data_4FAE # _entry.id 4FAE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.373 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4FAE pdb_00004fae 10.2210/pdb4fae/pdb RCSB RCSB072655 ? ? WWPDB D_1000072655 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4FAF 'Substrate CA/p2 in Complex with a Human Immunodeficiency Virus Type 1 Protease Variant' unspecified PDB 1TW7 'Uncomplexed multi-drug resistant HIV-1 protease variant, MDR 769' unspecified PDB 3OQ7 'Uncomplexed multi-drug resistant HIV-1 protease variant, MDR 769 82T' unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4FAE _pdbx_database_status.recvd_initial_deposition_date 2012-05-22 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wang, Y.' 1 'Dewdney, T.G.' 2 'Liu, Z.' 3 'Reiter, S.J.' 4 'Brunzelle, J.S.' 5 'Kovari, I.A.' 6 'Kovari, L.C.' 7 # _citation.id primary _citation.title 'Higher Desolvation Energy Reduces Molecular Recognition in Multi-Drug Resistant HIV-1 Protease.' _citation.journal_abbrev 'Biology (Basel)' _citation.journal_volume 1 _citation.page_first 81 _citation.page_last 93 _citation.year 2012 _citation.journal_id_ASTM ? _citation.country CH _citation.journal_id_ISSN 2079-7737 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24832048 _citation.pdbx_database_id_DOI 10.3390/biology1010081 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wang, Y.' 1 ? primary 'Dewdney, T.G.' 2 ? primary 'Liu, Z.' 3 ? primary 'Reiter, S.J.' 4 ? primary 'Brunzelle, J.S.' 5 ? primary 'Kovari, I.A.' 6 ? primary 'Kovari, L.C.' 7 ? # _cell.entry_id 4FAE _cell.length_a 28.615 _cell.length_b 63.851 _cell.length_c 91.113 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4FAE _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'HIV-1 protease' 10769.635 2 3.4.23.16 'D25N, D35E, I36V, M46L' ? ? 2 polymer syn 'Substrate p2/NC peptide' 837.043 1 ? ? ? ? 3 water nat water 18.015 185 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPT PTNVIGRNLMTQIGCTLNF ; ;PQITLWQRPIVTIKIGGQLKEALLNTGADDTVLEEVNLPGRWKPKLIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPT PTNVIGRNLMTQIGCTLNF ; A,B ? 2 'polypeptide(L)' no no TIMMQRG TIMMQRG D ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 PRO n 1 2 GLN n 1 3 ILE n 1 4 THR n 1 5 LEU n 1 6 TRP n 1 7 GLN n 1 8 ARG n 1 9 PRO n 1 10 ILE n 1 11 VAL n 1 12 THR n 1 13 ILE n 1 14 LYS n 1 15 ILE n 1 16 GLY n 1 17 GLY n 1 18 GLN n 1 19 LEU n 1 20 LYS n 1 21 GLU n 1 22 ALA n 1 23 LEU n 1 24 LEU n 1 25 ASN n 1 26 THR n 1 27 GLY n 1 28 ALA n 1 29 ASP n 1 30 ASP n 1 31 THR n 1 32 VAL n 1 33 LEU n 1 34 GLU n 1 35 GLU n 1 36 VAL n 1 37 ASN n 1 38 LEU n 1 39 PRO n 1 40 GLY n 1 41 ARG n 1 42 TRP n 1 43 LYS n 1 44 PRO n 1 45 LYS n 1 46 LEU n 1 47 ILE n 1 48 GLY n 1 49 GLY n 1 50 ILE n 1 51 GLY n 1 52 GLY n 1 53 PHE n 1 54 VAL n 1 55 LYS n 1 56 VAL n 1 57 ARG n 1 58 GLN n 1 59 TYR n 1 60 ASP n 1 61 GLN n 1 62 VAL n 1 63 PRO n 1 64 ILE n 1 65 GLU n 1 66 ILE n 1 67 CYS n 1 68 GLY n 1 69 HIS n 1 70 LYS n 1 71 VAL n 1 72 ILE n 1 73 GLY n 1 74 THR n 1 75 VAL n 1 76 LEU n 1 77 VAL n 1 78 GLY n 1 79 PRO n 1 80 THR n 1 81 PRO n 1 82 THR n 1 83 ASN n 1 84 VAL n 1 85 ILE n 1 86 GLY n 1 87 ARG n 1 88 ASN n 1 89 LEU n 1 90 MET n 1 91 THR n 1 92 GLN n 1 93 ILE n 1 94 GLY n 1 95 CYS n 1 96 THR n 1 97 LEU n 1 98 ASN n 1 99 PHE n 2 1 THR n 