data_4H22 # _entry.id 4H22 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4H22 pdb_00004h22 10.2210/pdb4h22/pdb RCSB RCSB074920 ? ? WWPDB D_1000074920 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 2q6q _pdbx_database_related.details 'spindle pole body component SPC42' _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4H22 _pdbx_database_status.recvd_initial_deposition_date 2012-09-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nguyen, J.B.' 1 'Modis, Y.' 2 # _citation.id primary _citation.title 'Crystal structure of the dimeric coiled-coil domain of the cytosolic nucleic acid sensor LRRFIP1.' _citation.journal_abbrev J.Struct.Biol. _citation.journal_volume 181 _citation.page_first 82 _citation.page_last 88 _citation.year 2013 _citation.journal_id_ASTM JSBIEM _citation.country US _citation.journal_id_ISSN 1047-8477 _citation.journal_id_CSD 0803 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23099021 _citation.pdbx_database_id_DOI 10.1016/j.jsb.2012.10.006 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nguyen, J.B.' 1 ? primary 'Modis, Y.' 2 ? # _cell.entry_id 4H22 _cell.length_a 152.363 _cell.length_b 71.447 _cell.length_c 68.035 _cell.angle_alpha 90.00 _cell.angle_beta 110.10 _cell.angle_gamma 90.00 _cell.Z_PDB 16 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4H22 _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Leucine-rich repeat flightless-interacting protein 1' 12399.946 4 ? ? 'UNP residues 162-249' ? 2 water nat water 18.015 26 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'LRR FLII-interacting protein 1, GC-binding factor 2, TAR RNA-interacting protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MDSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESRRQYEEKNKEFEREKHAHSILQFQFAEVKEA LKQREEMLEPKLAAALEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MDSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESRRQYEEKNKEFEREKHAHSILQFQFAEVKEA LKQREEMLEPKLAAALEHHHHHH ; _entity_poly.pdbx_strand_id A,B,C,D _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 ASP n 1 3 SER n 1 4 LEU n 1 5 ALA n 1 6 GLU n 1 7 VAL n 1 8 GLU n 1 9 GLU n 1 10 LYS n 1 11 TYR n 1 12 LYS n 1 13 LYS n 1 14 ALA n 1 15 MET n 1 16 VAL n 1 17 SER n 1 18 ASN n 1 19 ALA n 1 20 GLN n 1 21 LEU n 1 22 ASP n 1 23 ASN n 1 24 GLU n 1 25 LYS n 1 26 THR n 1 27 ASN n 1 28 PHE n 1 29 MET n 1 30 TYR n 1 31 GLN n 1 32 VAL n 1 33 ASP n 1 34 THR n 1 35 LEU n 1 36 LYS n 1 37 ASP n 1 38 MET n 1 39 LEU n 1 40 LEU n 1 41 GLU n 1 42 LEU n 1 43 GLU n 1 44 GLU n 1 45 GLN n 1 46 LEU n 1 47 ALA n 1 48 GLU n 1 49 SER n 1 50 ARG n 1 51 ARG n 1 52 GLN n 1 53 TYR n 1 54 GLU n 1 55 GLU n 1 56 LYS n 1 57 ASN n 1 58 LYS n 1 59 GLU n 1 60 PHE n 1 61 GLU n 1 62 ARG n 1 63 GLU n 1 64 LYS n 1 65 HIS n 1 66 ALA n 1 67 HIS n 1 68 SER n 1 69 ILE n 1 70 LEU n 1 71 GLN n 1 72 PHE n 1 73 GLN n 1 74 PHE n 1 75 ALA n 1 76 GLU n 1 77 VAL n 1 78 LYS n 1 79 GLU n 1 80 ALA n 1 81 LEU n 1 82 LYS n 1 83 GLN n 1 84 ARG n 1 85 GLU n 1 86 GLU n 1 87 MET n 1 88 LEU n 1 89 GLU n 1 90 PRO n 1 91 LYS n 1 92 LEU n 1 93 ALA n 1 94 ALA n 1 95 ALA n 1 96 LEU n 1 97 GLU n 1 98 HIS n 1 99 HIS n 1 100 HIS n 1 101 HIS n 1 102 HIS n 1 103 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'LRRFIP1, GCF2, TRIP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain Rosetta _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET21a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code LRRF1_HUMAN _struct_ref.pdbx_db_accession Q32MZ4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DSLAEVEEKYKKAMVSNAQLDNEKTNFMYQVDTLKDMLLELEEQLAESRRQYEEKNKEFEREKHAHSILQFQFAEVKEAL KQREEMLE ; _struct_ref.pdbx_align_begin 162 _struct_ref.pdbx_db_isoform ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4H22 A 2 ? 89 ? Q32MZ4 162 ? 249 ? 162 249 2 1 4H22 B 2 ? 89 ? Q32MZ4 162 ? 249 ? 162 249 3 1 4H22 C 2 ? 89 ? Q32MZ4 162 ? 249 ? 162 249 4 1 4H22 D 2 ? 89 ? Q32MZ4 162 ? 249 ? 162 249 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4H22 MET A 1 ? UNP Q32MZ4 ? ? 'expression tag' 161 1 1 4H22 PRO A 90 ? UNP Q32MZ4 ? ? 'expression tag' 250 2 1 4H22 LYS A 91 ? UNP Q32MZ4 ? ? 'expression tag' 251 3 1 4H22 LEU A 92 ? UNP Q32MZ4 ? ? 'expression tag' 252 4 1 4H22 ALA A 93 ? UNP Q32MZ4 ? ? 'expression tag' 253 5 1 4H22 ALA A 94 ? UNP Q32MZ4 ? ? 'expression tag' 254 6 1 4H22 ALA A 95 ? UNP Q32MZ4 ? ? 'expression tag' 255 7 1 4H22 LEU A 96 ? UNP Q32MZ4 ? ? 'expression tag' 256 8 1 4H22 GLU A 97 ? UNP Q32MZ4 ? ? 'expression tag' 257 9 1 4H22 HIS A 98 ? UNP Q32MZ4 ? ? 'expression tag' 258 10 1 4H22 HIS A 99 ? UNP Q32MZ4 ? ? 'expression tag' 259 11 1 4H22 HIS A 100 ? UNP Q32MZ4 ? ? 'expression tag' 260 12 1 4H22 HIS A 101 ? UNP Q32MZ4 ? ? 'expression tag' 261 13 1 4H22 HIS A 102 ? UNP Q32MZ4 ? ? 'expression tag' 262 14 1 4H22 HIS A 103 ? UNP Q32MZ4 ? ? 'expression tag' 263 15 2 4H22 MET B 1 ? UNP Q32MZ4 ? ? 'expression tag' 161 16 2 4H22 PRO B 90 ? UNP Q32MZ4 ? ? 'expression tag' 250 17 2 4H22 LYS B 91 ? UNP Q32MZ4 ? ? 'expression tag' 251 18 2 4H22 LEU B 92 ? UNP Q32MZ4 ? ? 'expression tag' 252 19 2 4H22 ALA B 93 ? UNP Q32MZ4 ? ? 'expression tag' 253 20 2 4H22 ALA B 94 ? UNP Q32MZ4 ? ? 'expression tag' 254 21 2 4H22 ALA B 95 ? UNP Q32MZ4 ? ? 