PRO PRO A . n A 1 124 GLU 124 123 123 GLU GLU A . n A 1 125 LYS 125 124 124 LYS LYS A . n A 1 126 LEU 126 125 125 LEU LEU A . n A 1 127 ASN 127 126 126 ASN ASN A . n A 1 128 ASN 128 127 ? ? ? A . n A 1 129 TYR 129 128 ? ? ? A . n A 1 130 GLU 130 129 ? ? ? A . n A 1 131 PRO 131 130 130 PRO PRO A . n A 1 132 PHE 132 131 131 PHE PHE A . n A 1 133 SER 133 132 132 SER SER A . n A 1 134 PRO 134 133 133 PRO PRO A . n A 1 135 GLU 135 134 134 GLU GLU A . n A 1 136 VAL 136 135 135 VAL VAL A . n A 1 137 TYR 137 136 136 TYR TYR A . n A 1 138 GLY 138 137 137 GLY GLY A . n A 1 139 GLU 139 138 138 GLU GLU A . n A 1 140 THR 140 139 139 THR THR A . n A 1 141 SER 141 140 140 SER SER A . n A 1 142 PHE 142 141 141 PHE PHE A . n A 1 143 ASP 143 142 142 ASP ASP A . n A 1 144 LEU 144 143 143 LEU LEU A . n A 1 145 VAL 145 144 144 VAL VAL A . n A 1 146 ALA 146 145 145 ALA ALA A . n A 1 147 GLN 147 146 146 GLN GLN A . n A 1 148 MET 148 147 147 MET MET A . n A 1 149 ILE 149 148 148 ILE ILE A . n A 1 150 ASP 150 149 149 ASP ASP A . n A 1 151 GLU 151 150 150 GLU GLU A . n A 1 152 ILE 152 151 151 ILE ILE A . n A 1 153 LYS 153 152 152 LYS LYS A . n A 1 154 MET 154 153 153 MET MET A . n A 1 155 THR 155 154 154 THR THR A . n A 1 156 ASP 156 155 155 ASP ASP A . n A 1 157 ASP 157 156 156 ASP ASP A . n A 1 158 ASP 158 157 157 ASP ASP A . n A 1 159 LEU 159 158 158 LEU LEU A . n A 1 160 PHE 160 159 159 PHE PHE A . n A 1 161 VAL 161 160 160 VAL VAL A . n A 1 162 ASP 162 161 161 ASP ASP A . n A 1 163 LEU 163 162 162 LEU LEU A . n A 1 164 GLY 164 163 163 GLY GLY A . n A 1 165 SER 165 164 164 SER SER A . n A 1 166 GLY 166 165 165 GLY GLY A . n A 1 167 VAL 167 166 166 VAL VAL A . n A 1 168 GLY 168 167 167 GLY GLY A . n A 1 169 GLN 169 168 168 GLN GLN A . n A 1 170 VAL 170 169 169 VAL VAL A . n A 1 171 VAL 171 170 170 VAL VAL A . n A 1 172 LEU 172 171 171 LEU LEU A . n A 1 173 GLN 173 172 172 GLN GLN A . n A 1 174 VAL 174 173 173 VAL VAL A . n A 1 175 ALA 175 174 174 ALA ALA A . n A 1 176 ALA 176 175 175 ALA ALA A . n A 1 177 ALA 177 176 176 ALA ALA A . n A 1 178 THR 178 177 177 THR THR A . n A 1 179 ASN 179 178 178 ASN ASN A . n A 1 180 CYS 180 179 179 CYS CYS A . n A 1 181 LYS 181 180 180 LYS LYS A . n A 1 182 HIS 182 181 181 HIS HIS A . n A 1 183 HIS 183 182 182 HIS HIS A . n A 1 184 TYR 184 183 183 TYR TYR A . n A 1 185 GLY 185 184 184 GLY GLY A . n A 1 186 VAL 186 185 185 VAL VAL A . n A 1 187 GLU 187 186 186 GLU GLU A . n A 1 188 LYS 188 187 187 LYS LYS A . n A 1 189 ALA 189 188 188 ALA ALA A . n A 1 190 ASP 190 189 189 ASP ASP A . n A 1 191 ILE 191 190 190 ILE ILE A . n A 1 192 PRO 192 191 191 PRO PRO A . n A 1 193 ALA 193 192 192 ALA ALA A . n A 1 194 LYS 194 193 193 LYS LYS A . n A 1 195 TYR 195 194 194 TYR TYR A . n A 1 196 ALA 196 195 195 ALA ALA A . n A 1 197 GLU 197 196 196 GLU GLU A . n A 1 198 THR 198 197 197 THR THR A . n A 1 199 MET 199 198 198 MET MET A . n A 1 200 ASP 200 199 199 ASP ASP A . n A 1 201 ARG 201 200 200 ARG ARG A . n A 1 202 GLU 202 201 201 GLU GLU A . n A 1 203 PHE 203 202 202 PHE PHE A . n A 1 204 ARG 204 203 203 ARG ARG A . n A 1 205 LYS 205 204 204 LYS LYS A . n A 1 206 TRP 206 205 205 TRP TRP A . n A 1 207 MET 207 206 206 MET MET A . n A 1 208 LYS 208 207 207 LYS LYS A . n A 1 209 TRP 209 208 208 TRP TRP A . n A 1 210 TYR 210 209 209 TYR TYR A . n A 1 211 GLY 211 210 210 GLY GLY A . n A 1 212 LYS 212 211 211 LYS LYS A . n A 1 213 LYS 213 212 212 LYS LYS A . n A 1 214 HIS 214 213 213 HIS HIS A . n A 1 215 ALA 215 214 214 ALA ALA A . n A 1 216 GLU 216 215 215 GLU GLU A . n A 1 217 TYR 217 216 216 TYR TYR A . n A 1 218 THR 218 217 217 THR THR A . n A 1 219 LEU 219 218 218 LEU LEU A . n A 1 220 GLU 220 219 219 GLU GLU A . n A 1 221 ARG 221 220 220 ARG ARG A . n A 1 222 GLY 222 221 221 GLY GLY A . n A 1 223 ASP 223 222 222 ASP ASP A . n A 1 224 PHE 224 223 223 PHE PHE A . n A 1 225 LEU 225 224 224 LEU LEU A . n A 1 226 SER 226 225 225 SER SER A . n A 1 227 GLU 227 226 226 GLU GLU A . n A 1 228 GLU 228 227 227 GLU GLU A . n A 1 229 TRP 229 228 228 TRP TRP A . n A 1 230 ARG 230 229 229 ARG ARG A . n A 1 231 GLU 231 230 230 GLU GLU A . n A 1 232 ARG 232 231 231 ARG ARG A . n A 1 233 ILE 233 232 232 ILE ILE A . n A 1 234 ALA 234 233 233 ALA ALA A . n A 1 235 ASN 235 234 234 ASN ASN A . n A 1 236 THR 236 235 235 THR THR A . n A 1 237 SER 237 236 236 SER SER A . n A 1 238 VAL 238 237 237 VAL VAL A . n A 1 239 ILE 239 238 238 ILE ILE A . n A 1 240 PHE 240 239 239 PHE PHE A . n A 1 241 VAL 241 240 240 VAL VAL A . n A 1 242 ASN 242 241 241 ASN ASN A . n A 1 243 ASN 243 242 242 ASN ASN A . n A 1 244 PHE 244 243 243 PHE PHE A . n A 1 245 ALA 245 244 244 ALA ALA A . n A 1 246 PHE 246 245 245 PHE PHE A . n A 1 247 GLY 247 246 246 GLY GLY A . n A 1 248 PRO 248 247 247 PRO PRO A . n A 1 249 GLU 249 248 248 GLU GLU A . n A 1 250 VAL 250 249 249 VAL VAL A . n A 1 251 ASP 251 250 250 ASP ASP A . n A 1 252 HIS 252 251 251 HIS HIS A . n A 1 253 GLN 253 252 252 GLN GLN A . n A 1 254 LEU 254 253 253 LEU LEU A . n A 1 255 LYS 255 254 254 LYS LYS A . n A 1 256 GLU 256 255 255 GLU GLU A . n A 1 257 ARG 257 256 256 ARG ARG A . n A 1 258 PHE 258 257 257 PHE PHE A . n A 1 259 ALA 259 258 258 ALA ALA A . n A 1 260 ASN 260 259 259 ASN ASN A . n A 1 261 MET 261 260 260 MET MET A . n A 1 262 LYS 262 261 261 LYS LYS A . n A 1 263 GLU 263 262 262 GLU GLU A . n A 1 264 GLY 264 263 263 GLY GLY A . n A 1 265 GLY 265 264 264 GLY GLY A . n A 1 266 ARG 266 265 265 ARG ARG A . n A 1 267 ILE 267 266 266 ILE ILE A . n A 1 268 VAL 268 267 267 VAL VAL A . n A 1 269 SER 269 268 268 SER SER A . n A 1 270 SER 270 269 269 SER SER A . n A 1 271 LYS 271 270 270 LYS LYS A . n A 1 272 PRO 272 271 271 PRO PRO A . n A 1 273 PHE 273 272 272 PHE PHE A . n A 1 274 ALA 274 273 273 ALA ALA A . n A 1 275 PRO 275 274 274 PRO PRO A . n A 1 276 LEU 276 275 275 LEU LEU A . n A 1 277 ASN 277 276 276 ASN ASN A . n A 1 278 PHE 278 277 277 PHE PHE A . n A 1 279 ARG 279 278 278 ARG ARG A . n A 1 280 ILE 280 279 279 ILE ILE A . n A 1 281 ASN 281 280 280 ASN ASN A . n A 1 282 SER 282 281 281 SER SER A . n A 1 283 ARG 283 282 282 ARG ARG A . n A 1 284 ASN 284 283 283 ASN ASN A . n A 1 285 LEU 285 284 284 LEU LEU A . n A 1 286 SER 286 285 285 SER SER A . n A 1 287 ASP 287 286 286 ASP ASP A . n A 1 288 ILE 288 287 287 ILE ILE A . n A 1 289 GLY 289 288 288 