2 2 ILE n 2 3 MET n 2 4 MET n 2 5 GLN n 2 6 ARG n 2 7 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Human immunodeficiency virus 1' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 11676 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Human immunodeficiency virus 1' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 11676 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP Q000H7_9HIV1 Q000H7 1 ;PQITLWQRPIVTIKIGGQLKEALLDTGADDTVLEDINLPGRWKPKMIGGIGGFVKVRQYDQVPIEICGHKVIGTVLVGPT PTNVIGRNLMTQIGCTLNF ; 1 ? 2 UNP Q9YP46_9HIV1 Q9YP46 2 TIMMQRG 375 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4FAE A 1 ? 99 ? Q000H7 1 ? 99 ? 1 99 2 1 4FAE B 1 ? 99 ? Q000H7 1 ? 99 ? 1 99 3 2 4FAE D 1 ? 7 ? Q9YP46 375 ? 381 ? 1 7 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4FAE ASN A 25 ? UNP Q000H7 ASP 25 'engineered mutation' 25 1 1 4FAE GLU A 35 ? UNP Q000H7 ASP 35 'engineered mutation' 35 2 1 4FAE VAL A 36 ? UNP Q000H7 ILE 36 'engineered mutation' 36 3 1 4FAE LEU A 46 ? UNP Q000H7 MET 46 'engineered mutation' 46 4 2 4FAE ASN B 25 ? UNP Q000H7 ASP 25 'engineered mutation' 25 5 2 4FAE GLU B 35 ? UNP Q000H7 ASP 35 'engineered mutation' 35 6 2 4FAE VAL B 36 ? UNP Q000H7 ILE 36 'engineered mutation' 36 7 2 4FAE LEU B 46 ? UNP Q000H7 MET 46 'engineered mutation' 46 8 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4FAE _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.86 _exptl_crystal.density_percent_sol 33.87 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.2 _exptl_crystal_grow.pdbx_details '0.1 M citric acid, 2.4 M ammonium sulfate, pH 5.2, VAPOR DIFFUSION, HANGING DROP, temperature 298K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'RAYONIX MX325HE' _diffrn_detector.pdbx_collection_date 2011-07-25 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength . _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 21-ID-D' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 21-ID-D _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list ? # _reflns.entry_id 4FAE _reflns.observed_criterion_sigma_I ? _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 52.29 _reflns.d_resolution_high 2.30 _reflns.number_obs 7945 _reflns.number_all ? _reflns.percent_possible_obs ? _reflns.pdbx_Rmerge_I_obs 0.114 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 10.0 _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 4.0 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_low _reflns_shell.d_res_high _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.38 2.30 ? 0.451 ? ? 4.0 ? ? ? ? ? ? 1 1 2.48 2.38 ? 0.424 ? ? 4.1 ? ? ? ? ? ? 2 1 2.59 2.48 ? 0.318 ? ? 4.0 ? ? ? ? ? ? 3 1 2.73 2.59 ? 0.241 ? ? 4.1 ? ? ? ? ? ? 4 1 2.90 2.73 ? 0.204 ? ? 3.9 ? ? ? ? ? ? 5 1 3.12 2.90 ? 0.143 ? ? 4.0 ? ? ? ? ? ? 6 1 3.43 3.12 ? 0.102 ? ? 4.0 ? ? ? ? ? ? 7 1 3.93 3.43 ? 0.082 ? ? 4.0 ? ? ? ? ? ? 8 1 4.95 3.93 ? 0.074 ? ? 3.9 ? ? ? ? ? ? 9 1 30.0 4.95 ? 0.069 ? ? 3.7 ? ? ? ? ? ? 