'expression tag' 255 22 2 4H22 LEU B 96 ? UNP Q32MZ4 ? ? 'expression tag' 256 23 2 4H22 GLU B 97 ? UNP Q32MZ4 ? ? 'expression tag' 257 24 2 4H22 HIS B 98 ? UNP Q32MZ4 ? ? 'expression tag' 258 25 2 4H22 HIS B 99 ? UNP Q32MZ4 ? ? 'expression tag' 259 26 2 4H22 HIS B 100 ? UNP Q32MZ4 ? ? 'expression tag' 260 27 2 4H22 HIS B 101 ? UNP Q32MZ4 ? ? 'expression tag' 261 28 2 4H22 HIS B 102 ? UNP Q32MZ4 ? ? 'expression tag' 262 29 2 4H22 HIS B 103 ? UNP Q32MZ4 ? ? 'expression tag' 263 30 3 4H22 MET C 1 ? UNP Q32MZ4 ? ? 'expression tag' 161 31 3 4H22 PRO C 90 ? UNP Q32MZ4 ? ? 'expression tag' 250 32 3 4H22 LYS C 91 ? UNP Q32MZ4 ? ? 'expression tag' 251 33 3 4H22 LEU C 92 ? UNP Q32MZ4 ? ? 'expression tag' 252 34 3 4H22 ALA C 93 ? UNP Q32MZ4 ? ? 'expression tag' 253 35 3 4H22 ALA C 94 ? UNP Q32MZ4 ? ? 'expression tag' 254 36 3 4H22 ALA C 95 ? UNP Q32MZ4 ? ? 'expression tag' 255 37 3 4H22 LEU C 96 ? UNP Q32MZ4 ? ? 'expression tag' 256 38 3 4H22 GLU C 97 ? UNP Q32MZ4 ? ? 'expression tag' 257 39 3 4H22 HIS C 98 ? UNP Q32MZ4 ? ? 'expression tag' 258 40 3 4H22 HIS C 99 ? UNP Q32MZ4 ? ? 'expression tag' 259 41 3 4H22 HIS C 100 ? UNP Q32MZ4 ? ? 'expression tag' 260 42 3 4H22 HIS C 101 ? UNP Q32MZ4 ? ? 'expression tag' 261 43 3 4H22 HIS C 102 ? UNP Q32MZ4 ? ? 'expression tag' 262 44 3 4H22 HIS C 103 ? UNP Q32MZ4 ? ? 'expression tag' 263 45 4 4H22 MET D 1 ? UNP Q32MZ4 ? ? 'expression tag' 161 46 4 4H22 PRO D 90 ? UNP Q32MZ4 ? ? 'expression tag' 250 47 4 4H22 LYS D 91 ? UNP Q32MZ4 ? ? 'expression tag' 251 48 4 4H22 LEU D 92 ? UNP Q32MZ4 ? ? 'expression tag' 252 49 4 4H22 ALA D 93 ? UNP Q32MZ4 ? ? 'expression tag' 253 50 4 4H22 ALA D 94 ? UNP Q32MZ4 ? ? 'expression tag' 254 51 4 4H22 ALA D 95 ? UNP Q32MZ4 ? ? 'expression tag' 255 52 4 4H22 LEU D 96 ? UNP Q32MZ4 ? ? 'expression tag' 256 53 4 4H22 GLU D 97 ? UNP Q32MZ4 ? ? 'expression tag' 257 54 4 4H22 HIS D 98 ? UNP Q32MZ4 ? ? 'expression tag' 258 55 4 4H22 HIS D 99 ? UNP Q32MZ4 ? ? 'expression tag' 259 56 4 4H22 HIS D 100 ? UNP Q32MZ4 ? ? 'expression tag' 260 57 4 4H22 HIS D 101 ? UNP Q32MZ4 ? ? 'expression tag' 261 58 4 4H22 HIS D 102 ? UNP Q32MZ4 ? ? 'expression tag' 262 59 4 4H22 HIS D 103 ? UNP Q32MZ4 ? ? 'expression tag' 263 60 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4H22 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 3.51 _exptl_crystal.density_percent_sol 64.91 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pdbx_details 'PEG 8000, MES pH 6.5, sodium acetate, VAPOR DIFFUSION, HANGING DROP, temperature 289K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2010-11-04 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0750 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.0750 # _reflns.entry_id 4H22 _reflns.observed_criterion_sigma_I 1.8 _reflns.observed_criterion_sigma_F 1.8 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 2.89 _reflns.number_obs 15465 _reflns.number_all 15508 _reflns.percent_possible_obs 99.7 _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 2.89 _reflns_shell.d_res_low 2.94 _reflns_shell.percent_possible_all 95.5 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4H22 _refine.ls_number_reflns_obs 14690 _refine.ls_number_reflns_all 15465 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.8 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 50.00 _refine.ls_d_res_high 2.89 _refine.ls_percent_reflns_obs 99.10 _refine.ls_R_factor_obs 0.23529 _refine.ls_R_factor_R_work 0.23461 _refine.ls_R_factor_R_free 0.24757 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 775 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.934 _refine.correlation_coeff_Fo_to_Fc_free 0.923 _refine.B_iso_mean 100.862 _refine.aniso_B[1][1] -5.42 _refine.aniso_B[2][2] -0.04 _refine.aniso_B[3][3] 5.37 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.12 _refine.aniso_B[2][3] -0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.pdbx_starting_model 'PDB entry 2q6q' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.434 _refine.pdbx_overall_ESU_R_Free 0.310 _refine.overall_SU_ML 0.255 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 29.590 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.ls_R_factor_all ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2630 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 2656 _refine_hist.d_res_high 2.89 _refine_hist.d_res_low 50.00 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.006 0.020 ? 2662 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 0.900 1.961 ? 3546 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 4.315 5.000 ? 308 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 42.448 26.025 ? 161 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 20.783 15.000 ? 563 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 13.810 15.000 ? 14 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.072 0.200 ? 371 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.004 0.020 ? 