GLY GLY A . n A 1 290 THR 290 289 289 THR THR A . n A 1 291 ILE 291 290 290 ILE ILE A . n A 1 292 MET 292 291 291 MET MET A . n A 1 293 ARG 293 292 292 ARG ARG A . n A 1 294 VAL 294 293 293 VAL VAL A . n A 1 295 VAL 295 294 294 VAL VAL A . n A 1 296 GLU 296 295 295 GLU GLU A . n A 1 297 LEU 297 296 296 LEU LEU A . n A 1 298 SER 298 297 297 SER SER A . n A 1 299 PRO 299 298 298 PRO PRO A . n A 1 300 LEU 300 299 299 LEU LEU A . n A 1 301 LYS 301 300 300 LYS LYS A . n A 1 302 GLY 302 301 301 GLY GLY A . n A 1 303 SER 303 302 302 SER SER A . n A 1 304 VAL 304 303 303 VAL VAL A . n A 1 305 SER 305 304 304 SER SER A . n A 1 306 TRP 306 305 305 TRP TRP A . n A 1 307 THR 307 306 306 THR THR A . n A 1 308 GLY 308 307 307 GLY GLY A . n A 1 309 LYS 309 308 308 LYS LYS A . n A 1 310 PRO 310 309 309 PRO PRO A . n A 1 311 VAL 311 310 310 VAL VAL A . n A 1 312 SER 312 311 311 SER SER A . n A 1 313 TYR 313 312 312 TYR TYR A . n A 1 314 TYR 314 313 313 TYR TYR A . n A 1 315 LEU 315 314 314 LEU LEU A . n A 1 316 HIS 316 315 315 HIS HIS A . n A 1 317 THR 317 316 316 THR THR A . n A 1 318 ILE 318 317 317 ILE ILE A . n A 1 319 ASP 319 318 318 ASP ASP A . n A 1 320 ARG 320 319 319 ARG ARG A . n A 1 321 THR 321 320 320 THR THR A . n A 1 322 ILE 322 321 321 ILE ILE A . n A 1 323 LEU 323 322 322 LEU LEU A . n A 1 324 GLU 324 323 323 GLU GLU A . n A 1 325 ASN 325 324 324 ASN ASN A . n A 1 326 TYR 326 325 325 TYR TYR A . n A 1 327 PHE 327 326 326 PHE PHE A . n A 1 328 SER 328 327 327 SER SER A . n A 1 329 SER 329 328 328 SER SER A . n A 1 330 LEU 330 329 329 LEU LEU A . n A 1 331 LYS 331 330 330 LYS LYS A . n A 1 332 ASN 332 331 331 ASN ASN A . n A 1 333 PRO 333 332 332 PRO PRO A . n A 1 334 LYS 334 333 333 LYS LYS A . n A 1 335 LEU 335 334 334 LEU LEU A . n A 1 336 ARG 336 335 335 ARG ARG A . n A 1 337 GLU 337 336 336 GLU GLU A . n A 1 338 GLU 338 337 337 GLU GLU A . n A 1 339 GLN 339 338 338 GLN GLN A . n A 1 340 GLU 340 339 339 GLU GLU A . n A 1 341 ALA 341 340 340 ALA ALA A . n A 1 342 ALA 342 341 341 ALA ALA A . n A 1 343 ARG 343 342 ? ? ? A . n A 1 344 ARG 344 343 ? ? ? A . n A 1 345 ARG 345 344 ? ? ? A . n A 1 346 GLN 346 345 ? ? ? A . n A 1 347 GLN 347 346 ? ? ? A . n A 1 348 ARG 348 347 ? ? ? A . n A 1 349 GLU 349 348 ? ? ? A . n A 1 350 SER 350 349 ? ? ? A . n A 1 351 LYS 351 350 ? ? ? A . n A 1 352 SER 352 351 ? ? ? A . n A 1 353 ASN 353 352 ? ? ? A . n A 1 354 ALA 354 353 ? ? ? A . n A 1 355 ALA 355 354 ? ? ? A . n A 1 356 THR 356 355 ? ? ? A . n A 1 357 PRO 357 356 ? ? ? A . n A 1 358 THR 358 357 ? ? ? A . n A 1 359 LYS 359 358 ? ? ? A . n A 1 360 GLY 360 359 ? ? ? A . n A 1 361 PRO 361 360 ? ? ? A . n A 1 362 GLU 362 361 ? ? ? A . n A 1 363 GLY 363 362 ? ? ? A . n A 1 364 LYS 364 363 ? ? ? A . n A 1 365 VAL 365 364 ? ? ? A . n A 1 366 ALA 366 365 ? ? ? A . n A 1 367 GLY 367 366 ? ? ? A . n A 1 368 PRO 368 367 ? ? ? A . n A 1 369 ALA 369 368 ? ? ? A . n A 1 370 ASP 370 369 ? ? ? A . n A 1 371 ALA 371 370 ? ? ? A . n A 1 372 PRO 372 371 ? ? ? A . n A 1 373 MET 373 372 ? ? ? A . n A 1 374 ASP 374 373 ? ? ? A . n A 1 375 SER 375 374 ? ? ? A . n A 1 376 GLY 376 375 ? ? ? A . n A 1 377 ALA 377 376 ? ? ? A . n A 1 378 GLU 378 377 ? ? ? A . n A 1 379 GLU 379 378 ? ? ? A . n A 1 380 GLU 380 379 ? ? ? A . n A 1 381 LYS 381 380 ? ? ? A . n A 1 382 ALA 382 381 ? ? ? A . n A 1 383 GLY 383 382 ? ? ? A . n A 1 384 ALA 384 383 ? ? ? A . n A 1 385 ALA 385 384 ? ? ? A . n A 1 386 THR 386 385 ? ? ? A . n A 1 387 VAL 387 386 ? ? ? A . n A 1 388 LYS 388 387 ? ? ? A . n A 1 389 LYS 389 388 ? ? ? A . n A 1 390 PRO 390 389 ? ? ? A . n A 1 391 SER 391 390 ? ? ? A . n A 1 392 PRO 392 391 ? ? ? A . n A 1 393 SER 393 392 ? ? ? A . n A 1 394 LYS 394 393 ? ? ? A . n A 1 395 ALA 395 394 ? ? ? A . n A 1 396 ARG 396 395 ? ? ? A . n A 1 397 LYS 397 396 ? ? ? A . n A 1 398 LYS 398 397 ? ? ? A . n A 1 399 LYS 399 398 ? ? ? A . n A 1 400 LEU 400 399 ? ? ? A . n A 1 401 ASN 401 400 ? ? ? A . n A 1 402 LYS 402 401 ? ? ? A . n A 1 403 LYS 403 402 ? ? ? A . n A 1 404 GLY 404 403 ? ? ? A . n A 1 405 ARG 405 404 ? ? ? A . n A 1 406 LYS 406 405 ? ? ? A . n A 1 407 MET 407 406 ? ? ? A . n A 1 408 ALA 408 407 ? ? ? A . n A 1 409 GLY 409 408 ? ? ? A . n A 1 410 ARG 410 409 ? ? ? A . n A 1 411 LYS 411 410 ? ? ? A . n A 1 412 ARG 412 411 ? ? ? A . n A 1 413 GLY 413 412 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 BR 1 501 1 BR BR A . C 3 AW2 1 502 1 AW2 LIG A . D 4 NA 1 503 1 NA NA A . E 5 HOH 1 601 1 HOH HOH A . E 5 HOH 2 602 2 HOH HOH A . E 5 HOH 3 603 4 HOH HOH A . E 5 HOH 4 604 5 HOH HOH A . E 5 HOH 5 605 7 HOH HOH A . E 5 HOH 6 606 8 HOH HOH A . E 5 HOH 7 607 9 HOH HOH A . E 5 HOH 8 608 11 HOH HOH A . E 5 HOH 9 609 12 HOH HOH A . E 5 HOH 10 610 15 HOH HOH A . E 5 HOH 11 611 16 HOH HOH A . E 5 HOH 12 612 17 HOH HOH A . E 5 HOH 13 613 18 HOH HOH A . E 5 HOH 14 614 19 HOH HOH A . E 5 HOH 15 615 20 HOH HOH A . E 5 HOH 16 616 21 HOH HOH A . E 5 HOH 17 617 22 HOH HOH A . E 5 HOH 18 618 23 HOH HOH A . E 5 HOH 19 619 24 HOH HOH A . E 5 HOH 20 620 25 HOH HOH A . E 5 HOH 21 621 26 HOH HOH A . E 5 HOH 22 622 27 HOH HOH A . E 5 HOH 23 623 28 HOH HOH A . E 5 HOH 24 624 29 HOH HOH A . E 5 HOH 25 625 30 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 4 ? CG ? A LYS 5 CG 2 1 Y 1 A LYS 4 ? CD ? A LYS 5 CD 3 1 Y 1 A LYS 4 ? CE ? A LYS 5 CE 4 1 Y 1 A LYS 4 ? NZ ? A LYS 5 NZ 5 1 Y 1 A GLU 16 ? CD ? A GLU 17 CD 6 1 Y 1 A GLU 16 ? OE1 ? A GLU 17 OE1 7 1 Y 1 A GLU 16 ? OE2 ? A GLU 17 OE2 8 1 Y 1 A LYS 29 ? CD ? A LYS 30 CD 9 1 Y 1 A LYS 29 ? CE ? A LYS 30 CE 10 1 Y 1 A LYS 29 ? NZ ? A LYS 30 NZ 11 1 Y 1 A GLU 56 ? CD ? A GLU 57 CD 12 1 Y 1 A GLU 56 ? OE1 ? A GLU 57 OE1 13 1 Y 1 A GLU 56 ? OE2 ? A GLU 57 OE2 14 1 Y 1 A LEU 60 ? CD1 ? A LEU 61 CD1 15 1 Y 1 A LEU 60 ? CD2 ? A LEU 61 CD2 16 1 Y 1 A GLU 69 ? CD ? A GLU 70 CD 17 1 Y 1 A GLU 69 ? OE1 ? A GLU 70 OE1 18 1 Y 1 A GLU 69 ? OE2 ? A GLU 70 OE2 19 1 Y 1 A GLN 94 ? CG ? A GLN 95 CG 20 1 Y 1 A GLN 94 ? CD ? A GLN 95 CD 21 1 Y 1 A GLN 94 ? OE1 ? A GLN 95 OE1 22 1 Y 1 A GLN 94 ? NE2 ? A GLN 95 NE2 23 1 Y 1 A LYS 97 ? CD ? A LYS 98 CD 24 1 Y 1 A LYS 97 ? CE ? A LYS 98 CE 25 1 Y 1 A LYS 97 ? NZ ? A LYS 98 NZ 26 1 Y 1 A ASN 99 ? CG ? A ASN 100 CG 27 1 Y 1 A ASN 99 ? OD1 ? A ASN 100 OD1 28 1 Y 1 A ASN 99 ? ND2 ? A ASN 100 ND2 29 1 Y 1 A VAL 119 ? CG1 ? A VAL 120 CG1 30 1 Y 1 A VAL 119 ? CG2 ? A