10 1 # _refine.entry_id 4FAE _refine.ls_number_reflns_obs 7453 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 30.0 _refine.ls_d_res_high 2.30 _refine.ls_percent_reflns_obs 98.71 _refine.ls_R_factor_obs 0.20345 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.19998 _refine.ls_R_factor_R_free 0.27864 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.6 _refine.ls_number_reflns_R_free 360 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.947 _refine.correlation_coeff_Fo_to_Fc_free 0.890 _refine.B_iso_mean 32.209 _refine.aniso_B[1][1] -1.47 _refine.aniso_B[2][2] 2.67 _refine.aniso_B[3][3] -1.20 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.40 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN ADDED IN THE RIDING POSITIONS' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 1.306 _refine.pdbx_overall_ESU_R_Free 0.322 _refine.overall_SU_ML 0.204 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 8.712 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1570 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 185 _refine_hist.number_atoms_total 1755 _refine_hist.d_res_high 2.30 _refine_hist.d_res_low 30.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.010 0.022 ? 1615 ? 'X-RAY DIFFRACTION' r_bond_other_d ? ? ? ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.412 1.984 ? 2196 ? 'X-RAY DIFFRACTION' r_angle_other_deg ? ? ? ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 7.162 5.000 ? 208 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 41.198 24.643 ? 56 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 23.013 15.000 ? 295 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 20.699 15.000 ? 9 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.103 0.200 ? 264 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.014 0.021 ? 1165 ? 'X-RAY DIFFRACTION' r_gen_planes_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_nbtor_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_xyhbond_nbd_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_vdw_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_hbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_refined ? ? ? ? ? 'X-RAY DIFFRACTION' r_symmetry_metal_ion_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcbond_it 0.937 1.500 ? 1024 ? 'X-RAY DIFFRACTION' r_mcbond_other ? ? ? ? ? 'X-RAY DIFFRACTION' r_mcangle_it 1.711 2.000 ? 1678 ? 'X-RAY DIFFRACTION' r_scbond_it 2.828 3.000 ? 591 ? 'X-RAY DIFFRACTION' r_scangle_it 4.526 4.500 ? 516 ? 'X-RAY DIFFRACTION' r_rigid_bond_restr ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_free ? ? ? ? ? 'X-RAY DIFFRACTION' r_sphericity_bonded ? ? ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.300 _refine_ls_shell.d_res_low 2.360 _refine_ls_shell.number_reflns_R_work 538 _refine_ls_shell.R_factor_R_work 0.249 _refine_ls_shell.percent_reflns_obs 97.05 _refine_ls_shell.R_factor_R_free 0.334 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 21 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4FAE _struct.title 'Substrate p2/NC in Complex with a Human Immunodeficiency Virus Type 1 Protease Variant' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4FAE _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'protease, VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? F N N 3 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLY A 86 ? THR A 91 ? GLY A 86 THR A 91 1 ? 6 HELX_P HELX_P2 2 GLN A 92 ? GLY A 94 ? GLN A 92 GLY A 94 5 ? 3 HELX_P HELX_P3 3 GLY B 86 ? GLY B 94 ? GLY B 86 GLY B 94 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 8 ? C ? 