2002 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.89 _refine_ls_shell.d_res_low 2.962 _refine_ls_shell.number_reflns_R_work 980 _refine_ls_shell.R_factor_R_work 0.357 _refine_ls_shell.percent_reflns_obs 93.42 _refine_ls_shell.R_factor_R_free 0.308 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 56 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4H22 _struct.title 'Crystal structure of the dimeric coiled-coil domain of the cytosolic nucleic acid sensor LRRFIP1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4H22 _struct_keywords.pdbx_keywords TRANSCRIPTION _struct_keywords.text 'nucleic acid sensor, Flightless-1, TRANSCRIPTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 1 ? D N N 1 ? E N N 2 ? F N N 2 ? G N N 2 ? H N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 LYS A 10 ? GLN A 83 ? LYS A 170 GLN A 243 1 ? 74 HELX_P HELX_P2 2 GLU B 8 ? GLU B 89 ? GLU B 168 GLU B 249 1 ? 82 HELX_P HELX_P3 3 TYR C 11 ? GLN C 83 ? TYR C 171 GLN C 243 1 ? 73 HELX_P HELX_P4 4 TYR D 11 ? LEU D 81 ? TYR D 171 LEU D 241 1 ? 71 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _database_PDB_matrix.entry_id 4H22 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4H22 _atom_sites.fract_transf_matrix[1][1] 0.006563 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002402 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013996 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015652 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 161 ? ? ? A . n A 1 2 ASP 2 162 ? ? ? A . n A 1 3 SER 3 163 ? ? ? A . n A 1 4 LEU 4 164 ? ? ? A . n A 1 5 ALA 5 165 ? ? ? A . n A 1 6 GLU 6 166 ? ? ? A . n A 1 7 VAL 7 167 ? ? ? A . n A 1 8 GLU 8 168 168 GLU GLU A . n A 1 9 GLU 9 169 169 GLU GLU A . n A 1 10 LYS 10 170 170 LYS LYS A . n A 1 11 TYR 11 171 171 TYR TYR A . n A 1 12 LYS 12 172 172 LYS LYS A . n A 1 13 LYS 13 173 173 LYS LYS A . n A 1 14 ALA 14 174 174 ALA ALA A . n A 1 15 MET 15 175 175 MET MET A . n A 1 16 VAL 16 176 176 VAL VAL A . n A 1 17 SER 17 177 177 SER SER A . n A 1 18 ASN 18 178 178 ASN ASN A . n A 1 19 ALA 19 179 179 ALA ALA A . n A 1 20 GLN 20 180 180 GLN GLN A . n A 1 21 LEU 21 181 181 LEU LEU A . n A 1 22 ASP 22 182 182 ASP ASP A . n A 1 23 ASN 23 183 183 ASN ASN A . n A 1 24 GLU 24 184 184 GLU GLU A . n A 1 25 LYS 25 185 185 LYS LYS A . n A 1 26 THR 26 186 186 THR THR A . n A 1 27 ASN 27 187 187 ASN ASN A . n A 1 28 PHE 28 188 188 PHE PHE A . n A 1 29 MET 29 189 189 MET MET A . n A 1 30 TYR 30 190 190 TYR TYR A . n A 1 31 GLN 31 191 191 GLN GLN A . n A 1 32 VAL 32 192 192 VAL VAL A . n A 1 33 ASP 33 193 193 ASP ASP A . n A 1 34 THR 34 194 194 THR THR A . n A 1 35 LEU 35 195 195 LEU LEU A . n A 1 36 LYS 36 196 196 LYS LYS A . n A 1 37 ASP 37 197 197 ASP ASP A . n A 1 38 MET 38 198 198 MET MET A . n A 1 39 LEU 39 199 199 LEU LEU A . n A 1 40 LEU 40 200 200 LEU LEU A . n A 1 41 GLU 41 201 201 GLU GLU A . n A 1 42 LEU 42 202 202 LEU LEU A . n A 1 43 GLU 43 203 203 GLU GLU A . n A 1 44 GLU 44 204 204 GLU GLU A . n A 1 45 GLN 45 205 205 GLN GLN A . n A 1 46 LEU 46 206 206 LEU LEU A . n A 1 47 ALA 47 207 207 ALA ALA A . n A 1 48 GLU 48 208 208 GLU GLU A . n A 1 49 SER 49 209 209 SER SER A . n A 1 50 ARG 50 210 210 ARG ARG A . n A 1 51 ARG 51 211 211 ARG ARG A . n A 1 52 GLN 52 212 212 GLN GLN A . n A 1 53 TYR 53 213 213 TYR TYR A . n A 1 54 GLU 54 214 214 GLU GLU A . n A 1 55 GLU 55 215 215 GLU GLU A . n A 1 56 LYS 56 216 216 LYS LYS A . n A 1 57 ASN 57 217 217 ASN ASN A . n A 1 58 LYS 58 218 218 LYS LYS A . n A 1 59 GLU 59 219 219 GLU GLU A . n A 1 60 PHE 60 220 220 PHE PHE A . n A 1 61 GLU 61 221 221 GLU GLU A . n A 1 62 ARG 62 222 222 ARG ARG A . n A 1 63 GLU 63 223 223 GLU GLU A . n A 1 64 LYS 64 224 224 LYS LYS A . n A 1 65 HIS 65 225 225 HIS HIS A . n A 1 66 ALA 66 226 226 ALA ALA A . n A 1 67 HIS 67 227 227 HIS HIS A . n A 1 68 SER 68 228 228 SER SER A . n A 1 69 ILE 69 229 229 ILE ILE A . n A 1 70 LEU 70 230 230 LEU LEU A . n A 1 71 GLN 71 231 231 GLN GLN A . n A 1 72 PHE 72 232 232 PHE PHE A . n A 1 73 GLN 73 233 233 GLN GLN A . n A 1 74 PHE 74 234 234 PHE PHE A . n A 1 75 ALA 75 235 235 ALA ALA A . n A 1 76 GLU 76 236 236 GLU GLU A . n A 1 77 VAL 77 237 237 VAL VAL A . n A 1 78 LYS 78 238 238 LYS LYS A . n A 1 79 GLU 79 239 239 GLU GLU A . n A 1 80 ALA 80 240 240 ALA ALA A . n A 1 81 LEU 81 241 241 LEU LEU A . n A 1 82 LYS 82 242 242 LYS LYS A . n A 1 83 GLN 83 243 243 GLN GLN A . n A 1 84 ARG 84 244 244 ARG ARG A . n A 1 85 GLU 85 245 245 GLU GLU A . n A 1 86 GLU 86 246 246 GLU GLU A . n A 1 87 MET 87 247 247 MET MET A . n A 1 88 LEU 88 248 248 LEU LEU A . n A 1 89 GLU 89 249 ? ? ? A . n A 1 90 PRO 90 250 ? ? ? A . n A 1 91 LYS 91 251 ? ? ? A . n A 1 92 LEU 92 252 ? ? ? A . n A 1 93 ALA 93 253 ? ? ? A . n A 1 94 ALA 94 254 ? ? ? A . n A 1 95 ALA 95 255 ? ? ? A . n A 1 96 LEU 96 256 ? ? ? A . n A 1 97 GLU 97 257 ? ? ? A . n A 1 98 HIS 98 258 ? ? ? A . n A 1 99 HIS 99 259 ? ? ? A . n A 1 100 HIS 100 260 ? ? ? A . n A 1 101 HIS 101 261 ? ? ? A . n A 1 102 HIS 102 262 ? ? ? A . n A 1 103 HIS 103 263 ? ? ? A . n B 1 1 MET 1 161 ? ? ? B . n B 1 2 ASP 2 162 ? ? ? B . n B 1 3 SER 3 163 ? ? ? B . n B 1 4 LEU 4 164 ? ? ? B . n B 1 5 ALA 5 165 ? ? ? B . n B 1 6 GLU 6 166 ? ? ? B . n B 1 7 VAL 7 167 167 VAL VAL B . n B 1 8 GLU 8 168 168 GLU GLU B . n B 1 9 GLU 9 169 169 GLU GLU B . n B 1 10 LYS 10 170 170 LYS LYS B . n B 1 11 TYR 11 171 171 TYR TYR B . n B 1 12 LYS 12 172 172 LYS LYS B . n B 1 13 LYS 13 173 173 LYS LYS B . n B 1 14 ALA 14 174 174 ALA ALA B . n B 