VAL 120 CG2 31 1 Y 1 A LYS 124 ? CD ? A LYS 125 CD 32 1 Y 1 A LYS 124 ? CE ? A LYS 125 CE 33 1 Y 1 A LYS 124 ? NZ ? A LYS 125 NZ 34 1 Y 1 A LEU 125 ? CG ? A LEU 126 CG 35 1 Y 1 A LEU 125 ? CD1 ? A LEU 126 CD1 36 1 Y 1 A LEU 125 ? CD2 ? A LEU 126 CD2 37 1 Y 1 A GLU 134 ? CD ? A GLU 135 CD 38 1 Y 1 A GLU 134 ? OE1 ? A GLU 135 OE1 39 1 Y 1 A GLU 134 ? OE2 ? A GLU 135 OE2 40 1 Y 1 A GLU 138 ? CD ? A GLU 139 CD 41 1 Y 1 A GLU 138 ? OE1 ? A GLU 139 OE1 42 1 Y 1 A GLU 138 ? OE2 ? A GLU 139 OE2 43 1 Y 1 A LYS 152 ? CG ? A LYS 153 CG 44 1 Y 1 A LYS 152 ? CD ? A LYS 153 CD 45 1 Y 1 A LYS 152 ? CE ? A LYS 153 CE 46 1 Y 1 A LYS 152 ? NZ ? A LYS 153 NZ 47 1 Y 1 A LYS 180 ? CG ? A LYS 181 CG 48 1 Y 1 A LYS 180 ? CD ? A LYS 181 CD 49 1 Y 1 A LYS 180 ? CE ? A LYS 181 CE 50 1 Y 1 A LYS 180 ? NZ ? A LYS 181 NZ 51 1 Y 1 A LYS 187 ? CE ? A LYS 188 CE 52 1 Y 1 A LYS 187 ? NZ ? A LYS 188 NZ 53 1 Y 1 A LYS 193 ? CD ? A LYS 194 CD 54 1 Y 1 A LYS 193 ? CE ? A LYS 194 CE 55 1 Y 1 A LYS 193 ? NZ ? A LYS 194 NZ 56 1 Y 1 A LYS 207 ? CD ? A LYS 208 CD 57 1 Y 1 A LYS 207 ? CE ? A LYS 208 CE 58 1 Y 1 A LYS 207 ? NZ ? A LYS 208 NZ 59 1 Y 1 A LYS 212 ? CD ? A LYS 213 CD 60 1 Y 1 A LYS 212 ? CE ? A LYS 213 CE 61 1 Y 1 A LYS 212 ? NZ ? A LYS 213 NZ 62 1 Y 1 A ARG 220 ? CD ? A ARG 221 CD 63 1 Y 1 A ARG 220 ? NE ? A ARG 221 NE 64 1 Y 1 A ARG 220 ? CZ ? A ARG 221 CZ 65 1 Y 1 A ARG 220 ? NH1 ? A ARG 221 NH1 66 1 Y 1 A ARG 220 ? NH2 ? A ARG 221 NH2 67 1 Y 1 A GLU 226 ? CG ? A GLU 227 CG 68 1 Y 1 A GLU 226 ? CD ? A GLU 227 CD 69 1 Y 1 A GLU 226 ? OE1 ? A GLU 227 OE1 70 1 Y 1 A GLU 226 ? OE2 ? A GLU 227 OE2 71 1 Y 1 A GLU 230 ? CG ? A GLU 231 CG 72 1 Y 1 A GLU 230 ? CD ? A GLU 231 CD 73 1 Y 1 A GLU 230 ? OE1 ? A GLU 231 OE1 74 1 Y 1 A GLU 230 ? OE2 ? A GLU 231 OE2 75 1 Y 1 A GLU 248 ? CD ? A GLU 249 CD 76 1 Y 1 A GLU 248 ? OE1 ? A GLU 249 OE1 77 1 Y 1 A GLU 248 ? OE2 ? A GLU 249 OE2 78 1 Y 1 A GLU 255 ? CD ? A GLU 256 CD 79 1 Y 1 A GLU 255 ? OE1 ? A GLU 256 OE1 80 1 Y 1 A GLU 255 ? OE2 ? A GLU 256 OE2 81 1 Y 1 A LYS 261 ? CE ? A LYS 262 CE 82 1 Y 1 A LYS 261 ? NZ ? A LYS 262 NZ 83 1 Y 1 A ASN 276 ? OD1 ? A ASN 277 OD1 84 1 Y 1 A ASN 276 ? ND2 ? A ASN 277 ND2 85 1 Y 1 A ARG 278 ? CD ? A ARG 279 CD 86 1 Y 1 A ARG 278 ? NE ? A ARG 279 NE 87 1 Y 1 A ARG 278 ? CZ ? A ARG 279 CZ 88 1 Y 1 A ARG 278 ? NH1 ? A ARG 279 NH1 89 1 Y 1 A ARG 278 ? NH2 ? A ARG 279 NH2 90 1 Y 1 A ARG 282 ? CD ? A ARG 283 CD 91 1 Y 1 A ARG 282 ? NE ? A ARG 283 NE 92 1 Y 1 A ARG 282 ? CZ ? A ARG 283 CZ 93 1 Y 1 A ARG 282 ? NH1 ? A ARG 283 NH1 94 1 Y 1 A ARG 282 ? NH2 ? A ARG 283 NH2 95 1 Y 1 A LEU 299 ? CG ? A LEU 300 CG 96 1 Y 1 A LEU 299 ? CD1 ? A LEU 300 CD1 97 1 Y 1 A LEU 299 ? CD2 ? A LEU 300 CD2 98 1 Y 1 A LYS 300 ? CG ? A LYS 301 CG 99 1 Y 1 A LYS 300 ? CD ? A LYS 301 CD 100 1 Y 1 A LYS 300 ? CE ? A LYS 301 CE 101 1 Y 1 A LYS 300 ? NZ ? A LYS 301 NZ 102 1 Y 1 A SER 302 ? OG ? A SER 303 OG 103 1 Y 1 A LYS 308 ? CD ? A LYS 309 CD 104 1 Y 1 A LYS 308 ? CE ? A LYS 309 CE 105 1 Y 1 A LYS 308 ? NZ ? A LYS 309 NZ 106 1 Y 1 A TYR 312 ? CD1 ? A TYR 313 CD1 107 1 Y 1 A TYR 312 ? CE1 ? A TYR 313 CE1 108 1 Y 1 A TYR 312 ? CE2 ? A TYR 313 CE2 109 1 Y 1 A TYR 312 ? CZ ? A TYR 313 CZ 110 1 Y 1 A TYR 312 ? OH ? A TYR 313 OH 111 1 Y 1 A GLU 323 ? CD ? A GLU 324 CD 112 1 Y 1 A GLU 323 ? OE1 ? A GLU 324 OE1 113 1 Y 1 A GLU 323 ? OE2 ? A GLU 324 OE2 114 1 Y 1 A LYS 333 ? NZ ? A LYS 334 NZ 115 1 Y 1 A GLU 336 ? CD ? A GLU 337 CD 116 1 Y 1 A GLU 336 ? OE1 ? A GLU 337 OE1 117 1 Y 1 A GLU 336 ? OE2 ? A GLU 337 OE2 118 1 Y 1 A GLU 337 ? CG ? A GLU 338 CG 119 1 Y 1 A GLU 337 ? CD ? A GLU 338 CD 120 1 Y 1 A GLU 337 ? OE1 ? A GLU 338 OE1 121 1 Y 1 A GLU 337 ? OE2 ? A GLU 338 OE2 122 1 Y 1 A GLU 339 ? CG ? A GLU 340 CG 123 1 Y 1 A GLU 339 ? CD ? A GLU 340 CD 124 1 Y 1 A GLU 339 ? OE1 ? A GLU 340 OE1 125 1 Y 1 A GLU 339 ? OE2 ? A GLU 340 OE2 # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 MOSFLM . ? package 'Andrew G.W. Leslie' andrew@mrc-lmb.cam.ac.uk 'data reduction' http://www.mrc-lmb.cam.ac.uk/harry/mosflm/ ? ? 2 SCALA 3.3.16 2010/01/06 other 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 'data scaling' http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 3 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 4 PDB_EXTRACT 3.10 'June 10, 2010' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 5 31ID . ? ? ? ? 'data collection' ? ? ? # _cell.entry_id 4ER6 _cell.length_a 149.907 _cell.length_b 149.907 _cell.length_c 52.839 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 6 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4ER6 _symmetry.space_group_name_H-M 'P 65' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 170 _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 4ER6 _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.64 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 66.23 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '3.5 M NaFormate, 0.1 M NaAcet, pH 4.5, VAPOR DIFFUSION, HANGING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MARMOSAIC 225 mm CCD' _diffrn_detector.pdbx_collection_date 2011-11-22 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979310 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 31-ID' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.979310 _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 31-ID # _reflns.entry_id 4ER6 _reflns.d_resolution_high 2.30 _reflns.d_resolution_low 50.148 _reflns.number_all 30402 _reflns.number_obs 30402 _reflns.pdbx_netI_over_sigmaI 18.300 _reflns.pdbx_Rsym_value 0.083 _reflns.pdbx_redundancy 11.100 _reflns.percent_possible_obs 99.900 _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.pdbx_Rmerge_I_obs ? _reflns.B_iso_Wilson_estimate ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.300 2.420 ? 49459 ? 0.986 0.800 0.986 ? 11.300 ? 4382 100.000 1 1 2.420 2.570 ? 47181 ? 0.682 1.100 0.682 ? 11.300 ? 4169 100.000 2 1 2.570 2.750 ? 44326 ? 0.439 1.700 0.439 ? 11.300 ? 3916 100.000 3 1 2.750 2.970 ? 41526 ? 0.253 3.000 0.253 ? 11.300 ? 3668 100.000 4 1 2.970 3.250 ? 38261 ? 0.136 5.600 0.136 ? 11.200 ? 3407 100.000 5 1 3.250 3.640 ? 33546 ? 0.078 9.300 0.078 ? 11.000 ? 3042 100.000 6 1 3.640 4.200 ? 29562 ? 0.055 11.800 0.055 ? 10.900 ? 2721 100.000 7 1 4.200 5.140 ? 24904 ? 0.044 14.200 0.044 ? 10.800 ? 2309 100.000 8 1 5.140 7.270 ? 