8 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? parallel B 4 5 ? anti-parallel B 5 6 ? parallel B 6 7 ? anti-parallel B 7 8 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? parallel C 4 5 ? anti-parallel C 5 6 ? parallel C 6 7 ? anti-parallel C 7 8 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLN A 2 ? ILE A 3 ? GLN A 2 ILE A 3 A 2 THR B 96 ? ASN B 98 ? THR B 96 ASN B 98 A 3 THR A 96 ? ASN A 98 ? THR A 96 ASN A 98 A 4 GLN B 2 ? ILE B 3 ? GLN B 2 ILE B 3 B 1 LYS A 43 ? GLY A 48 ? LYS A 43 GLY A 48 B 2 PHE A 53 ? ILE A 66 ? PHE A 53 ILE A 66 B 3 HIS A 69 ? VAL A 77 ? HIS A 69 VAL A 77 B 4 VAL A 32 ? LEU A 33 ? VAL A 32 LEU A 33 B 5 VAL A 84 ? ILE A 85 ? VAL A 84 ILE A 85 B 6 GLN A 18 ? LEU A 24 ? GLN A 18 LEU A 24 B 7 ILE A 10 ? ILE A 15 ? ILE A 10 ILE A 15 B 8 PHE A 53 ? ILE A 66 ? PHE A 53 ILE A 66 C 1 TRP B 42 ? ILE B 47 ? TRP B 42 ILE B 47 C 2 VAL B 54 ? ILE B 66 ? VAL B 54 ILE B 66 C 3 HIS B 69 ? VAL B 77 ? HIS B 69 VAL B 77 C 4 VAL B 32 ? LEU B 33 ? VAL B 32 LEU B 33 C 5 VAL B 84 ? ILE B 85 ? VAL B 84 ILE B 85 C 6 GLN B 18 ? LEU B 24 ? GLN B 18 LEU B 24 C 7 ILE B 10 ? ILE B 15 ? ILE B 10 ILE B 15 C 8 VAL B 54 ? ILE B 66 ? VAL B 54 ILE B 66 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 3 ? N ILE A 3 O LEU B 97 ? O LEU B 97 A 2 3 O ASN B 98 ? O ASN B 98 N THR A 96 ? N THR A 96 A 3 4 N LEU A 97 ? N LEU A 97 O ILE B 3 ? O ILE B 3 B 1 2 N LYS A 45 ? N LYS A 45 O VAL A 56 ? O VAL A 56 B 2 3 N ILE A 64 ? N ILE A 64 O VAL A 71 ? O VAL A 71 B 3 4 O LEU A 76 ? O LEU A 76 N LEU A 33 ? N LEU A 33 B 4 5 N VAL A 32 ? N VAL A 32 O VAL A 84 ? O VAL A 84 B 5 6 O ILE A 85 ? O ILE A 85 N LEU A 23 ? N LEU A 23 B 6 7 O LYS A 20 ? O LYS A 20 N ILE A 13 ? N ILE A 13 B 7 8 N LYS A 14 ? N LYS A 14 O GLU A 65 ? O GLU A 65 C 1 2 N LYS B 43 ? N LYS B 43 O GLN B 58 ? O GLN B 58 C 2 3 N ILE B 64 ? N ILE B 64 O VAL B 71 ? O VAL B 71 C 3 4 O LEU B 76 ? O LEU B 76 N LEU B 33 ? N LEU B 33 C 4 5 N VAL B 32 ? N VAL B 32 O VAL B 84 ? O VAL B 84 C 5 6 O ILE B 85 ? O ILE B 85 N LEU B 23 ? N LEU B 23 C 6 7 O LYS B 20 ? O LYS B 20 N ILE B 13 ? N ILE B 13 C 7 8 N LYS B 14 ? N LYS B 14 O GLU B 65 ? O GLU B 65 # _database_PDB_matrix.entry_id 4FAE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4FAE _atom_sites.fract_transf_matrix[1][1] 0.034947 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015661 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.010975 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 PRO 1 1 1 PRO PRO A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ILE 3 3 3 ILE ILE A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 LEU 5 5 5 LEU LEU A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 ARG 8 8 8 ARG ARG A . n A 1 9 PRO 9 9 9 PRO PRO A . n A 1 10 ILE 10 10 10 ILE ILE A . n A 1 11 VAL 11 11 11 VAL VAL A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 ILE 13 13 13 ILE ILE A . n A 1 14 LYS 14 14 14 LYS LYS A . n A 1 15 ILE 15 15 15 ILE ILE A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 ALA 22 22 22 ALA ALA A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 LEU 24 24 24 LEU LEU A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 THR 26 26 26 THR THR A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 ASP 29 29 29 ASP ASP A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 THR 31 31 31 THR THR A . n A 1 32 