1 15 MET 15 175 175 MET MET B . n B 1 16 VAL 16 176 176 VAL VAL B . n B 1 17 SER 17 177 177 SER SER B . n B 1 18 ASN 18 178 178 ASN ASN B . n B 1 19 ALA 19 179 179 ALA ALA B . n B 1 20 GLN 20 180 180 GLN GLN B . n B 1 21 LEU 21 181 181 LEU LEU B . n B 1 22 ASP 22 182 182 ASP ASP B . n B 1 23 ASN 23 183 183 ASN ASN B . n B 1 24 GLU 24 184 184 GLU GLU B . n B 1 25 LYS 25 185 185 LYS LYS B . n B 1 26 THR 26 186 186 THR THR B . n B 1 27 ASN 27 187 187 ASN ASN B . n B 1 28 PHE 28 188 188 PHE PHE B . n B 1 29 MET 29 189 189 MET MET B . n B 1 30 TYR 30 190 190 TYR TYR B . n B 1 31 GLN 31 191 191 GLN GLN B . n B 1 32 VAL 32 192 192 VAL VAL B . n B 1 33 ASP 33 193 193 ASP ASP B . n B 1 34 THR 34 194 194 THR THR B . n B 1 35 LEU 35 195 195 LEU LEU B . n B 1 36 LYS 36 196 196 LYS LYS B . n B 1 37 ASP 37 197 197 ASP ASP B . n B 1 38 MET 38 198 198 MET MET B . n B 1 39 LEU 39 199 199 LEU LEU B . n B 1 40 LEU 40 200 200 LEU LEU B . n B 1 41 GLU 41 201 201 GLU GLU B . n B 1 42 LEU 42 202 202 LEU LEU B . n B 1 43 GLU 43 203 203 GLU GLU B . n B 1 44 GLU 44 204 204 GLU GLU B . n B 1 45 GLN 45 205 205 GLN GLN B . n B 1 46 LEU 46 206 206 LEU LEU B . n B 1 47 ALA 47 207 207 ALA ALA B . n B 1 48 GLU 48 208 208 GLU GLU B . n B 1 49 SER 49 209 209 SER SER B . n B 1 50 ARG 50 210 210 ARG ARG B . n B 1 51 ARG 51 211 211 ARG ARG B . n B 1 52 GLN 52 212 212 GLN GLN B . n B 1 53 TYR 53 213 213 TYR TYR B . n B 1 54 GLU 54 214 214 GLU GLU B . n B 1 55 GLU 55 215 215 GLU GLU B . n B 1 56 LYS 56 216 216 LYS LYS B . n B 1 57 ASN 57 217 217 ASN ASN B . n B 1 58 LYS 58 218 218 LYS LYS B . n B 1 59 GLU 59 219 219 GLU GLU B . n B 1 60 PHE 60 220 220 PHE PHE B . n B 1 61 GLU 61 221 221 GLU GLU B . n B 1 62 ARG 62 222 222 ARG ARG B . n B 1 63 GLU 63 223 223 GLU GLU B . n B 1 64 LYS 64 224 224 LYS LYS B . n B 1 65 HIS 65 225 225 HIS HIS B . n B 1 66 ALA 66 226 226 ALA ALA B . n B 1 67 HIS 67 227 227 HIS HIS B . n B 1 68 SER 68 228 228 SER SER B . n B 1 69 ILE 69 229 229 ILE ILE B . n B 1 70 LEU 70 230 230 LEU LEU B . n B 1 71 GLN 71 231 231 GLN GLN B . n B 1 72 PHE 72 232 232 PHE PHE B . n B 1 73 GLN 73 233 233 GLN GLN B . n B 1 74 PHE 74 234 234 PHE PHE B . n B 1 75 ALA 75 235 235 ALA ALA B . n B 1 76 GLU 76 236 236 GLU GLU B . n B 1 77 VAL 77 237 237 VAL VAL B . n B 1 78 LYS 78 238 238 LYS LYS B . n B 1 79 GLU 79 239 239 GLU GLU B . n B 1 80 ALA 80 240 240 ALA ALA B . n B 1 81 LEU 81 241 241 LEU LEU B . n B 1 82 LYS 82 242 242 LYS LYS B . n B 1 83 GLN 83 243 243 GLN GLN B . n B 1 84 ARG 84 244 244 ARG ARG B . n B 1 85 GLU 85 245 245 GLU GLU B . n B 1 86 GLU 86 246 246 GLU GLU B . n B 1 87 MET 87 247 247 MET MET B . n B 1 88 LEU 88 248 248 LEU LEU B . n B 1 89 GLU 89 249 249 GLU GLU B . n B 1 90 PRO 90 250 ? ? ? B . n B 1 91 LYS 91 251 ? ? ? B . n B 1 92 LEU 92 252 ? ? ? B . n B 1 93 ALA 93 253 ? ? ? B . n B 1 94 ALA 94 254 ? ? ? B . n B 1 95 ALA 95 255 ? ? ? B . n B 1 96 LEU 96 256 ? ? ? B . n B 1 97 GLU 97 257 ? ? ? B . n B 1 98 HIS 98 258 ? ? ? B . n B 1 99 HIS 99 259 ? ? ? B . n B 1 100 HIS 100 260 ? ? ? B . n B 1 101 HIS 101 261 ? ? ? B . n B 1 102 HIS 102 262 ? ? ? B . n B 1 103 HIS 103 263 ? ? ? B . n C 1 1 MET 1 161 ? ? ? C . n C 1 2 ASP 2 162 ? ? ? C . n C 1 3 SER 3 163 ? ? ? C . n C 1 4 LEU 4 164 ? ? ? C . n C 1 5 ALA 5 165 ? ? ? C . n C 1 6 GLU 6 166 ? ? ? C . n C 1 7 VAL 7 167 ? ? ? C . n C 1 8 GLU 8 168 ? ? ? C . n C 1 9 GLU 9 169 ? ? ? C . n C 1 10 LYS 10 170 170 LYS LYS C . n C 1 11 TYR 11 171 171 TYR TYR C . n C 1 12 LYS 12 172 172 LYS LYS C . n C 1 13 LYS 13 173 173 LYS LYS C . n C 1 14 ALA 14 174 174 ALA ALA C . n C 1 15 MET 15 175 175 MET MET C . n C 1 16 VAL 16 176 176 VAL VAL C . n C 1 17 SER 17 177 177 SER SER C . n C 1 18 ASN 18 178 178 ASN ASN C . n C 1 19 ALA 19 179 179 ALA ALA C . n C 1 20 GLN 20 180 180 GLN GLN C . n C 1 21 LEU 21 181 181 LEU LEU C . n C 1 22 ASP 22 182 182 ASP ASP C . n C 1 23 ASN 23 183 183 ASN ASN C . n C 1 24 GLU 24 184 184 GLU GLU C . n C 1 25 LYS 25 185 185 LYS LYS C . n C 1 26 THR 26 186 186 THR THR C . n C 1 27 ASN 27 187 187 ASN ASN C . n C 1 28 PHE 28 188 188 PHE PHE C . n C 1 29 MET 29 189 189 MET MET C . n C 1 30 TYR 30 190 190 TYR TYR C . n C 1 31 GLN 31 191 191 GLN GLN C . n C 1 32 VAL 32 192 192 VAL VAL C . n C 1 33 ASP 33 193 193 ASP ASP C . n C 1 34 THR 34 194 194 THR THR C . n C 1 35 LEU 35 195 195 LEU LEU C . n C 1 36 LYS 36 196 196 LYS LYS C . n C 1 37 ASP 37 197 197 ASP ASP C . n C 1 38 MET 38 198 198 MET MET C . n C 1 39 LEU 39 199 199 LEU LEU C . n C 1 40 LEU 40 200 200 LEU LEU C . n C 1 41 GLU 41 201 201 GLU GLU C . n C 1 42 LEU 42 202 202 LEU LEU C . n C 1 43 GLU 43 203 203 GLU GLU C . n C 1 44 GLU 44 204 204 GLU GLU C . n C 1 45 GLN 45 205 205 GLN GLN C . n C 1 46 LEU 46 206 206 LEU LEU C . n C 1 47 ALA 47 207 207 ALA ALA C . n C 1 48 GLU 48 208 208 GLU GLU C . n C 1 49 SER 49 209 209 SER SER C . n C 1 50 ARG 50 210 210 ARG ARG C . n C 1 51 ARG 51 211 211 ARG ARG C . n C 1 52 GLN 52 212 212 GLN GLN C . n C 1 53 TYR 53 213 213 TYR TYR C . n C 1 54 GLU 54 214 214 GLU GLU C . n C 1 55 GLU 55 215 215 GLU GLU C . n C 1 56 LYS 56 216 216 LYS LYS C . n C 1 57 ASN 57 217 217 ASN ASN C . n C 1 58 LYS 58 218 218 LYS LYS C . n C 1 59 GLU 59 219 219 GLU GLU C . n C 1 60 PHE 60 220 