19358 ? 0.043 14.700 0.043 ? 10.700 ? 1809 100.000 9 1 7.270 49.069 ? 9324 ? 0.030 20.900 0.030 ? 9.500 ? 979 95.500 10 1 # _refine.entry_id 4ER6 _refine.ls_d_res_high 2.3000 _refine.ls_d_res_low 35.0000 _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.7800 _refine.ls_number_reflns_obs 30370 _refine.ls_number_reflns_all 30436 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details 'PDB entry 3qow' _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.ls_R_factor_all .2169 _refine.ls_R_factor_obs 0.2169 _refine.ls_R_factor_R_work 0.2162 _refine.ls_wR_factor_R_work 0.2094 _refine.ls_R_factor_R_free 0.2300 _refine.ls_wR_factor_R_free 0.2219 _refine.ls_percent_reflns_R_free 4.9000 _refine.ls_number_reflns_R_free 1479 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 58.9458 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] -0.5100 _refine.aniso_B[2][2] -0.5100 _refine.aniso_B[3][3] 0.7600 _refine.aniso_B[1][2] -0.2500 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.correlation_coeff_Fo_to_Fc 0.9450 _refine.correlation_coeff_Fo_to_Fc_free 0.9350 _refine.overall_SU_R_Cruickshank_DPI 0.1948 _refine.overall_SU_R_free 0.1642 _refine.pdbx_overall_ESU_R 0.1950 _refine.pdbx_overall_ESU_R_Free 0.1640 _refine.overall_SU_ML 0.1380 _refine.overall_SU_B 12.4170 _refine.solvent_model_details MASK _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'FOURIER SYNTHESIS' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8368 _refine.B_iso_max 111.040 _refine.B_iso_min 34.460 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 0.300 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2600 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 42 _refine_hist.number_atoms_solvent 25 _refine_hist.number_atoms_total 2667 _refine_hist.d_res_high 2.3000 _refine_hist.d_res_low 35.0000 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 2736 0.012 0.019 ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 3733 1.044 1.936 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 340 5.080 5.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 116 32.649 23.621 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 424 14.338 15.000 ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 15 13.223 15.000 ? ? 'X-RAY DIFFRACTION' r_chiral_restr 411 0.068 0.200 ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 2084 0.004 0.021 ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 2.3000 _refine_ls_shell.d_res_low 2.3600 _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.percent_reflns_obs 100.0000 _refine_ls_shell.number_reflns_R_work 2021 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_R_work 0.3060 _refine_ls_shell.R_factor_R_free 0.3600 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 85 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.number_reflns_all 2106 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4ER6 _struct.title 'Crystal structure of human DOT1L in complex with inhibitor SGC0946' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4ER6 _struct_keywords.pdbx_keywords 'Transferase/Transferase Inhibitor' _struct_keywords.text ;histone, methyltransferase, epigenetics, Transferase-Transferase Inhibitor complex, Structural Genomics, Structural Genomics Consortium, SGC ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DOT1L_HUMAN _struct_ref.pdbx_db_accession Q8TEK3 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MGEKLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVLIDYDTKSFESMQRLCDKYNR AIDSIHQLWKGTTQPMKLNTRPSTGLLRHILQQVYNHSVTDPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTDDDLFV DLGSGVGQVVLQVAAATNCKHHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLKGSVSWTGKPVSYYLHTIDRT ILENYFSSLKNPKLREEQEAARRRQQRESKSNAATPTKGPEGKVAGPADAPMDSGAEEEKAGAATVKKPSPSKARKKKLN KKGRKMAGRKRG ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4ER6 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 413 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8TEK3 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 412 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 412 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4ER6 _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q8TEK3 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 0 _struct_ref_seq_dif.pdbx_ordinal 1 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # _struct_biol.id 1 _struct_biol.details 'AUTHORS STATE THAT THE BIOLOGICAL MOLECULE IS UNKNOWN.' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ALA A 34 ? ILE A 49 ? ALA A 33 ILE A 48 1 ? 16 HELX_P HELX_P2 2 ILE A 49 ? MET A 56 ? ILE A 48 MET A 55 1 ? 8 HELX_P HELX_P3 3 TYR A 59 ? ASP A 63 ? TYR A 58 ASP A 62 5 ? 5 HELX_P HELX_P4 4 SER A 68 ? GLY A 92 ? SER A 67 GLY A 91 1 ? 25 HELX_P HELX_P5 5 SER A 104 ? VAL A 120 ? SER A 103 VAL A 119 1 ? 17 HELX_P HELX_P6 6 SER A 133 ? GLU A 139 ? SER A 132 GLU A 138 5 ? 7 HELX_P HELX_P7 7 THR A 140 ? ILE A 152 ? THR A 139 ILE A 151 1 ? 13 HELX_P HELX_P8 8 GLY A 168 ? THR A 178 ? GLY A 167 THR A 177 1 ? 11 HELX_P HELX_P9 9 ALA A 189 ? GLY A 211 ? ALA A 188 GLY A 210 1 ? 23 HELX_P HELX_P10 10 SER A 226 ? ASN A 235 ? SER A 225 ASN A 234 1 ? 10 HELX_P HELX_P11 11 GLY A 247 ? ALA A 259 ? GLY A 246 ALA A 258 1 ? 13 HELX_P HELX_P12 12 ASP A 287 ? THR A 290 ? ASP A 286 THR A 289 5 ? 4 HELX_P HELX_P13 13 ARG A 320 ? ASN A 332 ? ARG A 319 ASN A 331 1 ? 13 HELX_P HELX_P14 14 ASN A 332 ? GLU A 340 ? ASN A 331 GLU A 339 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A LYS 53 O ? ? ? 1_555 D NA . NA ? ? A LYS 52 A NA 503 1_555 ? ? ? ? ? ? ? 2.808 ? ? metalc2 metalc ? ? A LEU 54 O ? ? ? 1_555 D NA . NA ? ? A LEU 53 A NA 503 1_555 ? ? ? ? ? ? ? 2.977 ? ? metalc3 metalc ? ? A MET 56 O ? ? ? 1_555 D NA . NA ? ? A MET 55 A NA 503 1_555 ? ? ? ? ? ? ? 2.474 ? ? metalc4 metalc ? ? A ASN 58 OD1 ? ? ? 1_555 D NA . NA ? ? A ASN 57 A NA 503 1_555 ? ? ? ? ? ? ? 2.528 ? ? metalc5 metalc ? ? D NA . NA ? ? ? 1_555 E HOH . O ? ? A NA 503 A HOH 624 1_555 ? ? ? ? ? ? ? 2.284 ? ? metalc6 metalc ? ? D NA . NA ? ? ? 1_555 E HOH . O ? ? A NA 503 A HOH 625 1_555 ? ? ? ? ? ? ? 2.206 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O ? A LYS 53 ? A LYS 52 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 O ? A LEU 54 ? A LEU 53 ? 1_555 75.0 ? 2 O ? A LYS 53 ? A LYS 52 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 O ? A MET 56 ? A MET 55 ? 1_555 85.3 ? 3 O ? A LEU 54 ? A LEU 53 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 O ? A MET 56 ? A MET 55 ? 1_555 88.3 ? 4 O ? A LYS 53 ? A LYS 52 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 OD1 ? A ASN 58 ? A ASN 57 ? 1_555 81.9 ? 5 O ? A LEU 54 ? A LEU 53 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 OD1 ? A ASN 58 ? A ASN 57 ? 1_555 153.0 ? 6 O ? A MET 56 ? A MET 55 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 OD1 ? A ASN 58 ? A ASN 57 ? 1_555 75.9 ? 7 O ? A LYS 53 ? A LYS 52 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 O ? E HOH . ? A HOH 624 ? 1_555 162.4 ? 8 O ? A LEU 54 ? A LEU 53 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 O ? E HOH . ? A HOH 624 ? 1_555 116.4 ? 9 O ? A MET 56 ? A MET 55 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 O ? E HOH . ? A HOH 624 ? 1_555 81.8 ? 10 OD1 ? A ASN 58 ? A ASN 57 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 O ? E HOH . ? A HOH 624 ? 1_555 83.3 ? 11 O ? A LYS 53 ? A LYS 52 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 O ? E HOH . ? A HOH 625 ? 1_555 93.0 ? 12 O ? A LEU 54 ? A LEU 53 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 O ? E HOH . ? A HOH 625 ? 1_555 95.0 ? 13 O ? A MET 56 ? A MET 55 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 O ? E HOH . ? A HOH 625 ? 1_555 175.8 ? 14 OD1 ? A ASN 58 ? A ASN 57 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 O ? E HOH . ? A HOH 625 ? 1_555 100.1 ? 15 O ? E HOH . ? A HOH 624 ? 1_555 NA ? D NA . ? A NA 503 ? 1_555 O ? E HOH . ? A HOH 625 ? 1_555 99.0 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id TRP _struct_mon_prot_cis.label_seq_id 23 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id TRP _struct_mon_prot_cis.auth_seq_id 22 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 24 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 23 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -4.46 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 2 ? B ? 2 ? C ? 7 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? parallel C 2 3 ? parallel C 3 4 ? parallel C 4 5 ? parallel C 5 6 ? anti-parallel C 6 7 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLU A 7 ? LEU A 10 ? GLU A 6 LEU A 9 A 2 ALA A 19 ? PRO A 22 ? ALA A 18 PRO A 21 B 1 VAL A 27 ? ASP A 29 ? VAL A 26 ASP A 28 B 2 HIS A 32 ? ASP A 33 ? HIS A 31 ASP A 32 C 1 TYR A 217 ? ARG A 221 ? TYR A 216 ARG A 220 C 2 HIS A 182 ? GLU A 187 ? HIS A 181 GLU A 186 C 3 LEU A 159 ? LEU A 163 ? LEU A 158 LEU A 162 C 4 VAL A 238 ? VAL A 241 ? VAL A 237 VAL A 240 C 5 ARG A 266 ? SER A 269 ? ARG A 265 SER A 268 C 6 TYR A 313 ? ILE A 318 ? TYR A 312 ILE A 317 C 7 MET A 292 ? LEU A 297 ? MET A 291 LEU A 296 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N LEU A 8 ? N LEU A 7 O TYR A 21 ? O TYR A 20 B 1 2 N TYR A 28 ? N TYR A 27 O HIS A 32 ? O HIS A 31 C 1 2 O GLU A 220 ? O GLU A 219 N GLY A 185 ? N GLY A 184 C 2 3 O TYR A 184 ? O TYR A 183 N ASP A 162 ? N ASP A 161 C 3 4 N LEU A 163 ? N LEU A 162 O PHE A 240 ? O PHE A 239 C 4 5 N ILE A 239 ? N ILE A 238 O VAL A 268 ? O VAL A 267 C 5 6 N ILE A 267 ? N ILE A 266 O HIS A 316 ? O HIS A 315 C 6 7 O TYR A 313 ? O TYR A 312 N LEU A 297 ? N LEU A 296 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A BR 501 ? 1 'BINDING SITE FOR RESIDUE BR A 501' AC2 Software A AW2 502 ? 19 'BINDING SITE FOR RESIDUE AW2 A 502' AC3 Software A NA 503 ? 7 'BINDING SITE FOR RESIDUE NA A 503' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 AW2 C . ? AW2 A 502 . ? 1_555 ? 2 AC2 19 TYR A 59 ? TYR A 58 . ? 4_664 ? 3 AC2 19 ASP A 162 ? ASP A 161 . ? 1_555 ? 4 AC2 19 GLY A 164 ? GLY A 163 . ? 1_555 ? 5 AC2 19 SER A 165 ? SER A 164 . ? 1_555 ? 6 AC2 19 GLY A 166 ? GLY A 165 . ? 1_555 ? 7 AC2 19 VAL A 170 ? VAL A 169 . ? 1_555 ? 8 AC2 19 GLU A 187 ? GLU A 186 . ? 1_555 ? 9 AC2 19 LYS A 188 ? LYS A 187 . ? 1_555 ? 10 AC2 19 ALA A 189 ? ALA A 188 . ? 1_555 ? 11 AC2 19 GLY A 222 ? GLY A 221 . ? 1_555 ? 12 AC2 19 ASP A 223 ? ASP A 222 . ? 1_555 ? 13 AC2 19 PHE A 224 ? PHE A 223 . ? 1_555 ? 14 AC2 19 PHE A 240 ? PHE A 239 . ? 1_555 ? 15 AC2 19 ASN A 242 ? ASN A 241 . ? 1_555 ? 16 AC2 19 PHE A 246 ? PHE A 245 . ? 1_555 ? 17 AC2 19 VAL A 268 ? VAL A 267 . ? 1_555 ? 18 AC2 19 SER A 269 ? SER A 268 . ? 1_555 ? 19 AC2 19 TYR A 313 ? TYR A 312 . ? 1_555 ? 20 AC2 19 BR B . ? BR A 501 . ? 1_555 ? 21 AC3 7 LYS A 53 ? LYS A 52 . ? 1_555 ? 22 AC3 7 LEU A 54 ? LEU A 53 . ? 1_555 ? 23 AC3 7 MET A 56 ? MET A 55 . ? 1_555 ? 24 AC3 7 ASN A 58 ? ASN A 57 . ? 1_555 ? 25 AC3 7 ARG A 336 ? ARG A 335 . ? 5_555 ? 26 AC3 7 HOH E . ? HOH A 624 . ? 1_555 ? 27 AC3 7 HOH E . ? HOH A 625 . ? 1_555 ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 62 ? ? -93.49 44.11 2 1 THR A 139 ? ? -131.90 -87.29 3 1 GLU A 339 ? ? -74.41 41.41 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Structural Genomics Consortium' _pdbx_SG_project.initial_of_center SGC # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 27.4566 _pdbx_refine_tls.origin_y 57.9540 _pdbx_refine_tls.origin_z 3.3779 _pdbx_refine_tls.T[1][1] 0.0607 _pdbx_refine_tls.T[2][2] 0.1052 _pdbx_refine_tls.T[3][3] 0.0121 _pdbx_refine_tls.T[1][2] 0.0154 _pdbx_refine_tls.T[1][3] 0.0045 _pdbx_refine_tls.T[2][3] 0.0167 _pdbx_refine_tls.L[1][1] 5.4689 _pdbx_refine_tls.L[2][2] 1.7620 _pdbx_refine_tls.L[3][3] 0.4016 _pdbx_refine_tls.L[1][2] -2.4320 _pdbx_refine_tls.L[1][3] -0.0130 _pdbx_refine_tls.L[2][3] 0.0238 _pdbx_refine_tls.S[1][1] -0.0223 _pdbx_refine_tls.S[2][2] -0.0322 _pdbx_refine_tls.S[3][3] 0.0545 _pdbx_refine_tls.S[1][2] 0.1930 _pdbx_refine_tls.S[1][3] 0.1269 _pdbx_refine_tls.S[2][3] -0.0318 _pdbx_refine_tls.S[2][1] -0.0330 _pdbx_refine_tls.S[3][1] 0.0299 _pdbx_refine_tls.S[3][2] 0.0048 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 4 _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 341 _pdbx_refine_tls_group.selection_details ? _pdbx_refine_tls_group.beg_label_asym_id . _pdbx_refine_tls_group.beg_label_seq_id . _pdbx_refine_tls_group.end_label_asym_id . _pdbx_refine_tls_group.end_label_seq_id . _pdbx_refine_tls_group.selection ? # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A MET 1 ? A MET 2 3 1 Y 1 A GLY 2 ? A GLY 3 4 1 Y 1 A GLU 3 ? A GLU 4 5 1 Y 1 A ASN 127 ? A ASN 128 6 1 Y 1 A TYR 128 ? A TYR 129 7 1 Y 1 A GLU 129 ? A GLU 130 8 1 Y 1 A ARG 342 ? A ARG 343 9 1 Y 1 A ARG 343 ? A ARG 344 10 1 Y 1 A ARG 344 ? A ARG 345 11 1 Y 1 A GLN 345 ? A GLN 346 12 1 Y 1 A GLN 346 ? A GLN 347 13 1 Y 1 A ARG 347 ? A ARG 348 14 1 Y 1 A GLU 348 ? A GLU 349 15 1 Y 1 A SER 349 ? A SER 350 16 1 Y 1 A LYS 350 ? A LYS 351 17 1 Y 1 A SER 351 ? A SER 352 18 1 Y 1 A ASN 352 ? A ASN 353 19 1 Y 1 A ALA 353 ? A ALA 354 20 1 Y 1 A ALA 354 ? A ALA 355 21 1 Y 1 A THR 355 ? A THR 356 22 1 Y 1 A PRO 356 ? A PRO 357 23 1 Y 1 A THR 357 ? A THR 358 24 1 Y 1 A LYS 358 ? A LYS 359 25 1 Y 1 A GLY 359 ? A GLY 360 26 1 Y 1 A PRO 360 ? A PRO 361 27 1 Y 1 A GLU 361 ? A GLU 362 28 1 Y 1 A GLY 362 ? A GLY 363 29 1 Y 1 A LYS 363 ? A LYS 364 30 1 Y 1 A VAL 364 ? A VAL 365 31 1 Y 1 A ALA 365 ? A ALA 366 32 1 Y 1 A GLY 366 ? A GLY 367 33 1 Y 1 A PRO 367 ? A PRO 368 34 1 Y 1 A ALA 368 ? A ALA 369 35 1 Y 1 A ASP 369 ? A ASP 370 36 1 Y 1 A ALA 370 ? A ALA 371 37 1 Y 1 A PRO 371 ? A PRO 372 38 1 Y 1 A MET 372 ? A MET 373 39 1 Y 1 A ASP 373 ? A ASP 374 40 1 Y 1 A SER 374 ? A SER 375 41 1 Y 1 A GLY 375 ? A GLY 376 42 1 Y 1 A ALA 376 ? A ALA 377 43 1 Y 1 A GLU 377 ? A GLU 378 44 1 Y 1 A GLU 378 ? A GLU 379 45 1 Y 1 A GLU 379 ? A GLU 380 46 1 Y 1 A LYS 380 ? A LYS 381 47 1 Y 1 A ALA 381 ? A ALA 382 48 1 Y 1 A GLY 382 ? A GLY 383 49 1 Y 1 A ALA 383 ? A ALA 384 50 1 Y 1 A ALA 384 ? A ALA 385 51 1 Y 1 A THR 385 ? A THR 386 52 1 Y 1 A VAL 386 ? A VAL 387 53 1 Y 1 A LYS 387 ? A LYS 388 54 1 Y 1 A LYS 388 ? A LYS 389 55 1 Y 1 A PRO 389 ? A PRO 390 56 1 Y 1 A SER 390 ? A SER 391 57 1 Y 1 A PRO 391 ? A PRO 392 58 1 Y 1 A SER 392 ? A SER 393 59 1 Y 1 A LYS 393 ? A LYS 394 60 1 Y 1 A ALA 394 ? A ALA 395 61 1 Y 1 A ARG 395 ? A ARG 396 62 1 Y 1 A LYS 396 ? A LYS 397 63 1 Y 1 A LYS 397 ? A LYS 398 64 1 Y 1 A LYS 398 ? A LYS 399 65 1 Y 1 A LEU 399 ? A LEU 400 66 1 Y 1 A ASN 400 ? A ASN 401 67 1 Y 1 A LYS 401 ? A LYS 402 68 1 Y 1 A LYS 402 ? A LYS 403 69 1 Y 1 A GLY 403 ? A GLY 404 70 1 Y 1 A ARG 404 ? A ARG 405 71 1 Y 1 A LYS 405 ? A LYS 406 72 1 Y 1 A MET 406 ? A MET 407 73 1 Y 1 A ALA 407 ? A ALA 408 74 1 Y 1 A GLY 408 ? A GLY 409 75 1 Y 1 A ARG 409 ? A ARG 410 76 1 Y 1 A LYS 410 ? A LYS 411 77 1 Y 1 A ARG 411 ? A ARG 412 78 1 Y 1 A GLY 412 ? A GLY 413 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 AW2 BR9 BR N N 74 AW2 N01 N N N 75 AW2 C02 C Y N 76 AW2 N03 N Y N 77 AW2 C04 C Y N 78 AW2 N05 N Y N 79 AW2 C06 C Y N 80 AW2 C07 C Y N 81 AW2 C08 C Y N 82 AW2 C10 C Y N 83 AW2 N11 N Y N 84 AW2 C12 C N R 85 AW2 O13 O N N 86 AW2 C14 C N R 87 AW2 C15 C N N 88 AW2 N16 N N R 89 AW2 C17 C N N 90 AW2 C18 C N N 91 AW2 C19 C N N 92 AW2 N20 N N N 93 AW2 C21 C N N 94 AW2 N22 N N N 95 AW2 C23 C Y N 96 AW2 C24 C Y N 97 AW2 C25 C Y N 98 AW2 C26 C Y N 99 AW2 C27 C N N 100 AW2 C28 C N N 101 AW2 C29 C N N 102 AW2 C30 C N N 103 AW2 C31 C Y N 104 AW2 C32 C Y N 105 AW2 O33 O N N 106 AW2 C34 C N N 107 AW2 C35 C N N 108 AW2 C36 C N N 109 AW2 C37 C N S 110 AW2 O38 O N N 111 AW2 C39 C N R 112 AW2 O40 O N N 113 AW2 HN01 H N N 114 AW2 HN0A H N N 115 AW2 H04 H N N 116 AW2 H10 H N N 117 AW2 H12 H N N 118 AW2 H14 H N N 119 AW2 H15 H N N 120 AW2 H15A H N N 121 AW2 H17 H N N 122 AW2 H17A H N N 123 AW2 H18 H N N 124 AW2 H18A H N N 125 AW2 H19 H N N 126 AW2 H19A H N N 127 AW2 HN20 H N N 128 AW2 HN22 H N N 129 AW2 H24 H N N 130 AW2 H25 H N N 131 AW2 H28 H N N 132 AW2 H28A H N N 133 AW2 H28B H N N 134 AW2 H29 H N N 135 AW2 H29A H N N 136 AW2 H29B H N N 137 AW2 H30 H N N 138 AW2 H30A H N N 139 AW2 H30B H N N 140 AW2 H31 H N N 141 AW2 H32 H N N 142 AW2 H34 H N N 143 AW2 H35 H N N 144 AW2 H35A H N N 145 AW2 H35B H N N 146 AW2 H36 H N N 147 AW2 H36A H N N 148 AW2 H36B H N N 149 AW2 H37 H N N 150 AW2 HO38 H N N 151 AW2 H39 H N N 152 AW2 HO40 H N N 153 BR BR BR N N 154 CYS N N N N 155 CYS CA C N R 156 CYS C C N N 157 CYS O O N N 158 CYS CB C N N 159 CYS SG S N N 160 CYS OXT O N N 161 CYS H H N N 162 CYS H2 H N N 163 CYS HA H N N 164 CYS HB2 H N N 165 CYS HB3 H N N 166 CYS HG H N N 167 CYS HXT H N N 168 GLN N N N N 169 GLN CA C N S 170 GLN C C N N 171 GLN O O N N 172 GLN CB C N N 173 GLN CG C N N 174 GLN CD C N N 175 GLN OE1 O N N 176 GLN NE2 N N N 177 GLN OXT O N N 178 GLN H H N N 179 GLN H2 H N N 180 GLN HA H N N 181 GLN HB2 H N N 182 GLN HB3 H N N 183 GLN HG2 H N N 184 GLN HG3 H N N 185 GLN HE21 H N N 186 GLN HE22 H N N 187 GLN HXT H N N 188 GLU N N N N 189 GLU CA C N S 190 GLU C C N N 191 GLU O O N N 192 GLU CB C N N 193 GLU CG C N N 194 GLU CD C N N 195 GLU OE1 O N N 196 GLU OE2 O N N 197 GLU OXT O N N 198 GLU H H N N 199 GLU H2 H N N 200 GLU HA H N N 201 GLU HB2 H N N 202 GLU HB3 H N N 203 GLU HG2 H N N 204 GLU HG3 H N N 205 GLU HE2 H N N 206 GLU HXT H N N 207 GLY N N N N 208 GLY CA C N N 209 GLY C C N N 210 GLY O O N N 211 GLY OXT O N N 212 GLY H H N N 213 GLY H2 H N N 214 GLY HA2 H N N 215 GLY HA3 H N N 216 GLY HXT H N N 217 HIS N N N N 218 HIS CA C N S 219 HIS C C N N 220 HIS O O N N 221 HIS CB C N N 222 HIS CG C Y N 223 HIS ND1 N Y N 224 HIS CD2 C Y N 225 HIS CE1 C Y N 226 HIS NE2 N Y N 227 HIS OXT O N N 228 HIS H H N N 229 HIS H2 H N N 230 HIS HA H N N 231 HIS HB2 H N N 232 HIS HB3 H N N 233 HIS HD1 H N N 234 HIS HD2 H N N 235 HIS HE1 H N N 236 HIS HE2 H N N 237 HIS HXT H N N 238 HOH O O N N 239 HOH H1 H N N 240 HOH H2 H N N 241 ILE N N N N 242 ILE CA C N S 243 ILE C C N N 244 ILE O O N N 245 ILE CB C N S 246 ILE CG1 C N N 247 ILE CG2 C N N 248 ILE CD1 C N N 249 ILE OXT O N N 250 ILE H H N N 251 ILE H2 H N N 252 ILE HA H N N 253 ILE HB H N N 254 ILE HG12 H N N 255 ILE HG13 H N N 256 ILE HG21 H N N 257 ILE HG22 H N N 258 ILE HG23 H N N 259 ILE HD11 H N N 260 ILE HD12 H N N 261 ILE HD13 H N N 262 ILE HXT H N N 263 LEU N N N N 264 LEU CA C N S 265 LEU C C N N 266 LEU O O N N 267 LEU CB C N N 268 LEU CG C N N 269 LEU CD1 C N N 270 LEU CD2 C N N 271 LEU OXT O N N 272 LEU H H N N 273 LEU H2 H N N 274 LEU HA H N N 275 LEU HB2 H N N 276 LEU HB3 H N N 277 LEU HG H N N 278 LEU HD11 H N N 279 LEU HD12 H N N 280 LEU HD13 H N N 281 LEU HD21 H N N 282 LEU HD22 H N N 283 LEU HD23 H N N 284 LEU HXT H N N 285 LYS N N N N 286 LYS CA C N S 287 LYS C C N N 288 LYS O O N N 289 LYS CB C N N 290 LYS CG C N N 291 LYS CD C N N 292 LYS CE C N N 293 LYS NZ N N N 294 LYS OXT O N N 295 LYS H H N N 296 LYS H2 H N N 297 LYS HA H N N 298 LYS HB2 H N N 299 LYS HB3 H N N 300 LYS HG2 H N N 301 LYS