VAL 32 32 32 VAL VAL A . n A 1 33 LEU 33 33 33 LEU LEU A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 VAL 36 36 36 VAL VAL A . n A 1 37 ASN 37 37 37 ASN ASN A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 PRO 39 39 39 PRO PRO A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 TRP 42 42 42 TRP TRP A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 GLY 48 48 48 GLY GLY A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 ILE 50 50 50 ILE ILE A . n A 1 51 GLY 51 51 51 GLY GLY A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 PHE 53 53 53 PHE PHE A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 LYS 55 55 55 LYS LYS A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ARG 57 57 57 ARG ARG A . n A 1 58 GLN 58 58 58 GLN GLN A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 ASP 60 60 60 ASP ASP A . n A 1 61 GLN 61 61 61 GLN GLN A . n A 1 62 VAL 62 62 62 VAL VAL A . n A 1 63 PRO 63 63 63 PRO PRO A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ILE 66 66 66 ILE ILE A . n A 1 67 CYS 67 67 67 CYS CYS A . n A 1 68 GLY 68 68 68 GLY GLY A . n A 1 69 HIS 69 69 69 HIS HIS A . n A 1 70 LYS 70 70 70 LYS LYS A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ILE 72 72 72 ILE ILE A . n A 1 73 GLY 73 73 73 GLY GLY A . n A 1 74 THR 74 74 74 THR THR A . n A 1 75 VAL 75 75 75 VAL VAL A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLY 78 78 78 GLY GLY A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 THR 80 80 80 THR THR A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 THR 82 82 82 THR THR A . n A 1 83 ASN 83 83 83 ASN ASN A . n A 1 84 VAL 84 84 84 VAL VAL A . n A 1 85 ILE 85 85 85 ILE ILE A . n A 1 86 GLY 86 86 86 GLY GLY A . n A 1 87 ARG 87 87 87 ARG ARG A . n A 1 88 ASN 88 88 88 ASN ASN A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 MET 90 90 90 MET MET A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 GLN 92 92 92 GLN GLN A . n A 1 93 ILE 93 93 93 ILE ILE A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 CYS 95 95 95 CYS CYS A . n A 1 96 THR 96 96 96 THR THR A . n A 1 97 LEU 97 97 97 LEU LEU A . n A 1 98 ASN 98 98 98 ASN ASN A . n A 1 99 PHE 99 99 99 PHE PHE A . n B 1 1 PRO 1 1 1 PRO PRO B . n B 1 2 GLN 2 2 2 GLN GLN B . n B 1 3 ILE 3 3 3 ILE ILE B . n B 1 4 THR 4 4 4 THR THR B . n B 1 5 LEU 5 5 5 LEU LEU B . n B 1 6 TRP 6 6 6 TRP TRP B . n B 1 7 GLN 7 7 7 GLN GLN B . n B 1 8 ARG 8 8 8 ARG ARG B . n B 1 9 PRO 9 9 9 PRO PRO B . n B 1 10 ILE 10 10 10 ILE ILE B . n B 1 11 VAL 11 11 11 VAL VAL B . n B 1 12 THR 12 12 12 THR THR B . n B 1 13 ILE 13 13 13 ILE ILE B . n B 1 14 LYS 14 14 14 LYS LYS B . n B 1 15 ILE 15 15 15 ILE ILE B . n B 1 16 GLY 16 16 16 GLY GLY B . n B 1 17 GLY 17 17 17 GLY GLY B . n B 1 18 GLN 18 18 18 GLN GLN B . n B 1 19 LEU 19 19 19 LEU LEU B . n B 1 20 LYS 20 20 20 LYS LYS B . n B 1 21 GLU 21 21 21 GLU GLU B . n B 1 22 ALA 22 22 22 ALA ALA B . n B 1 23 LEU 23 23 23 LEU LEU B . n B 1 24 LEU 24 24 24 LEU LEU B . n B 1 25 ASN 25 25 25 ASN ASN B . n B 1 26 THR 26 26 26 THR THR B . n B 1 27 GLY 27 27 27 GLY GLY B . n B 1 28 ALA 28 28 28 ALA ALA B . n B 1 29 ASP 29 29 29 ASP ASP B . n B 1 30 ASP 30 30 30 ASP ASP B . n B 1 31 THR 31 31 31 THR THR B . n B 1 32 VAL 32 32 32 VAL VAL B . n B 1 33 LEU 33 33 33 LEU LEU B . n B 1 34 GLU 34 34 34 GLU GLU B . n B 1 35 GLU 35 35 35 GLU GLU B . n B 1 36 VAL 36 36 36 VAL VAL B . n B 1 37 ASN 37 37 37 ASN ASN B . n B 1 38 LEU 38 38 38 LEU LEU B . n B 1 39 PRO 39 39 39 PRO PRO B . n B 1 40 GLY 40 40 40 GLY GLY B . n B 1 41 ARG 41 41 41 ARG ARG B . n B 1 42 TRP 42 42 42 TRP TRP B . n B 1 43 LYS 43 43 43 LYS LYS B . n B 1 44 PRO 44 44 44 PRO PRO B . n B 1 45 LYS 45 45 45 LYS LYS B . n B 1 46 LEU 46 46 46 LEU LEU B . n B 1 47 ILE 47 47 47 ILE ILE B . n B 1 48 GLY 48 48 48 GLY GLY B . n B 1 49 GLY 49 49 49 GLY GLY B . n B 1 50 ILE 50 50 50 ILE ILE B . n B 1 51 GLY 51 51 51 GLY GLY B . n B 1 52 GLY 52 52 52 GLY GLY B . n B 1 53 PHE 53 53 53 PHE PHE B . n B 1 54 VAL 54 54 54 VAL VAL B . n B 1 55 LYS 55 55 55 LYS LYS B . n B 1 56 VAL 56 56 56 VAL VAL B . n B 1 57 ARG 57 57 57 ARG ARG B . n B 1 58 GLN 58 58 58 GLN GLN B . n B 1 59 TYR 59 59 59 TYR TYR B . n B 1 60 ASP 60 60 60 ASP ASP B . n B 1 61 GLN 61 61 61 GLN GLN B . n B 1 62 VAL 62 62 62 VAL VAL B . n B 1 63 PRO 63 63 63 PRO PRO B . n B 1 64 ILE 64 64 64 ILE ILE B . n B 1 65 GLU 65 65 65 GLU GLU B . n B 1 66 ILE 66 66 66 ILE ILE B . n B 1 67 CYS 67 67 67 CYS CYS B . n B 1 68 GLY 68 68 68 GLY GLY B . n B 1 69 HIS 69 69 69 HIS HIS B . n B 1 70 LYS 70 70 70 LYS LYS B . n B 1 71 VAL 71 71 71 VAL VAL B . n B 1 72 ILE 72 72 72 ILE ILE B . n B 1 73 GLY 73 73 73 GLY GLY B . n B 1 74 THR 74 74 74 THR THR B . n B 1 75 VAL 75 75 75 VAL VAL B . n B 1 76 LEU 76 76 76 LEU LEU B . n B 1 77 VAL 77 77 77 VAL VAL B . n B 1 78 GLY 78 78 78 GLY GLY B . n B 1 79 PRO 79 79 79 PRO PRO B . n B 1 80 THR 80 80 80 THR THR B . n B 1 81 PRO 81 81 81 PRO PRO B . n B 1 82 THR 82 82 82 THR THR B . n B 1 83 ASN 83 83 83 ASN ASN B . n B 1 84 VAL 84 84 84 VAL VAL B . n B 1 85 ILE 85 85 85 ILE ILE B . n B 1 86 GLY 86 86 86 GLY GLY B . n B 1 87 ARG 87 87 87 ARG ARG B . n B 1 88 ASN 88 88 88 ASN ASN B . n B 1 89 LEU 89 89 89 LEU LEU B . n B 1 90 MET 90 90 90 MET MET B . n B 1 91 THR 91 91 91 THR THR B . n B 1 92 GLN 92 92 92 GLN GLN B . n B 1 93 ILE 93 93 93 ILE ILE B . n B 1 94 GLY 94 94 94 GLY GLY B . n B 1 95 CYS 95 95 95 CYS CYS B . n B 1 96 THR 96 96 96 THR THR B . n B 1 97 LEU 97 97 97 LEU LEU B . n B 1 98 ASN 98 98 98 ASN ASN B . n B 1 99 PHE 99 99 99 PHE PHE B . n C 2 1 THR 1 1 1 THR THR D . n C 2 2 ILE 2 2 2 ILE ILE D . n C 2 3 MET 3 3 3 MET MET D . n C 2 4 MET 4 4 4 MET MET D . n C 2 5 GLN 5 5 5 GLN GLN D . n C 2 6 ARG 6 6 6 ARG ARG D . n C 2 7 GLY 7 7 7 GLY GLY D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code D 3 HOH 1 101 2 HOH HOH A . D 3 HOH 2 102 3 HOH HOH A . D 3 HOH 3 103 5 HOH HOH A . D 3 HOH 4 104 6 HOH HOH A . D 3 HOH 5 105 7 HOH HOH A . D 3 HOH 6 106 9 HOH HOH A . D 3 HOH 7 107 10 HOH HOH A . D 3 HOH 8 108 11 HOH HOH A . D 3 HOH 9 109 13 HOH HOH A . D 3 HOH 10 110 15 HOH HOH A . D 3 HOH 11 111 16 HOH HOH A . D 3 HOH 12 112 19 HOH HOH A . D 3 HOH 13 113 20 HOH HOH A . D 3 HOH 14 114 25 HOH HOH A . D 3 HOH 15 115 30 HOH HOH A . D 3 HOH 16 116 34 HOH HOH A . D 3 HOH 17 117 37 HOH HOH A . D 3 HOH 18 118 39 HOH HOH A . D 3 HOH 19 119 40 HOH HOH A . D 3 HOH 20 120 43 HOH HOH A . D 3 HOH 21 121 44 HOH HOH A . D 3 HOH 22 122 45 HOH HOH A . D 3 HOH 23 123 46 HOH HOH A . D 3 HOH 24 124 47 HOH HOH A . D 3 HOH 25 125 51 HOH HOH A . D 3 HOH 26 126 53 HOH HOH A . D 3 HOH 27 127 55 HOH HOH A . D 3 HOH 