220 PHE PHE C . n C 1 61 GLU 61 221 221 GLU GLU C . n C 1 62 ARG 62 222 222 ARG ARG C . n C 1 63 GLU 63 223 223 GLU GLU C . n C 1 64 LYS 64 224 224 LYS LYS C . n C 1 65 HIS 65 225 225 HIS HIS C . n C 1 66 ALA 66 226 226 ALA ALA C . n C 1 67 HIS 67 227 227 HIS HIS C . n C 1 68 SER 68 228 228 SER SER C . n C 1 69 ILE 69 229 229 ILE ILE C . n C 1 70 LEU 70 230 230 LEU LEU C . n C 1 71 GLN 71 231 231 GLN GLN C . n C 1 72 PHE 72 232 232 PHE PHE C . n C 1 73 GLN 73 233 233 GLN GLN C . n C 1 74 PHE 74 234 234 PHE PHE C . n C 1 75 ALA 75 235 235 ALA ALA C . n C 1 76 GLU 76 236 236 GLU GLU C . n C 1 77 VAL 77 237 237 VAL VAL C . n C 1 78 LYS 78 238 238 LYS LYS C . n C 1 79 GLU 79 239 239 GLU GLU C . n C 1 80 ALA 80 240 240 ALA ALA C . n C 1 81 LEU 81 241 241 LEU LEU C . n C 1 82 LYS 82 242 242 LYS LYS C . n C 1 83 GLN 83 243 243 GLN GLN C . n C 1 84 ARG 84 244 ? ? ? C . n C 1 85 GLU 85 245 ? ? ? C . n C 1 86 GLU 86 246 ? ? ? C . n C 1 87 MET 87 247 ? ? ? C . n C 1 88 LEU 88 248 ? ? ? C . n C 1 89 GLU 89 249 ? ? ? C . n C 1 90 PRO 90 250 ? ? ? C . n C 1 91 LYS 91 251 ? ? ? C . n C 1 92 LEU 92 252 ? ? ? C . n C 1 93 ALA 93 253 ? ? ? C . n C 1 94 ALA 94 254 ? ? ? C . n C 1 95 ALA 95 255 ? ? ? C . n C 1 96 LEU 96 256 ? ? ? C . n C 1 97 GLU 97 257 ? ? ? C . n C 1 98 HIS 98 258 ? ? ? C . n C 1 99 HIS 99 259 ? ? ? C . n C 1 100 HIS 100 260 ? ? ? C . n C 1 101 HIS 101 261 ? ? ? C . n C 1 102 HIS 102 262 ? ? ? C . n C 1 103 HIS 103 263 ? ? ? C . n D 1 1 MET 1 161 ? ? ? D . n D 1 2 ASP 2 162 ? ? ? D . n D 1 3 SER 3 163 ? ? ? D . n D 1 4 LEU 4 164 ? ? ? D . n D 1 5 ALA 5 165 ? ? ? D . n D 1 6 GLU 6 166 ? ? ? D . n D 1 7 VAL 7 167 ? ? ? D . n D 1 8 GLU 8 168 ? ? ? D . n D 1 9 GLU 9 169 ? ? ? D . n D 1 10 LYS 10 170 170 LYS LYS D . n D 1 11 TYR 11 171 171 TYR TYR D . n D 1 12 LYS 12 172 172 LYS LYS D . n D 1 13 LYS 13 173 173 LYS LYS D . n D 1 14 ALA 14 174 174 ALA ALA D . n D 1 15 MET 15 175 175 MET MET D . n D 1 16 VAL 16 176 176 VAL VAL D . n D 1 17 SER 17 177 177 SER SER D . n D 1 18 ASN 18 178 178 ASN ASN D . n D 1 19 ALA 19 179 179 ALA ALA D . n D 1 20 GLN 20 180 180 GLN GLN D . n D 1 21 LEU 21 181 181 LEU LEU D . n D 1 22 ASP 22 182 182 ASP ASP D . n D 1 23 ASN 23 183 183 ASN ASN D . n D 1 24 GLU 24 184 184 GLU GLU D . n D 1 25 LYS 25 185 185 LYS LYS D . n D 1 26 THR 26 186 186 THR THR D . n D 1 27 ASN 27 187 187 ASN ASN D . n D 1 28 PHE 28 188 188 PHE PHE D . n D 1 29 MET 29 189 189 MET MET D . n D 1 30 TYR 30 190 190 TYR TYR D . n D 1 31 GLN 31 191 191 GLN GLN D . n D 1 32 VAL 32 192 192 VAL VAL D . n D 1 33 ASP 33 193 193 ASP ASP D . n D 1 34 THR 34 194 194 THR THR D . n D 1 35 LEU 35 195 195 LEU LEU D . n D 1 36 LYS 36 196 196 LYS LYS D . n D 1 37 ASP 37 197 197 ASP ASP D . n D 1 38 MET 38 198 198 MET MET D . n D 1 39 LEU 39 199 199 LEU LEU D . n D 1 40 LEU 40 200 200 LEU LEU D . n D 1 41 GLU 41 201 201 GLU GLU D . n D 1 42 LEU 42 202 202 LEU LEU D . n D 1 43 GLU 43 203 203 GLU GLU D . n D 1 44 GLU 44 204 204 GLU GLU D . n D 1 45 GLN 45 205 205 GLN GLN D . n D 1 46 LEU 46 206 206 LEU LEU D . n D 1 47 ALA 47 207 207 ALA ALA D . n D 1 48 GLU 48 208 208 GLU GLU D . n D 1 49 SER 49 209 209 SER SER D . n D 1 50 ARG 50 210 210 ARG ARG D . n D 1 51 ARG 51 211 211 ARG ARG D . n D 1 52 GLN 52 212 212 GLN GLN D . n D 1 53 TYR 53 213 213 TYR TYR D . n D 1 54 GLU 54 214 214 GLU GLU D . n D 1 55 GLU 55 215 215 GLU GLU D . n D 1 56 LYS 56 216 216 LYS LYS D . n D 1 57 ASN 57 217 217 ASN ASN D . n D 1 58 LYS 58 218 218 LYS LYS D . n D 1 59 GLU 59 219 219 GLU GLU D . n D 1 60 PHE 60 220 220 PHE PHE D . n D 1 61 GLU 61 221 221 GLU GLU D . n D 1 62 ARG 62 222 222 ARG ARG D . n D 1 63 GLU 63 223 223 GLU GLU D . n D 1 64 LYS 64 224 224 LYS LYS D . n D 1 65 HIS 65 225 225 HIS HIS D . n D 1 66 ALA 66 226 226 ALA ALA D . n D 1 67 HIS 67 227 227 HIS HIS D . n D 1 68 SER 68 228 228 SER SER D . n D 1 69 ILE 69 229 229 ILE ILE D . n D 1 70 LEU 70 230 230 LEU LEU D . n D 1 71 GLN 71 231 231 GLN GLN D . n D 1 72 PHE 72 232 232 PHE PHE D . n D 1 73 GLN 73 233 233 GLN GLN D . n D 1 74 PHE 74 234 234 PHE PHE D . n D 1 75 ALA 75 235 235 ALA ALA D . n D 1 76 GLU 76 236 236 GLU GLU D . n D 1 77 VAL 77 237 237 VAL VAL D . n D 1 78 LYS 78 238 238 LYS LYS D . n D 1 79 GLU 79 239 239 GLU GLU D . n D 1 80 ALA 80 240 240 ALA ALA D . n D 1 81 LEU 81 241 241 LEU LEU D . n D 1 82 LYS 82 242 242 LYS LYS D . n D 1 83 GLN 83 243 243 GLN GLN D . n D 1 84 ARG 84 244 ? ? ? D . n D 1 85 GLU 85 245 ? ? ? D . n D 1 86 GLU 86 246 ? ? ? D . n D 1 87 MET 87 247 ? ? ? D . n D 1 88 LEU 88 248 ? ? ? D . n D 1 89 GLU 89 249 ? ? ? D . n D 1 90 PRO 90 250 ? ? ? D . n D 1 91 LYS 91 251 ? ? ? D . n D 1 92 LEU 92 252 ? ? ? D . n D 1 93 ALA 93 253 ? ? ? D . n D 1 94 ALA 94 254 ? ? ? D . n D 1 95 ALA 95 255 ? ? ? D . n D 1 96 LEU 96 256 ? ? ? D . n D 1 97 GLU 97 257 ? ? ? D . n D 1 98 HIS 98 258 ? ? ? D . n D 1 99 HIS 99 259 ? ? ? D . n D 1 100 HIS 100 260 ? ? ? D . n D 1 101 HIS 101 261 ? ? ? D . n D 1 102 HIS 102 262 ? ? ? D . n D 1 103 HIS 103 263 ? ? ? D . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code E 2 HOH 1 301 2 HOH HOH A . E 2 HOH 2 302 4 HOH HOH A . E 2 HOH 3 303 13 HOH HOH A . E 2 HOH 4 304 15 HOH HOH A . E 2 HOH 5 305 17 HOH HOH A . E 2 HOH 6 306 20 HOH HOH A . E 2 HOH 7 307 32 HOH HOH A . E 2 HOH 8 308 33 HOH HOH A . F 2 HOH 1 301 7 HOH HOH B . F 2 HOH 2 302 11 HOH HOH B . F 2 HOH 3 303 19 HOH HOH B . F 2 HOH 4 304 21 HOH HOH B . F 2 HOH 5 305 24 HOH HOH B . F 2 HOH 6 306 28 HOH HOH B . G 2 HOH 1 301 5 HOH HOH C . G 2 HOH 2 302 6 HOH HOH C . G 2 HOH 3 303 38 HOH HOH C . G 2 HOH 4 304 40 HOH HOH C . H 2 HOH 1 301 1 HOH HOH D . H 2 HOH 2 302 18 HOH HOH D . H 2 HOH 3 303 22 HOH HOH D . H 2 HOH 4 304 25 HOH HOH D . H 2 HOH 5 305 29 HOH HOH D . H 2 HOH 6 306 30 HOH HOH D . H 2 HOH 7 307 31 HOH HOH D . H 2 HOH 8 308 34 HOH HOH D . # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1 A,B,E,F 2 1 C,D,G,H # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4650 ? 1 MORE -44 ? 1 'SSA (A^2)' 12680 ? 2 'ABSA (A^2)' 4180 ? 2 MORE -40 ? 2 'SSA (A^2)' 11220 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2012-11-07 2 'Structure model' 1 1 2013-01-02 3 'Structure model' 1 2 2023-09-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] 'X-RAY DIFFRACTION' 1 ? refined -0.2819 8.7795 -20.8824 0.0784 0.2586 0.1764 0.0461 -0.0863 0.0172 3.9850 1.0622 1.1652 -2.0130 1.9662 -0.9761 0.1845 -0.0268 -0.1577 -0.2041 0.1015 -0.0631 -0.1283 0.1968 -0.1351 'X-RAY DIFFRACTION' 2 ? refined -1.0950 7.0633 -21.7395 0.1164 0.1534 0.1376 0.0190 0.0173 0.0537 0.9733 1.2715 1.1365 -0.8639 0.5052 -0.7141 0.1311 -0.1203 -0.0108 -0.0249 -0.0202 -0.0961 -0.0645 0.2597 0.0798 'X-RAY DIFFRACTION' 3 ? refined -25.5810 17.7081 -23.4163 0.1282 0.1749 0.1710 0.0560 -0.0070 -0.0052 1.4908 3.5576 0.1991 -2.2001 -0.4988 0.7594 -0.0536 0.1236 -0.0700 -0.1409 -0.0274 0.0700 -0.1294 -0.0061 0.0241 'X-RAY DIFFRACTION' 4 ? refined -24.9950 16.7117 -19.4822 0.0700 0.1724 0.2630 0.0831 0.0512 0.0279 4.6931 6.2629 0.6699 -5.1966 -1.5036 1.8809 0.0940 0.0808 -0.1748 -0.3437 -0.1738 0.0811 -0.3238 -0.1286 0.0249 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 168 A 248 ? . . . . ? 'X-RAY DIFFRACTION' 2 2 B 167 B 249 ? . . . . ? 'X-RAY DIFFRACTION' 3 3 C 170 C 243 ? . . . . ? 'X-RAY DIFFRACTION' 4 4 D 170 D 243 ? . . . . ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 PHASER phasing . ? 2 REFMAC refinement 5.6.0117 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 168 ? CG ? A GLU 8 CG 2 1 Y 1 A GLU 168 ? CD ? A GLU 8 CD 3 1 Y 1 A GLU 168 ? OE1 ? A GLU 8 OE1 4 1 Y 1 A GLU 168 ? OE2 ? A GLU 8 OE2 5 1 Y 1 A LYS 170 ? CG ? A LYS 10 CG 6 1 Y 1 A LYS 170 ? CD ? A LYS 10 CD 7 1 Y 1 A LYS 170 ? CE ? A LYS 10 CE 8 1 Y 1 A LYS 170 ? NZ ? A LYS 10 NZ 9 1 Y 1 B GLU 168 ? CG ? B GLU 8 CG 10 1 Y 1 B GLU 168 ? CD ? B GLU 8 CD 11 1 Y 1 B GLU 168 ? OE1 ? B GLU 8 OE1 12 1 Y 1 B GLU 168 ? OE2 ? B GLU 8 OE2 13 1 Y 1 B LYS 170 ? CG ? B LYS 10 CG 14 1 Y 1 B LYS 170 ? CD ? B LYS 10 CD 15 1 Y 1 B LYS 170 ? CE ? B LYS 10 CE 16 1 Y 1 B LYS 170 ? NZ ? B LYS 10 NZ 17 1 Y 1 C LYS 170 ? CG ? C LYS 10 CG 18 1 Y 1 C LYS 170 ? CD ? C LYS 10 CD 19 1 Y 1 C LYS 170 ? CE ? C LYS 10 CE 20 1 Y 1 C LYS 170 ? NZ ? C LYS 10 NZ 21 1 Y 1 C LYS 172 ? CG ? C LYS 12 CG 22 1 Y 1 C LYS 172 ? CD ? C LYS 12 CD 23 1 Y 1 C LYS 172 ? CE ? C LYS 12 CE 24 1 Y 1 C LYS 172 ? NZ ? C LYS 12 NZ 25 1 Y 1 D LYS 170 ? CG ? D LYS 10 CG 26 1 Y 1 D LYS 170 ? CD ? D LYS 10 CD 27 1 Y 1 D LYS 170 ? CE ? D LYS 10 CE 28 1 Y 1 D LYS 170 ? NZ ? D LYS 10 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 161 ? A MET 1 2 1 Y 1 A ASP 162 ? A ASP 2 3 1 Y 1 A SER 163 ? A SER 3 4 1 Y 1 A LEU 164 ? A LEU 4 5 1 Y 1 A ALA 165 ? A ALA 5 6 1 Y 1 A GLU 166 ? A GLU 6 7 1 Y 1 A VAL 167 ? A VAL 7 8 1 Y 1 A GLU 249 ? A GLU 89 9 1 Y 1 A PRO 250 ? A PRO 90 10 1 Y 1 A LYS 251 ? A LYS 91 11 1 Y 1 A LEU 252 ? A LEU 92 12 1 Y 1 A ALA 253 ? A ALA 93 13 1 Y 1 A ALA 254 ? A ALA 94 14 1 Y 1 A ALA 255 ? A ALA 95 15 1 Y 1 A LEU 256 ? A LEU 96 16 1 Y 1 A GLU 257 ? A GLU 97 17 1 Y 1 A HIS 258 ? A HIS 98 18 1 Y 1 A HIS 259 ? A HIS 99 19 1 Y 1 A HIS 260 ? A HIS 100 20 1 Y 1 A HIS 261 ? A HIS 101 21 1 Y 1 A HIS 262 ? A HIS 102 22 1 Y 1 A HIS 263 ? A HIS 103 23 1 Y 1 B MET 161 ? B MET 1 24 1 Y 1 B ASP 162 ? B ASP 2 25 1 Y 1 B SER 163 ? B SER 3 26 1 Y 1 B LEU 164 ? B LEU 4 27 1 Y 1 B ALA 165 ? B ALA 5 28 1 Y 1 B GLU 166 ? B GLU 6 29 1 Y 1 B PRO 250 ? B PRO 90 30 1 Y 1 B LYS 251 ? B LYS 91 31 1 Y 1 B LEU 252 ? B LEU 92 32 1 Y 1 B ALA 253 ? B ALA 93 33 1 Y 1 B ALA 254 ? B ALA 94 34 1 Y 1 B ALA 255 ? B ALA 95 35 1 Y 1 B LEU 256 ? B LEU 96 36 1 Y 1 B GLU 257 ? B GLU 97 37 1 Y 1 B HIS 258 ? B HIS 98 38 1 Y 1 B HIS 259 ? B HIS 99 39 1 Y 1 B HIS 260 ? B HIS 100 40 1 Y 1 B HIS 261 ? B HIS 101 41 1 Y 1 B HIS 262 ? B HIS 102 42 1 Y 1 B HIS 263 ? B HIS 103 43 1 Y 1 C MET 161 ? C MET 1 44 1 Y 1 C ASP 162 ? C ASP 2 45 1 Y 1 C SER 163 ? C SER 3 46 1 Y 1 C LEU 164 ? C LEU 4 47 1 Y 1 C ALA 165 ? C ALA 5 48 1 Y 1 C GLU 166 ? C GLU 6 49 1 Y 1 C VAL 167 ? C VAL 7 50 1 Y 1 C GLU 168 ? C GLU 8 51 1 Y 1 C GLU 169 ? C GLU 9 52 1 Y 1 C ARG 244 ? C ARG 84 53 1 Y 1 C GLU 245 ? C GLU 85 54 1 Y 1 C GLU 246 ? C GLU 86 55 1 Y 1 C MET 247 ? C MET 87 56 1 Y 1 C LEU 248 ? C LEU 88 57 1 Y 1 C GLU 249 ? C GLU 89 58 1 Y 1 C PRO 250 ? C PRO 90 59 1 Y 1 C LYS 251 ? C LYS 91 60 1 Y 1 C LEU 252 ? C LEU 92 61 1 Y 1 C ALA 253 ? C ALA 93 62 1 Y 1 C ALA 254 ? C ALA 94 63 1 Y 1 C ALA 255 ? C ALA 95 64 1 Y 1 C LEU 256 ? C LEU 96 65 