HG3 H N N 302 LYS HD2 H N N 303 LYS HD3 H N N 304 LYS HE2 H N N 305 LYS HE3 H N N 306 LYS HZ1 H N N 307 LYS HZ2 H N N 308 LYS HZ3 H N N 309 LYS HXT H N N 310 MET N N N N 311 MET CA C N S 312 MET C C N N 313 MET O O N N 314 MET CB C N N 315 MET CG C N N 316 MET SD S N N 317 MET CE C N N 318 MET OXT O N N 319 MET H H N N 320 MET H2 H N N 321 MET HA H N N 322 MET HB2 H N N 323 MET HB3 H N N 324 MET HG2 H N N 325 MET HG3 H N N 326 MET HE1 H N N 327 MET HE2 H N N 328 MET HE3 H N N 329 MET HXT H N N 330 NA NA NA N N 331 PHE N N N N 332 PHE CA C N S 333 PHE C C N N 334 PHE O O N N 335 PHE CB C N N 336 PHE CG C Y N 337 PHE CD1 C Y N 338 PHE CD2 C Y N 339 PHE CE1 C Y N 340 PHE CE2 C Y N 341 PHE CZ C Y N 342 PHE OXT O N N 343 PHE H H N N 344 PHE H2 H N N 345 PHE HA H N N 346 PHE HB2 H N N 347 PHE HB3 H N N 348 PHE HD1 H N N 349 PHE HD2 H N N 350 PHE HE1 H N N 351 PHE HE2 H N N 352 PHE HZ H N N 353 PHE HXT H N N 354 PRO N N N N 355 PRO CA C N S 356 PRO C C N N 357 PRO O O N N 358 PRO CB C N N 359 PRO CG C N N 360 PRO CD C N N 361 PRO OXT O N N 362 PRO H H N N 363 PRO HA H N N 364 PRO HB2 H N N 365 PRO HB3 H N N 366 PRO HG2 H N N 367 PRO HG3 H N N 368 PRO HD2 H N N 369 PRO HD3 H N N 370 PRO HXT H N N 371 SER N N N N 372 SER CA C N S 373 SER C C N N 374 SER O O N N 375 SER CB C N N 376 SER OG O N N 377 SER OXT O N N 378 SER H H N N 379 SER H2 H N N 380 SER HA H N N 381 SER HB2 H N N 382 SER HB3 H N N 383 SER HG H N N 384 SER HXT H N N 385 THR N N N N 386 THR CA C N S 387 THR C C N N 388 THR O O N N 389 THR CB C N R 390 THR OG1 O N N 391 THR CG2 C N N 392 THR OXT O N N 393 THR H H N N 394 THR H2 H N N 395 THR HA H N N 396 THR HB H N N 397 THR HG1 H N N 398 THR HG21 H N N 399 THR HG22 H N N 400 THR HG23 H N N 401 THR HXT H N N 402 TRP N N N N 403 TRP CA C N S 404 TRP C C N N 405 TRP O O N N 406 TRP CB C N N 407 TRP CG C Y N 408 TRP CD1 C Y N 409 TRP CD2 C Y N 410 TRP NE1 N Y N 411 TRP CE2 C Y N 412 TRP CE3 C Y N 413 TRP CZ2 C Y N 414 TRP CZ3 C Y N 415 TRP CH2 C Y N 416 TRP OXT O N N 417 TRP H H N N 418 TRP H2 H N N 419 TRP HA H N N 420 TRP HB2 H N N 421 TRP HB3 H N N 422 TRP HD1 H N N 423 TRP HE1 H N N 424 TRP HE3 H N N 425 TRP HZ2 H N N 426 TRP HZ3 H N N 427 TRP HH2 H N N 428 TRP HXT H N N 429 TYR N N N N 430 TYR CA C N S 431 TYR C C N N 432 TYR O O N N 433 TYR CB C N N 434 TYR CG C Y N 435 TYR CD1 C Y N 436 TYR CD2 C Y N 437 TYR CE1 C Y N 438 TYR CE2 C Y N 439 TYR CZ C Y N 440 TYR OH O N N 441 TYR OXT O N N 442 TYR H H N N 443 TYR H2 H N N 444 TYR HA H N N 445 TYR HB2 H N N 446 TYR HB3 H N N 447 TYR HD1 H N N 448 TYR HD2 H N N 449 TYR HE1 H N N 450 TYR HE2 H N N 451 TYR HH H N N 452 TYR HXT H N N 453 VAL N N N N 454 VAL CA C N S 455 VAL C C N N 456 VAL O O N N 457 VAL CB C N N 458 VAL CG1 C N N 459 VAL CG2 C N N 460 VAL OXT O N N 461 VAL H H N N 462 VAL H2 H N N 463 VAL HA H N N 464 VAL HB H N N 465 VAL HG11 H N N 466 VAL HG12 H N N 467 VAL HG13 H N N 468 VAL HG21 H N N 469 VAL HG22 H N N 470 VAL HG23 H N N 471 VAL HXT H N N 472 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 AW2 BR9 C08 sing N N 70 AW2 N01 C02 sing N N 71 AW2 N01 HN01 sing N N 72 AW2 N01 HN0A sing N N 73 AW2 C02 C07 doub Y N 74 AW2 C02 N03 sing Y N 75 AW2 N03 C04 doub Y N 76 AW2 C04 N05 sing Y N 77 AW2 C04 H04 sing N N 78 AW2 C06 N05 doub Y N 79 AW2 C07 C06 sing Y N 80 AW2 C06 N11 sing Y N 81 AW2 C08 C07 sing Y N 82 AW2 C08 C10 doub Y N 83 AW2 C10 N11 sing Y N 84 AW2 C10 H10 sing N N 85 AW2 N11 C12 sing N N 86 AW2 C39 C12 sing N N 87 AW2 C12 O13 sing N N 88 AW2 C12 H12 sing N N 89 AW2 O13 C14 sing N N 90 AW2 C37 C14 sing N N 91 AW2 C14 C15 sing N N 92 AW2 C14 H14 sing N N 93 AW2 C15 N16 sing N N 94 AW2 C15 H15 sing N N 95 AW2 C15 H15A sing N N 96 AW2 N16 C34 sing N N 97 AW2 N16 C17 sing N N 98 AW2 C18 C17 sing N N 99 AW2 C17 H17 sing N N 100 AW2 C17 H17A sing N N 101 AW2 C18 C19 sing N N 102 AW2 C18 H18 sing N N 103 AW2 C18 H18A sing N N 104 AW2 C19 N20 sing N N 105 AW2 C19 H19 sing N N 106 AW2 C19 H19A sing N N 107 AW2 N20 C21 sing N N 108 AW2 N20 HN20 sing N N 109 AW2 C21 O33 doub N N 110 AW2 C21 N22 sing N N 111 AW2 N22 C23 sing N N 112 AW2 N22 HN22 sing N N 113 AW2 C23 C24 doub Y N 114 AW2 C23 C32 sing Y N 115 AW2 C24 C25 sing Y N 116 AW2 C24 H24 sing N N 117 AW2 C25 C26 doub Y N 118 AW2 C25 H25 sing N N 119 AW2 C31 C26 sing Y N 120 AW2 C26 C27 sing N N 121 AW2 C28 C27 sing N N 122 AW2 C27 C30 sing N N 123 AW2 C27 C29 sing N N 124 AW2 C28 H28 sing N N 125 AW2 C28 H28A sing N N 126 AW2 C28 H28B sing N N 127 AW2 C29 H29 sing N N 128 AW2 C29 H29A sing N N 129 AW2 C29 H29B sing N N 130 AW2 C30 H30 sing N N 131 AW2 C30 H30A sing N N 132 AW2 C30 H30B sing N N 133 AW2 C32 C31 doub Y N 134 AW2 C31 H31 sing N N 135 AW2 C32 H32 sing N N 136 AW2 C36 C34 sing N N 137 AW2 C35 C34 sing N N 138 AW2 C34 H34 sing N N 139 AW2 C35 H35 sing N N 140 AW2 C35 H35A sing N N 141 AW2 C35 H35B sing N N 142 AW2 C36 H36 sing N N 143 AW2 C36 H36A sing N N 144 AW2 C36 H36B sing N N 145 AW2 C39 C37 sing N N 146 AW2 O38 C37 sing N N 147 AW2 C37 H37 sing N N 148 AW2 O38 HO38 sing N N 149 AW2 O40 C39 sing N N 150 AW2 C39 H39 sing N N 151 AW2 O40 HO40 sing N N 152 CYS N CA sing N N 153 CYS N H sing N N 154 CYS N H2 sing N N 155 CYS CA C sing N N 156 CYS CA CB sing N N 157 CYS CA HA sing N N 158 CYS C O doub N N 159 CYS C OXT sing N N 160 CYS CB SG sing N N 161 CYS CB HB2 sing N N 162 CYS CB HB3 sing N N 163 CYS SG HG sing N N 164 CYS OXT HXT sing N N 165 GLN N CA sing N N 166 GLN N H sing N N 167 GLN N H2 sing N N 168 GLN CA C sing N N 169 GLN CA CB sing N N 170 GLN CA HA sing N N 171 GLN C O doub N N 172 GLN C OXT sing N N 173 GLN CB CG sing N N 174 GLN CB HB2 sing N N 175 GLN CB HB3 sing N N 176 GLN CG CD sing N N 177 GLN CG HG2 sing N N 178 GLN CG HG3 sing N N 179 GLN CD OE1 doub N N 180 GLN CD NE2 sing N N 181 GLN NE2 HE21 sing N N 182 GLN NE2 HE22 sing N N 183 GLN OXT HXT sing N N 184 GLU N CA sing N N 185 GLU N H sing N N 186 GLU N H2 sing N N 187 GLU CA C sing N N 188 GLU CA CB sing N N 189 GLU CA HA sing N N 190 GLU C O doub N N 191 GLU C OXT sing N N 192 GLU CB CG sing N N 193 GLU CB HB2 sing N N 194 GLU CB HB3 sing N N 195 GLU CG CD sing N N 196 GLU CG HG2 sing N N 197 GLU CG HG3 sing N N 198 GLU CD OE1 doub N N 199 GLU CD OE2 sing N N 200 GLU OE2 HE2 sing N N 201 GLU OXT HXT sing N N 202 GLY N CA sing N N 203 GLY N H sing N N 204 GLY N H2 sing N N 205 GLY CA C sing N N 206 GLY CA HA2 sing N N 207 GLY CA HA3 sing N N 208 GLY C O doub N N 209 GLY C OXT sing N N 210 GLY OXT HXT sing N N 211 HIS N CA sing N N 212 HIS N H sing N N 213 HIS N H2 sing N N 214 HIS CA C sing N N 215 HIS CA CB sing N N 216 HIS CA HA sing N N 217 HIS C O doub N N 218 HIS C OXT sing N N 219 HIS CB CG sing N N 220 HIS CB HB2 sing N N 221 HIS CB HB3 sing N N 222 HIS CG ND1 sing Y N 223 HIS CG CD2 doub Y N 224 HIS ND1 CE1 doub Y N 225 HIS ND1 HD1 sing N N 226 HIS CD2 NE2 sing Y N 227 HIS CD2 HD2 sing N N 228 HIS CE1 NE2 sing Y N 229 HIS CE1 HE1 sing N N 230 HIS NE2 HE2 sing N N 231 HIS OXT HXT sing N N 232 HOH O H1 sing N N 233 HOH O H2 sing N N 234 ILE N CA sing N N 235 ILE N H sing N N 236 ILE N H2 sing N N 237 ILE CA C sing N N 238 ILE CA CB sing N N 239 ILE CA HA sing N N 240 ILE C O doub N N 241 ILE C OXT sing N N 242 ILE CB CG1 sing N N 243 ILE CB CG2 sing N N 244 ILE CB HB sing N N 245 ILE CG1 CD1 sing N N 246 ILE CG1 HG12 sing N N 247 ILE CG1 HG13 sing N N 248 ILE CG2 HG21 sing N N 249 ILE CG2 HG22 sing N N 250 ILE CG2 HG23 sing N N 251 ILE CD1 HD11 sing N N 252 ILE CD1 HD12 sing N N 253 ILE CD1 HD13 sing N N 254 ILE OXT HXT sing N N 255 LEU N CA sing N N 256 LEU N H sing N N 257 LEU N H2 sing N N 258 LEU CA C sing N N 259 LEU CA CB sing N N 260 LEU CA HA sing N N 261 LEU C O doub N N 262 LEU C OXT sing N N 263 LEU CB CG sing N N 264 LEU CB HB2 sing N N 265 LEU CB HB3 sing N N 266 LEU CG CD1 sing N N 267 LEU CG CD2 sing N N 268 LEU CG HG sing N N 269 LEU CD1 HD11 sing N N 270 LEU CD1 HD12 sing N N 271 LEU CD1 HD13 sing N N 272 LEU CD2 HD21 sing N N 273 LEU CD2 HD22 sing N N 274 LEU CD2 HD23 sing N N 275 LEU OXT HXT sing N N 276 LYS N CA sing N N 277 LYS N H sing N N 278 LYS N H2 sing N N 279 LYS CA C sing N N 280 LYS CA CB sing N N 281 LYS CA HA sing N N 282 LYS C O doub N N 283 LYS C OXT sing N N 284 LYS CB CG sing N N 285 LYS CB HB2 sing N N 286 LYS CB HB3 sing N N 287 LYS CG CD sing N N 288 LYS CG HG2 sing N N 289 LYS CG HG3 sing N N 290 LYS CD CE sing N N 291 LYS CD HD2 sing N N 292 LYS CD HD3 sing N N 293 LYS CE NZ sing N N 294 LYS CE HE2 sing N N 295 LYS CE HE3 sing N N 296 LYS NZ HZ1 sing N N 297 LYS NZ HZ2 sing N N 298 LYS NZ HZ3 sing N N 299 LYS OXT HXT sing N N 300 MET N CA sing N N 301 MET N H sing N N 302 MET N H2 sing N N 303 MET CA C sing N N 304 MET CA CB sing N N 305 MET CA HA sing N N 306 MET C O doub N N 307 MET C OXT sing N N 308 MET CB CG sing N N 309 MET CB HB2 sing N N 310 MET CB HB3 sing N N 311 MET CG SD sing N N 312 MET CG HG2 sing N N 313 MET CG HG3 sing N N 314 MET SD CE sing N N 315 MET CE HE1 sing N N 316 MET CE HE2 sing N N 317 MET CE HE3 sing N N 318 MET OXT HXT sing N N 319 PHE N CA sing N N 320 PHE N H sing N N 321 PHE N H2 sing N N 322 PHE CA C sing N N 323 PHE CA CB sing N N 324 PHE CA HA sing N N 325 PHE C O doub N N 326 PHE C OXT sing N N 327 PHE CB CG sing N N 328 PHE CB HB2 sing N N 329 PHE CB HB3 sing N N 330 PHE CG CD1 doub Y N 331 PHE CG CD2 sing Y N 332 PHE CD1 CE1 sing Y N 333 PHE CD1 HD1 sing N N 334 PHE CD2 CE2 doub Y N 335 PHE CD2 HD2 sing N N 336 PHE CE1 CZ doub Y N 337 PHE CE1 HE1 sing N N 338 PHE CE2 CZ sing Y N 339 PHE CE2 HE2 sing N N 340 PHE CZ HZ sing N N 341 PHE OXT HXT sing N N 342 PRO N CA sing N N 343 PRO N CD sing N N 344 PRO N H sing N N 345 PRO CA C sing N N 346 PRO CA CB sing N N 347 PRO CA HA sing N N 348 PRO C O doub N N 349 PRO C OXT sing N N 350 PRO CB CG sing N N 351 PRO CB HB2 sing N N 352 PRO CB HB3 sing N N 353 PRO CG CD sing N N 354 PRO CG HG2 sing N N 355 PRO CG HG3 sing N N 356 PRO CD HD2 sing N N 357 PRO CD HD3 sing N N 358 PRO OXT HXT sing N N 359 SER N CA sing N N 360 SER N H sing N N 361 SER N H2 sing N N 362 SER CA C sing N N 363 SER CA CB sing N N 364 SER CA HA sing N N 365 SER C O doub N N 366 SER C OXT sing N N 367 SER CB OG sing N N 368 SER CB HB2 sing N N 369 SER CB HB3 sing N N 370 SER OG HG sing N N 371 SER OXT HXT sing N N 372 THR N CA sing N N 373 THR N H sing N N 374 THR N H2 sing N N 375 THR CA C sing N N 376 THR CA CB sing N N 377 THR CA HA sing N N 378 THR C O doub N N 379 THR C OXT sing N N 380 THR CB OG1 sing N N 381 THR CB CG2 sing N N 382 THR CB HB sing N N 383 THR OG1 HG1 sing N N 384 THR CG2 HG21 sing N N 385 THR CG2 HG22 sing N N 386 THR CG2 HG23 sing N N 387 THR OXT HXT sing N N 388 TRP N CA sing N N 389 TRP N H sing N N 390 TRP N H2 sing N N 391 TRP CA C sing N N 392 TRP CA CB sing N N 393 TRP CA HA sing N N 394 TRP C O doub N N 395 TRP C OXT sing N N 396 TRP CB CG sing N N 397 TRP CB HB2 sing N N 398 TRP CB HB3 sing N N 399 TRP CG CD1 doub Y N 400 TRP CG CD2 sing Y N 401 TRP CD1 NE1 sing Y N 402 TRP CD1 HD1 sing N N 403 TRP CD2 CE2 doub Y N 404 TRP CD2 CE3 sing Y N 405 TRP NE1 CE2 sing Y N 406 TRP NE1 HE1 sing N N 407 TRP CE2 CZ2 sing Y N 408 TRP CE3 CZ3 doub Y N 409 TRP CE3 HE3 sing N N 410 TRP CZ2 CH2 doub Y N 411 TRP CZ2 HZ2 sing N N 412 TRP CZ3 CH2 sing Y N 413 TRP CZ3 HZ3 sing N N 414 TRP CH2 HH2 sing N N 415 TRP OXT HXT sing N N 416 TYR N CA sing N N 417 TYR N H sing N N 418 TYR N H2 sing N N 419 TYR CA C sing N N 420 TYR CA CB sing N N 421 TYR CA HA sing N N 422 TYR C O doub N N 423 TYR C OXT sing N N 424 TYR CB CG sing N N 425 TYR CB HB2 sing N N 426 TYR CB HB3 sing N N 427 TYR CG CD1 doub Y N 428 TYR CG CD2 sing Y N 429 TYR CD1 CE1 sing Y N 430 TYR CD1 HD1 sing N N 431 TYR CD2 CE2 doub Y N 432 TYR CD2 HD2 sing N N 433 TYR CE1 CZ doub Y N 434 TYR CE1 HE1 sing N N 435 TYR CE2 CZ sing Y N 436 TYR CE2 HE2 sing N N 437 TYR CZ OH sing N N 438 TYR OH HH sing N N 439 TYR OXT HXT sing N N 440 VAL N CA sing N N 441 VAL N H sing N N 442 VAL N H2 sing N N 443 VAL CA C sing N N 444 VAL CA CB sing N N 445 VAL CA HA sing N N 446 VAL C O doub N N 447 VAL C OXT sing N N 448 VAL CB CG1 sing N N 449 VAL CB CG2 sing N N 450 VAL CB HB sing N N 451 VAL CG1 HG11 sing N N 452 VAL CG1 HG12 sing N N 453 VAL CG1 HG13 sing N N 454 VAL CG2 HG21 sing N N 455 VAL CG2 HG22 sing N N 456 VAL CG2 HG23 sing N N 457 VAL OXT HXT sing N N 458 # _atom_sites.entry_id 4ER6 _atom_sites.fract_transf_matrix[1][1] 0.006671 _atom_sites.fract_transf_matrix[1][2] 0.003851 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.007703 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.018925 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol BR C N NA O S # loop_