28 128 56 HOH HOH A . D 3 HOH 29 129 58 HOH HOH A . D 3 HOH 30 130 61 HOH HOH A . D 3 HOH 31 131 64 HOH HOH A . D 3 HOH 32 132 65 HOH HOH A . D 3 HOH 33 133 67 HOH HOH A . D 3 HOH 34 134 68 HOH HOH A . D 3 HOH 35 135 70 HOH HOH A . D 3 HOH 36 136 71 HOH HOH A . D 3 HOH 37 137 74 HOH HOH A . D 3 HOH 38 138 75 HOH HOH A . D 3 HOH 39 139 77 HOH HOH A . D 3 HOH 40 140 79 HOH HOH A . D 3 HOH 41 141 86 HOH HOH A . D 3 HOH 42 142 87 HOH HOH A . D 3 HOH 43 143 91 HOH HOH A . D 3 HOH 44 144 92 HOH HOH A . D 3 HOH 45 145 93 HOH HOH A . D 3 HOH 46 146 95 HOH HOH A . D 3 HOH 47 147 101 HOH HOH A . D 3 HOH 48 148 104 HOH HOH A . D 3 HOH 49 149 105 HOH HOH A . D 3 HOH 50 150 108 HOH HOH A . D 3 HOH 51 151 109 HOH HOH A . D 3 HOH 52 152 110 HOH HOH A . D 3 HOH 53 153 111 HOH HOH A . D 3 HOH 54 154 113 HOH HOH A . D 3 HOH 55 155 114 HOH HOH A . D 3 HOH 56 156 124 HOH HOH A . D 3 HOH 57 157 125 HOH HOH A . D 3 HOH 58 158 128 HOH HOH A . D 3 HOH 59 159 129 HOH HOH A . D 3 HOH 60 160 130 HOH HOH A . D 3 HOH 61 161 132 HOH HOH A . D 3 HOH 62 162 136 HOH HOH A . D 3 HOH 63 163 138 HOH HOH A . D 3 HOH 64 164 140 HOH HOH A . D 3 HOH 65 165 141 HOH HOH A . D 3 HOH 66 166 142 HOH HOH A . D 3 HOH 67 167 143 HOH HOH A . D 3 HOH 68 168 144 HOH HOH A . D 3 HOH 69 169 145 HOH HOH A . D 3 HOH 70 170 151 HOH HOH A . D 3 HOH 71 171 160 HOH HOH A . D 3 HOH 72 172 170 HOH HOH A . D 3 HOH 73 173 181 HOH HOH A . D 3 HOH 74 174 184 HOH HOH A . D 3 HOH 75 175 186 HOH HOH A . D 3 HOH 76 176 200 HOH HOH A . D 3 HOH 77 177 135 HOH HOH A . D 3 HOH 78 178 134 HOH HOH A . D 3 HOH 79 179 94 HOH HOH A . D 3 HOH 80 180 206 HOH HOH A . D 3 HOH 81 181 152 HOH HOH A . D 3 HOH 82 182 150 HOH HOH A . D 3 HOH 83 183 182 HOH HOH A . D 3 HOH 84 184 179 HOH HOH A . E 3 HOH 1 101 120 HOH HOH B . E 3 HOH 2 102 122 HOH HOH B . E 3 HOH 3 103 188 HOH HOH B . E 3 HOH 4 104 197 HOH HOH B . E 3 HOH 5 105 1 HOH HOH B . E 3 HOH 6 106 4 HOH HOH B . E 3 HOH 7 107 8 HOH HOH B . E 3 HOH 8 108 12 HOH HOH B . E 3 HOH 9 109 17 HOH HOH B . E 3 HOH 10 110 18 HOH HOH B . E 3 HOH 11 111 21 HOH HOH B . E 3 HOH 12 112 23 HOH HOH B . E 3 HOH 13 113 24 HOH HOH B . E 3 HOH 14 114 26 HOH HOH B . E 3 HOH 15 115 27 HOH HOH B . E 3 HOH 16 116 28 HOH HOH B . E 3 HOH 17 117 29 HOH HOH B . E 3 HOH 18 118 31 HOH HOH B . E 3 HOH 19 119 32 HOH HOH B . E 3 HOH 20 120 33 HOH HOH B . E 3 HOH 21 121 35 HOH HOH B . E 3 HOH 22 122 36 HOH HOH B . E 3 HOH 23 123 38 HOH HOH B . E 3 HOH 24 124 41 HOH HOH B . E 3 HOH 25 125 42 HOH HOH B . E 3 HOH 26 126 49 HOH HOH B . E 3 HOH 27 127 52 HOH HOH B . E 3 HOH 28 128 54 HOH HOH B . E 3 HOH 29 129 57 HOH HOH B . E 3 HOH 30 130 59 HOH HOH B . E 3 HOH 31 131 60 HOH HOH B . E 3 HOH 32 132 62 HOH HOH B . E 3 HOH 33 133 63 HOH HOH B . E 3 HOH 34 134 66 HOH HOH B . E 3 HOH 35 135 72 HOH HOH B . E 3 HOH 36 136 73 HOH HOH B . E 3 HOH 37 137 76 HOH HOH B . E 3 HOH 38 138 81 HOH HOH B . E 3 HOH 39 139 82 HOH HOH B . E 3 HOH 40 140 83 HOH HOH B . E 3 HOH 41 141 85 HOH HOH B . E 3 HOH 42 142 89 HOH HOH B . E 3 HOH 43 143 97 HOH HOH B . E 3 HOH 44 144 100 HOH HOH B . E 3 HOH 45 145 102 HOH HOH B . E 3 HOH 46 146 106 HOH HOH B . E 3 HOH 47 147 107 HOH HOH B . E 3 HOH 48 148 112 HOH HOH B . E 3 HOH 49 149 116 HOH HOH B . E 3 HOH 50 150 117 HOH HOH B . E 3 HOH 51 151 121 HOH HOH B . E 3 HOH 52 152 