1 Y 1 C GLU 257 ? C GLU 97 66 1 Y 1 C HIS 258 ? C HIS 98 67 1 Y 1 C HIS 259 ? C HIS 99 68 1 Y 1 C HIS 260 ? C HIS 100 69 1 Y 1 C HIS 261 ? C HIS 101 70 1 Y 1 C HIS 262 ? C HIS 102 71 1 Y 1 C HIS 263 ? C HIS 103 72 1 Y 1 D MET 161 ? D MET 1 73 1 Y 1 D ASP 162 ? D ASP 2 74 1 Y 1 D SER 163 ? D SER 3 75 1 Y 1 D LEU 164 ? D LEU 4 76 1 Y 1 D ALA 165 ? D ALA 5 77 1 Y 1 D GLU 166 ? D GLU 6 78 1 Y 1 D VAL 167 ? D VAL 7 79 1 Y 1 D GLU 168 ? D GLU 8 80 1 Y 1 D GLU 169 ? D GLU 9 81 1 Y 1 D ARG 244 ? D ARG 84 82 1 Y 1 D GLU 245 ? D GLU 85 83 1 Y 1 D GLU 246 ? D GLU 86 84 1 Y 1 D MET 247 ? D MET 87 85 1 Y 1 D LEU 248 ? D LEU 88 86 1 Y 1 D GLU 249 ? D GLU 89 87 1 Y 1 D PRO 250 ? D PRO 90 88 1 Y 1 D LYS 251 ? D LYS 91 89 1 Y 1 D LEU 252 ? D LEU 92 90 1 Y 1 D ALA 253 ? D ALA 93 91 1 Y 1 D ALA 254 ? D ALA 94 92 1 Y 1 D ALA 255 ? D ALA 95 93 1 Y 1 D LEU 256 ? D LEU 96 94 1 Y 1 D GLU 257 ? D GLU 97 95 1 Y 1 D HIS 258 ? D HIS 98 96 1 Y 1 D HIS 259 ? D HIS 99 97 1 Y 1 D HIS 260 ? D HIS 100 98 1 Y 1 D HIS 261 ? D HIS 101 99 1 Y 1 D HIS 262 ? D HIS 102 100 1 Y 1 D HIS 263 ? D HIS 103 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 HIS N N N N 113 HIS CA C N S 114 HIS C C N N 115 HIS O O N N 116 HIS CB C N N 117 HIS CG C Y N 118 HIS ND1 N Y N 119 HIS CD2 C Y N 120 HIS CE1 C Y N 121 HIS NE2 N Y N 122 HIS OXT O N N 123 HIS H H N N 124 HIS H2 H N N 125 HIS HA H N N 126 HIS HB2 H N N 127 HIS HB3 H N N 128 HIS HD1 H N N 129 HIS HD2 H N N 130 HIS HE1 H N N 131 HIS HE2 H N N 132 HIS HXT H N N 133 HOH O O N N 134 HOH H1 H N N 135 HOH H2 H N N 136 ILE N N N N 137 ILE CA C N S 138 ILE C C N N 139 ILE O O N N 140 ILE CB C N S 141 ILE CG1 C N N 142 ILE CG2 C N N 143 ILE CD1 C N N 144 ILE OXT O N N 145 ILE H H N N 146 ILE H2 H N N 147 ILE HA H N N 148 ILE HB H N N 149 ILE HG12 H N N 150 ILE HG13 H N N 151 ILE HG21 H N N 152 ILE HG22 H N N 153 ILE HG23 H N N 154 ILE HD11 H N N 155 ILE HD12 H N N 156 ILE HD13 H N N 157 ILE HXT H N N 158 LEU N N N N 159 LEU CA C N S 160 LEU C C N N 161 LEU O O N N 162 LEU CB C N N 163 LEU CG C N N 164 LEU CD1 C N N 165 LEU CD2 C N N 166 LEU OXT O N N 167 LEU H H N N 168 LEU H2 H N N 169 LEU HA H N N 170 LEU HB2 H N N 171 LEU HB3 H N N 172 LEU HG H N N 173 LEU HD11 H N N 174 LEU HD12 H N N 175 LEU HD13 H N N 176 LEU HD21 H N N 177 LEU HD22 H N N 178 LEU HD23 H N N 179 LEU HXT H N N 180 LYS N N N N 181 LYS CA C N S 182 LYS C C N N 183 LYS O O N N 184 LYS CB C N N 185 LYS CG C N N 186 LYS CD C N N 187 LYS CE C N N 188 LYS NZ N N N 189 LYS OXT O N N 190 LYS H H N N 191 LYS H2 H N N 192 LYS HA H N N 193 LYS HB2 H N N 194 LYS HB3 H N N 195 LYS HG2 H N N 196 LYS HG3 H N N 197 LYS HD2 H N N 198 LYS HD3 H N N 199 LYS HE2 H N N 200 LYS HE3 H N N 201 LYS HZ1 H N N 202 LYS HZ2 H N N 203 LYS HZ3 H N N 204 LYS HXT H N N 205 MET N N N N 206 MET CA C N S 207 MET C C N N 208 MET O O N N 209 MET CB C N N 210 MET CG C N N 211 MET SD S N N 212 MET CE C N N 213 MET OXT O N N 214 MET H H N N 215 MET H2 H N N 216 MET HA H N N 217 MET HB2 H N N 218 MET HB3 H N N 219 MET HG2 H N N 220 MET HG3 H N N 221 MET HE1 H N N 222 MET HE2 H N N 223 MET HE3 H N N 224 MET HXT H N N 225 PHE N N N N 226 PHE CA C N S 227 PHE C C N N 228 PHE O O N N 229 PHE CB C N N 230 PHE CG C Y N 231 PHE CD1 C Y N 232 PHE CD2 C Y N 233 PHE CE1 C Y N 234 PHE CE2 C Y N 235 PHE CZ C Y N 236 PHE OXT O N N 237 PHE H H N N 238 PHE H2 H N N 239 PHE HA H N N 240 PHE HB2 H N N 241 PHE HB3 H N N 242 PHE HD1 H N N 243 PHE HD2 H N N 244 PHE HE1 H N N 245 PHE HE2 H N N 246 PHE HZ H N N 247 PHE HXT H N N 248 PRO N N N N 249 PRO CA C N S 250 PRO C C N N 251 PRO O O N N 252 PRO CB C N N 253 PRO CG C N N 254 PRO CD C N N 255 PRO OXT O N N 256 PRO H H N N 257 PRO HA H N N 258 PRO HB2 H N N 259 PRO HB3 H N N 260 PRO HG2 H N N 261 PRO HG3 H N N 262 PRO HD2 H N N 263 PRO HD3 H N N 264 PRO HXT H N N 265 SER N N N N 266 SER CA C N S 267 SER C C N N 268 SER O O N N 269 SER CB C N N 270 SER OG O N N 271 SER OXT O N N 272 SER H H N N 273 SER H2 H N N 274 SER HA H N N 275 SER HB2 H N N 276 SER HB3 H N N 277 SER HG H N N 278 SER HXT H N N 279 THR N N N N 280 THR CA C N S 281 THR C C N N 282 THR O O N N 283 THR CB C N R 284 THR OG1 O N N 285 THR CG2 C N N 286 THR OXT O N N 287 THR H H N N 288 THR H2 H N N 289 THR HA H N N 290 THR HB H N N 291 THR HG1 H N N 292 THR HG21 H N N 293 THR HG22 H N N 294 THR HG23 H N N 295 THR HXT H N N 296 TYR N N N N 297 TYR CA C N S 298 TYR C C N N 299 TYR O O N N 300 TYR CB C N N 301 TYR CG C Y N 302 TYR CD1 C Y N 303 TYR CD2 C Y N 304 TYR CE1 C Y N 305 TYR CE2 C Y N 306 TYR CZ C Y N 307 TYR OH O N N 308 TYR OXT O N N 309 TYR H H N N 310 TYR H2 H N N 311 TYR HA H N N 312 TYR HB2 H N N 313 TYR HB3 H N N 314 TYR HD1 H N N 315 TYR HD2 H N N 316 TYR HE1 H N N 317 TYR HE2 H N N 318 TYR HH H N N 319 TYR HXT H N N 320 VAL N N N N 321 VAL CA C N S 322 VAL C C N N 323 VAL O O N N 324 VAL CB C N N 325 VAL CG1 C N N 326 VAL CG2 C N N 327 VAL OXT O N N 328 VAL H H N N 329 VAL H2 H N N 330 VAL HA H N N 331 VAL HB H N N 332 VAL HG11 H N N 333 VAL HG12 H N N 334 VAL HG13 H N N 335 VAL HG21 H N N 336 VAL HG22 H N N 337 VAL HG23 H N N 338 VAL HXT H N N 339 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 HIS N CA sing N N 107 HIS N H sing N N 108 HIS N H2 sing N N 109 HIS CA C sing N N 110 HIS CA CB sing N N 111 HIS CA HA sing N N 112 HIS C O doub N N 113 HIS C OXT sing N N 114 HIS CB CG sing N N 115 HIS CB HB2 sing N N 116 HIS CB HB3 sing N N 117 HIS CG ND1 sing Y N 118 HIS CG CD2 doub Y N 119 HIS ND1 CE1 doub Y N 120 HIS ND1 HD1 sing N N 121 HIS CD2 NE2 sing Y N 122 HIS CD2 HD2 sing N N 123 HIS CE1 NE2 sing Y N 124 HIS CE1 HE1 sing N N 125 HIS NE2 HE2 sing N N 126 HIS OXT HXT sing N N 127 HOH O H1 sing N N 128 HOH O H2 sing N N 129 ILE N CA sing N N 130 ILE N H sing N N 131 ILE N H2 sing N N 132 ILE CA C sing N N 133 ILE CA CB sing N N 134 ILE CA HA sing N N 135 ILE C O doub N N 136 ILE C OXT sing N N 137 ILE CB CG1 sing N N 138 ILE CB CG2 sing N N 139 ILE CB HB sing N N 140 ILE CG1 CD1 sing N N 141 ILE CG1 HG12 sing N N 142 ILE CG1 HG13 sing N N 143 ILE CG2 HG21 sing N N 144 ILE CG2 HG22 sing N N 145 ILE CG2 HG23 sing N N 146 ILE CD1 HD11 sing N N 147 ILE CD1 HD12 sing N N 148 ILE CD1 HD13 sing N N 149 ILE OXT HXT sing N N 150 LEU N CA sing N N 151 LEU N H sing N N 152 LEU N H2 sing N N 153 LEU CA C sing N N 154 LEU CA CB sing N N 155 LEU CA HA sing N N 156 LEU C O doub N N 157 LEU C OXT sing N N 158 LEU CB CG sing N N 159 LEU CB HB2 sing N N 160 LEU CB HB3 sing N N 161 LEU CG CD1 sing N N 162 LEU CG CD2 sing N N 163 LEU CG HG sing N N 164 LEU CD1 HD11 sing N N 165 LEU CD1 HD12 sing N N 166 LEU CD1 HD13 sing N N 167 LEU CD2 HD21 sing N N 168 LEU CD2 HD22 sing N N 169 LEU CD2 HD23 sing N N 170 LEU OXT HXT sing N N 171 LYS N CA sing N N 172 LYS N H sing N N 173 LYS N H2 sing N N 174 LYS CA C sing N N 175 LYS CA CB sing N N 176 LYS CA HA sing N N 177 LYS C O doub N N 178 LYS C OXT sing N N 179 LYS CB CG sing N N 180 LYS CB HB2 sing N N 181 LYS CB HB3 sing N N 182 LYS CG CD sing N N 183 LYS CG HG2 sing N N 184 LYS CG HG3 sing N N 185 LYS CD CE sing N N 186 LYS CD HD2 sing N N 187 LYS CD HD3 sing N N 188 LYS CE NZ sing N N 189 LYS CE HE2 sing N N 190 LYS CE HE3 sing N N 191 LYS NZ HZ1 sing N N 192 LYS NZ HZ2 sing N N 193 LYS NZ HZ3 sing N N 194 LYS OXT HXT sing N N 195 MET N CA sing N N 196 MET N H sing N N 197 MET N H2 sing N N 198 MET CA C sing N N 199 MET CA CB sing N N 200 MET CA HA sing N N 201 MET C O doub N N 202 MET C OXT sing N N 203 MET CB CG sing N N 204 MET CB HB2 sing N N 205 MET CB HB3 sing N N 206 MET CG SD sing N N 207 MET CG HG2 sing N N 208 MET CG HG3 sing N N 209 MET SD CE sing N N 210 MET CE HE1 sing N N 211 MET CE HE2 sing N N 212 MET CE HE3 sing N N 213 MET OXT HXT sing N N 214 PHE N CA sing N N 215 PHE N H sing N N 216 PHE N H2 sing N N 217 PHE CA C sing N N 218 PHE CA CB sing N N 219 PHE CA HA sing N N 220 PHE C O doub N N 221 PHE C OXT sing N N 222 PHE CB CG sing N N 223 PHE CB HB2 sing N N 224 PHE CB HB3 sing N N 225 PHE CG CD1 doub Y N 226 PHE CG CD2 sing Y N 227 PHE CD1 CE1 sing Y N 228 PHE CD1 HD1 sing N N 229 PHE CD2 CE2 doub Y N 230 PHE CD2 HD2 sing N N 231 PHE CE1 CZ doub Y N 232 PHE CE1 HE1 sing N N 233 PHE CE2 CZ sing Y N 234 PHE CE2 HE2 sing N N 235 PHE CZ HZ sing N N 236 PHE OXT HXT sing N N 237 PRO N CA sing N N 238 PRO N CD sing N N 239 PRO N H sing N N 240 PRO CA C sing N N 241 PRO CA CB sing N N 242 PRO CA HA sing N N 243 PRO C O doub N N 244 PRO C OXT sing N N 245 PRO CB CG sing N N 246 PRO CB HB2 sing N N 247 PRO CB HB3 sing N N 248 PRO CG CD sing N N 249 PRO CG HG2 sing N N 250 PRO CG HG3 sing N N 251 PRO CD HD2 sing N N 252 PRO CD HD3 sing N N 253 PRO OXT HXT sing N N 254 SER N CA sing N N 255 SER N H sing N N 256 SER N H2 sing N N 257 SER CA C sing N N 258 SER CA CB sing N N 259 SER CA HA sing N N 260 SER C O doub N N 261 SER C OXT sing N N 262 SER CB OG sing N N 263 SER CB HB2 sing N N 264 SER CB HB3 sing N N 265 SER OG HG sing N N 266 SER OXT HXT sing N N 267 THR N CA sing N N 268 THR N H sing N N 269 THR N H2 sing N N 270 THR CA C sing N N 271 THR CA CB sing N N 272 THR CA HA sing N N 273 THR C O doub N N 274 THR C OXT sing N N 275 THR CB OG1 sing N N 276 THR CB CG2 sing N N 277 THR CB HB sing N N 278 THR OG1 HG1 sing N N 279 THR CG2 HG21 sing N N 280 THR CG2 HG22 sing N N 281 THR CG2 HG23 sing N N 282 THR OXT HXT sing N N 283 TYR N CA sing N N 284 TYR N H sing N N 285 TYR N H2 sing N N 286 TYR CA C sing N N 287 TYR CA CB sing N N 288 TYR CA HA sing N N 289 TYR C O doub N N 290 TYR C OXT sing N N 291 TYR CB CG sing N N 292 TYR CB HB2 sing N N 293 TYR CB HB3 sing N N 294 TYR CG CD1 doub Y N 295 TYR CG CD2 sing Y N 296 TYR CD1 CE1 sing Y N 297 TYR CD1 HD1 sing N N 298 TYR CD2 CE2 doub Y N 299 TYR CD2 HD2 sing N N 300 TYR CE1 CZ doub Y N 301 TYR CE1 HE1 sing N N 302 TYR CE2 CZ sing Y N 303 TYR CE2 HE2 sing N N 304 TYR CZ OH sing N N 305 TYR OH HH sing N N 306 TYR OXT HXT sing N N 307 VAL N CA sing N N 308 VAL N H sing N N 309 VAL N H2 sing N N 310 VAL CA C sing N N 311 VAL CA CB sing N N 312 VAL CA HA sing N N 313 VAL C O doub N N 314 VAL C OXT sing N N 315 VAL CB CG1 sing N N 316 VAL CB CG2 sing N N 317 VAL CB HB sing N N 318 VAL CG1 HG11 sing N N 319 VAL CG1 HG12 sing N N 320 VAL CG1 HG13 sing N N 321 VAL CG2 HG21 sing N N 322 VAL CG2 HG22 sing N N 323 VAL CG2 HG23 sing N N 324 VAL OXT HXT sing N N 325 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 2Q6Q _pdbx_initial_refinement_model.details 'PDB entry 2q6q' #