123 HOH HOH B . E 3 HOH 53 153 126 HOH HOH B . E 3 HOH 54 154 127 HOH HOH B . E 3 HOH 55 155 131 HOH HOH B . E 3 HOH 56 156 133 HOH HOH B . E 3 HOH 57 157 147 HOH HOH B . E 3 HOH 58 158 148 HOH HOH B . E 3 HOH 59 159 149 HOH HOH B . E 3 HOH 60 160 154 HOH HOH B . E 3 HOH 61 161 155 HOH HOH B . E 3 HOH 62 162 157 HOH HOH B . E 3 HOH 63 163 162 HOH HOH B . E 3 HOH 64 164 163 HOH HOH B . E 3 HOH 65 165 164 HOH HOH B . E 3 HOH 66 166 165 HOH HOH B . E 3 HOH 67 167 167 HOH HOH B . E 3 HOH 68 168 168 HOH HOH B . E 3 HOH 69 169 173 HOH HOH B . E 3 HOH 70 170 175 HOH HOH B . E 3 HOH 71 171 178 HOH HOH B . E 3 HOH 72 172 183 HOH HOH B . E 3 HOH 73 173 185 HOH HOH B . E 3 HOH 74 174 189 HOH HOH B . E 3 HOH 75 175 190 HOH HOH B . E 3 HOH 76 176 193 HOH HOH B . E 3 HOH 77 177 194 HOH HOH B . E 3 HOH 78 178 196 HOH HOH B . E 3 HOH 79 179 198 HOH HOH B . E 3 HOH 80 180 199 HOH HOH B . E 3 HOH 81 181 201 HOH HOH B . E 3 HOH 82 182 202 HOH HOH B . E 3 HOH 83 183 203 HOH HOH B . E 3 HOH 84 184 204 HOH HOH B . E 3 HOH 85 185 205 HOH HOH B . E 3 HOH 86 186 207 HOH HOH B . E 3 HOH 87 187 159 HOH HOH B . E 3 HOH 88 188 180 HOH HOH B . E 3 HOH 89 189 169 HOH HOH B . E 3 HOH 90 190 153 HOH HOH B . F 3 HOH 1 101 195 HOH HOH D . F 3 HOH 2 102 96 HOH HOH D . F 3 HOH 3 103 119 HOH HOH D . F 3 HOH 4 104 48 HOH HOH D . F 3 HOH 5 105 50 HOH HOH D . F 3 HOH 6 106 98 HOH HOH D . F 3 HOH 7 107 103 HOH HOH D . F 3 HOH 8 108 137 HOH HOH D . F 3 HOH 9 109 158 HOH HOH D . F 3 HOH 10 110 166 HOH HOH D . F 3 HOH 11 111 176 HOH HOH D . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 5210 ? 1 MORE -34 ? 1 'SSA (A^2)' 9760 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-08-29 2 'Structure model' 1 1 2023-07-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' database_2 3 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.country' 2 2 'Structure model' '_citation.journal_abbrev' 3 2 'Structure model' '_citation.journal_id_CSD' 4 2 'Structure model' '_citation.journal_id_ISSN' 5 2 'Structure model' '_citation.journal_volume' 6 2 'Structure model' '_citation.page_first' 7 2 'Structure model' '_citation.page_last' 8 2 'Structure model' '_citation.pdbx_database_id_DOI' 9 2 'Structure model' '_citation.pdbx_database_id_PubMed' 10 2 'Structure model' '_citation.title' 11 2 'Structure model' '_citation.year' 12 2 'Structure model' '_database_2.pdbx_DOI' 13 2 'Structure model' '_database_2.pdbx_database_accession' 14 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 AMoRE phasing . ? 2 REFMAC refinement 5.5.0102 ? 3 DENZO 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OD2 B ASP 30 ? ? O B HOH 117 ? ? 2.08 2 1 OE1 A GLN 92 ? ? O A HOH 178 ? ? 2.08 3 1 NZ B LYS 55 ? ? O B HOH 160 ? ? 2.18 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 CG A LYS 70 ? ? 1_555 O B HOH 164 ? ? 2_655 1.58 2 1 CD A LYS 70 ? ? 1_555 O B HOH 164 ? ? 2_655 1.76 3 1 O A HOH 145 ? ? 1_555 O B HOH 142 ? ? 1_655 2.09 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CA B LEU 23 ? ? CB B LEU 23 ? ? CG B LEU 23 ? ? 129.24 115.30 13.94 2.30 N 2 1 C B THR 80 ? ? N B PRO 81 ? ? CA B PRO 81 ? ? 128.52 119.30 9.22 1.50 Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 67 ? ? 25.58 53.25 2 1 CYS A 67 ? ? 23.32 55.23 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #