data_4JC3 # _entry.id 4JC3 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4JC3 RCSB RCSB077858 WWPDB D_1000077858 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 3TOM . unspecified PDB 3UX0 . unspecified PDB 3MHR . unspecified PDB 3SMK . unspecified PDB 4JDD . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4JC3 _pdbx_database_status.recvd_initial_deposition_date 2013-02-21 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bier, D.' 1 'Ottmann, C.' 2 # _citation.id primary _citation.title 'Interaction of 14-3-3 proteins with the estrogen receptor alpha F domain provides a drug target interface.' _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_volume 110 _citation.page_first 8894 _citation.page_last 8899 _citation.year 2013 _citation.journal_id_ASTM PNASA6 _citation.country US _citation.journal_id_ISSN 1091-6490 _citation.journal_id_CSD 0040 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23676274 _citation.pdbx_database_id_DOI 10.1073/pnas.1220809110 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'De Vries-van Leeuwen, I.J.' 1 primary 'da Costa Pereira, D.' 2 primary 'Flach, K.D.' 3 primary 'Piersma, S.R.' 4 primary 'Haase, C.' 5 primary 'Bier, D.' 6 primary 'Yalcin, Z.' 7 primary 'Michalides, R.' 8 primary 'Feenstra, K.A.' 9 primary 'Jimenez, C.R.' 10 primary 'de Greef, T.F.' 11 primary 'Brunsveld, L.' 12 primary 'Ottmann, C.' 13 primary 'Zwart, W.' 14 primary 'de Boer, A.H.' 15 # _cell.entry_id 4JC3 _cell.length_a 82.210 _cell.length_b 112.490 _cell.length_c 62.450 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4JC3 _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man '14-3-3 protein sigma' 26542.914 1 ? ? 'UNP residues 1-231' ? 2 polymer syn 'Estrogen receptor Peptide' 1158.109 1 ? ? 'UNP RESIDUES 585-595' ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 3 ? ? ? ? 4 water nat water 18.015 171 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Epithelial cell marker protein 1, Stratifin' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; ;GAMGSMERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSE EKGPEVREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAM DISKKEMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; A ? 2 'polypeptide(L)' no yes 'TGEAEGFPA(TPO)V' TGEAEGFPATV B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 ALA n 1 3 MET n 1 4 GLY n 1 5 SER n 1 6 MET n 1 7 GLU n 1 8 ARG n 1 9 ALA n 1 10 SER n 1 11 LEU n 1 12 ILE n 1 13 GLN n 1 14 LYS n 1 15 ALA n 1 16 LYS n 1 17 LEU n 1 18 ALA n 1 19 GLU n 1 20 GLN n 1 21 ALA n 1 22 GLU n 1 23 ARG n 1 24 TYR n 1 25 GLU n 1 26 ASP n 1 27 MET n 1 28 ALA n 1 29 ALA n 1 30 PHE n 1 31 MET n 1 32 LYS n 1 33 GLY n 1 34 ALA n 1 35 VAL n 1 36 GLU n 1 37 LYS n 1 38 GLY n 1 39 GLU n 1 40 GLU n 1 41 LEU n 1 42 SER n 1 43 CYS n 1 44 GLU n 1 45 GLU n 1 46 ARG n 1 47 ASN n 1 48 LEU n 1 49 LEU n 1 50 SER n 1 51 VAL n 1 52 ALA n 1 53 TYR n 1 54 LYS n 1 55 ASN n 1 56 VAL n 1 57 VAL n 1 58 GLY n 1 59 GLY n 1 60 GLN n 1 61 ARG n 1 62 ALA n 1 63 ALA n 1 64 TRP n 1 65 ARG n 1 66 VAL n 1 67 LEU n 1 68 SER n 1 69 SER n 1 70 ILE n 1 71 GLU n 1 72 GLN n 1 73 LYS n 1 74 SER n 1 75 ASN n 1 76 GLU n 1 77 GLU n 1 78 GLY n 1 79 SER n 1 80 GLU n 1 81 GLU n 1 82 LYS n 1 83 GLY n 1 84 PRO n 1 85 GLU n 1 86 VAL n 1 87 ARG n 1 88 GLU n 1 89 TYR n 1 90 ARG n 1 91 GLU n 1 92 LYS n 1 93 VAL n 1 94 GLU n 1 95 THR n 1 96 GLU n 1 97 LEU n 1 98 GLN n 1 99 GLY n 1 100 VAL n 1 101 CYS n 1 102 ASP n 1 103 THR n 1 104 VAL n 1 105 LEU n 1 106 GLY n 1 107 LEU n 1 108 LEU n 1 109 ASP n 1 110 SER n 1 111 HIS n 1 112 LEU n 1 113 ILE n 1 114 LYS n 1 115 GLU n 1 116 ALA n 1 117 GLY n 1 118 ASP n 1 119 ALA n 1 120 GLU n 1 121 SER n 1 122 ARG n 1 123 VAL n 1 124 PHE n 1 125 TYR n 1 126 LEU n 1 127 LYS n 1 128 MET n 1 129 LYS n 1 130 GLY n 1 131 ASP n 1 132 TYR n 1 133 TYR n 1 134 ARG n 1 135 TYR n 1 136 LEU n 1 137 ALA n 1 138 GLU n 1 139 VAL n 1 140 ALA n 1 141 THR n 1 142 GLY n 1 143 ASP n 1 144 ASP n 1 145 LYS n 1 146 LYS n 1 147 ARG n 1 148 ILE n 1 149 ILE n 1 150 ASP n 1 151 SER n 1 152 ALA n 1 153 ARG n 1 154 SER n 1 155 ALA n 1 156 TYR n 1 157 GLN n 1 158 GLU n 1 159 ALA n 1 160 MET n 1 161 ASP n 1 162 ILE n 1 163 SER n 1 164 LYS n 1 165 LYS n 1 166 GLU n 1 167 MET n 1 168 PRO n 1 169 PRO n 1 170 THR n 1 171 ASN n 1 172 PRO n 1 173 ILE n 1 174 ARG n 1 175 LEU n 1 176 GLY n 1 177 LEU n 1 178 ALA n 1 179 LEU n 1 180 ASN n 1 181 PHE n 1 182 SER n 1 183 VAL n 1 184 PHE n 1 185 HIS n 1 186 TYR n 1 187 GLU n 1 188 ILE n 1 189 ALA n 1 190 ASN n 1 191 SER n 1 192 PRO n 1 193 GLU n 1 194 GLU n 1 195 ALA n 1 196 ILE n 1 197 SER n 1 198 LEU n 1 199 ALA n 1 200 LYS n 1 201 THR n 1 202 THR n 1 203 PHE n 1 204 ASP n 1 205 GLU n 1 206 ALA n 1 207 MET n 1 208 ALA n 1 209 ASP n 1 210 LEU n 1 211 HIS n 1 212 THR n 1 213 LEU n 1 214 SER n 1 215 GLU n 1 216 ASP n 1 217 SER n 1 218 TYR n 1 219 LYS n 1 220 ASP n 1 221 SER n 1 222 THR n 1 223 LEU n 1 224 ILE n 1 225 MET n 1 226 GLN n 1 227 LEU n 1 228 LEU n 1 229 ARG n 1 230 ASP n 1 231 ASN n 1 232 LEU n 1 233 THR n 1 234 LEU n 1 235 TRP n 1 236 THR n 2 1 THR n 2 2 GLY n 2 3 GLU n 2 4 ALA n 2 5 GLU n 2 6 GLY n 2 7 PHE n 2 8 PRO n 2 9 ALA n 2 10 TPO n 2 11 VAL n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'HME1, NM_006142, SFN' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'ROSETTA (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PPROEX HTB' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP 1433S_HUMAN P31947 1 ;MERASLIQKAKLAEQAERYEDMAAFMKGAVEKGEELSCEERNLLSVAYKNVVGGQRAAWRVLSSIEQKSNEEGSEEKGPE VREYREKVETELQGVCDTVLGLLDSHLIKEAGDAESRVFYLKMKGDYYRYLAEVATGDDKKRIIDSARSAYQEAMDISKK EMPPTNPIRLGLALNFSVFHYEIANSPEEAISLAKTTFDEAMADLHTLSEDSYKDSTLIMQLLRDNLTLWT ; 1 ? 2 UNP ESR1_HUMAN P03372 2 TGEAEGFPATV 585 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4JC3 A 6 ? 236 ? P31947 1 ? 231 ? 1 231 2 2 4JC3 B 1 ? 11 ? P03372 585 ? 595 ? 585 595 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4JC3 GLY A 1 ? UNP P31947 ? ? 'EXPRESSION TAG' -4 1 1 4JC3 ALA A 2 ? UNP P31947 ? ? 'EXPRESSION TAG' -3 2 1 4JC3 MET A 3 ? UNP P31947 ? ? 'EXPRESSION TAG' -2 3 1 4JC3 GLY A 4 ? UNP P31947 ? ? 'EXPRESSION TAG' -1 4 1 4JC3 SER A 5 ? UNP P31947 ? ? 'EXPRESSION TAG' 0 5 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TPO 'L-peptide linking' n PHOSPHOTHREONINE PHOSPHONOTHREONINE 'C4 H10 N O6 P' 199.099 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4JC3 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.61 _exptl_crystal.density_percent_sol 52.80 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 277.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '0.095M HEPES Na, 0.19M calcium chloride, 5% glycerol, 26.6% PEG400, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 277.15K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector 'IMAGE PLATE' _diffrn_detector.type 'MAR scanner 345 mm plate' _diffrn_detector.pdbx_collection_date 2012-08-20 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.54 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source 'ROTATING ANODE' _diffrn_source.type 'BRUKER AXS MICROSTAR' _diffrn_source.pdbx_synchrotron_site ? _diffrn_source.pdbx_synchrotron_beamline ? _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.54 # _reflns.entry_id 4JC3 _reflns.observed_criterion_sigma_I -3.000 _reflns.observed_criterion_sigma_F -3.000 _reflns.d_resolution_low 19.52 _reflns.d_resolution_high 2.05 _reflns.number_obs 18505 _reflns.number_all 18518 _reflns.percent_possible_obs 99.7800 _reflns.pdbx_Rmerge_I_obs 0.078 _reflns.pdbx_netI_over_sigmaI 24.160 _reflns.B_iso_Wilson_estimate 19.403 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 2.05 2.1 99.3 0.324 ? 6.85 ? ? ? ? ? ? ? 1 1 2.1 2.15 100 0.235 ? 9.05 ? ? ? ? ? ? ? 2 1 2.15 2.2 100 0.206 ? 10.31 ? ? ? ? ? ? ? 3 1 2.2 2.3 100 0.167 ? 12.5 ? ? ? ? ? ? ? 4 1 2.3 2.5 100 0.14 ? 14.7 ? ? ? ? ? ? ? 5 1 2.5 2.8 100 0.107 ? 18.88 ? ? ? ? ? ? ? 6 1 2.8 3 100 0.08 ? 24.25 ? ? ? ? ? ? ? 7 1 3 4 100 0.047 ? 38.85 ? ? ? ? ? ? ? 8 1 # _refine.entry_id 4JC3 _refine.ls_number_reflns_obs 17579 _refine.ls_number_reflns_all 18505 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 19.52 _refine.ls_d_res_high 2.05 _refine.ls_percent_reflns_obs 99.78 _refine.ls_R_factor_obs 0.18068 _refine.ls_R_factor_R_work 0.17787 _refine.ls_R_factor_R_free 0.23512 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.0 _refine.ls_number_reflns_R_free 926 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.938 _refine.correlation_coeff_Fo_to_Fc_free 0.887 _refine.B_iso_mean 14.867 _refine.aniso_B[1][1] 0.30 _refine.aniso_B[2][2] 0.13 _refine.aniso_B[3][3] -0.43 _refine.aniso_B[1][2] 0.00 _refine.aniso_B[1][3] 0.00 _refine.aniso_B[2][3] 0.00 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.175 _refine.pdbx_overall_ESU_R_Free 0.168 _refine.overall_SU_ML 0.098 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 3.471 _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.ls_R_factor_all ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1891 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 171 _refine_hist.number_atoms_total 2065 _refine_hist.d_res_high 2.05 _refine_hist.d_res_low 19.52 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.019 0.019 ? 1921 ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.767 1.983 ? 2589 ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 5.471 5.000 ? 241 ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 35.935 24.778 ? 90 ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 15.459 15.000 ? 358 ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 17.919 15.000 ? 13 ? 'X-RAY DIFFRACTION' r_chiral_restr 0.115 0.200 ? 286 ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.009 0.021 ? 1433 ? 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 2.050 _refine_ls_shell.d_res_low 2.103 _refine_ls_shell.number_reflns_R_work 1166 _refine_ls_shell.R_factor_R_work 0.187 _refine_ls_shell.percent_reflns_obs 99.27 _refine_ls_shell.R_factor_R_free 0.242 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 59 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4JC3 _struct.title '14-3-3 protein interaction with Estrogen Receptor Alpha provides a novel drug target interface' _struct.pdbx_descriptor '14-3-3 protein sigma, Estrogen receptor Peptide' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4JC3 _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN/Peptide' _struct_keywords.text '14-3-3, ADAPTER PROTEIN, PROTEIN-PROTEIN INTERACTION, SIGNALING PROTEIN-Peptide complex' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 GLU A 7 ? ALA A 21 ? GLU A 2 ALA A 16 1 ? 15 HELX_P HELX_P2 2 ARG A 23 ? LYS A 37 ? ARG A 18 LYS A 32 1 ? 15 HELX_P HELX_P3 3 SER A 42 ? ASN A 75 ? SER A 37 ASN A 70 1 ? 34 HELX_P HELX_P4 4 PRO A 84 ? SER A 110 ? PRO A 79 SER A 105 1 ? 27 HELX_P HELX_P5 5 HIS A 111 ? ALA A 116 ? HIS A 106 ALA A 111 1 ? 6 HELX_P HELX_P6 6 ASP A 118 ? ALA A 140 ? ASP A 113 ALA A 135 1 ? 23 HELX_P HELX_P7 7 ASP A 144 ? MET A 167 ? ASP A 139 MET A 162 1 ? 24 HELX_P HELX_P8 8 ASN A 171 ? ILE A 188 ? ASN A 166 ILE A 183 1 ? 18 HELX_P HELX_P9 9 SER A 191 ? ALA A 208 ? SER A 186 ALA A 203 1 ? 18 HELX_P HELX_P10 10 ASP A 209 ? LEU A 213 ? ASP A 204 LEU A 208 5 ? 5 HELX_P HELX_P11 11 SER A 214 ? THR A 236 ? SER A 209 THR A 231 1 ? 23 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? B ALA 9 C ? ? ? 1_555 B TPO 10 N ? ? B ALA 593 B TPO 594 1_555 ? ? ? ? ? ? ? 1.343 ? covale2 covale ? ? B TPO 10 C ? ? ? 1_555 B VAL 11 N ? ? B TPO 594 B VAL 595 1_555 ? ? ? ? ? ? ? 1.320 ? metalc1 metalc ? ? A GLU 94 OE2 ? ? ? 1_555 E MG . MG ? ? A GLU 89 A MG 303 1_555 ? ? ? ? ? ? ? 2.177 ? metalc2 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 303 A HOH 560 1_555 ? ? ? ? ? ? ? 2.363 ? metalc3 metalc ? ? C MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 301 A HOH 452 1_555 ? ? ? ? ? ? ? 2.384 ? metalc4 metalc ? ? A GLU 7 OE1 ? ? ? 1_555 D MG . MG ? ? A GLU 2 A MG 302 1_555 ? ? ? ? ? ? ? 2.438 ? metalc5 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 566 1_555 ? ? ? ? ? ? ? 2.461 ? metalc6 metalc ? ? D MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 302 A HOH 439 1_555 ? ? ? ? ? ? ? 2.700 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id SER _struct_mon_prot_cis.label_seq_id 110 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id SER _struct_mon_prot_cis.auth_seq_id 105 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 HIS _struct_mon_prot_cis.pdbx_label_seq_id_2 111 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 HIS _struct_mon_prot_cis.pdbx_auth_seq_id_2 106 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 10.94 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG A 301' AC2 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE MG A 302' AC3 Software ? ? ? ? 2 'BINDING SITE FOR RESIDUE MG A 303' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 GLU A 44 ? GLU A 39 . ? 6_555 ? 2 AC1 3 HOH F . ? HOH A 421 . ? 6_555 ? 3 AC1 3 HOH F . ? HOH A 452 . ? 1_555 ? 4 AC2 6 GLU A 7 ? GLU A 2 . ? 1_555 ? 5 AC2 6 GLU A 7 ? GLU A 2 . ? 3_654 ? 6 AC2 6 HOH F . ? HOH A 439 . ? 3_654 ? 7 AC2 6 HOH F . ? HOH A 439 . ? 1_555 ? 8 AC2 6 HOH F . ? HOH A 566 . ? 1_555 ? 9 AC2 6 HOH F . ? HOH A 566 . ? 3_654 ? 10 AC3 2 GLU A 94 ? GLU A 89 . ? 1_555 ? 11 AC3 2 HOH F . ? HOH A 560 . ? 1_555 ? # _database_PDB_matrix.entry_id 4JC3 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4JC3 _atom_sites.fract_transf_matrix[1][1] 0.012164 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008890 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016013 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -4 -4 GLY GLY A . n A 1 2 ALA 2 -3 -3 ALA ALA A . n A 1 3 MET 3 -2 -2 MET MET A . n A 1 4 GLY 4 -1 -1 GLY GLY A . n A 1 5 SER 5 0 0 SER SER A . n A 1 6 MET 6 1 1 MET MET A . n A 1 7 GLU 7 2 2 GLU GLU A . n A 1 8 ARG 8 3 3 ARG ARG A . n A 1 9 ALA 9 4 4 ALA ALA A . n A 1 10 SER 10 5 5 SER SER A . n A 1 11 LEU 11 6 6 LEU LEU A . n A 1 12 ILE 12 7 7 ILE ILE A . n A 1 13 GLN 13 8 8 GLN GLN A . n A 1 14 LYS 14 9 9 LYS LYS A . n A 1 15 ALA 15 10 10 ALA ALA A . n A 1 16 LYS 16 11 11 LYS LYS A . n A 1 17 LEU 17 12 12 LEU LEU A . n A 1 18 ALA 18 13 13 ALA ALA A . n A 1 19 GLU 19 14 14 GLU GLU A . n A 1 20 GLN 20 15 15 GLN GLN A . n A 1 21 ALA 21 16 16 ALA ALA A . n A 1 22 GLU 22 17 17 GLU GLU A . n A 1 23 ARG 23 18 18 ARG ARG A . n A 1 24 TYR 24 19 19 TYR TYR A . n A 1 25 GLU 25 20 20 GLU GLU A . n A 1 26 ASP 26 21 21 ASP ASP A . n A 1 27 MET 27 22 22 MET MET A . n A 1 28 ALA 28 23 23 ALA ALA A . n A 1 29 ALA 29 24 24 ALA ALA A . n A 1 30 PHE 30 25 25 PHE PHE A . n A 1 31 MET 31 26 26 MET MET A . n A 1 32 LYS 32 27 27 LYS LYS A . n A 1 33 GLY 33 28 28 GLY GLY A . n A 1 34 ALA 34 29 29 ALA ALA A . n A 1 35 VAL 35 30 30 VAL VAL A . n A 1 36 GLU 36 31 31 GLU GLU A . n A 1 37 LYS 37 32 32 LYS LYS A . n A 1 38 GLY 38 33 33 GLY GLY A . n A 1 39 GLU 39 34 34 GLU GLU A . n A 1 40 GLU 40 35 35 GLU GLU A . n A 1 41 LEU 41 36 36 LEU LEU A . n A 1 42 SER 42 37 37 SER SER A . n A 1 43 CYS 43 38 38 CYS CYS A . n A 1 44 GLU 44 39 39 GLU GLU A . n A 1 45 GLU 45 40 40 GLU GLU A . n A 1 46 ARG 46 41 41 ARG ARG A . n A 1 47 ASN 47 42 42 ASN ASN A . n A 1 48 LEU 48 43 43 LEU LEU A . n A 1 49 LEU 49 44 44 LEU LEU A . n A 1 50 SER 50 45 45 SER SER A . n A 1 51 VAL 51 46 46 VAL VAL A . n A 1 52 ALA 52 47 47 ALA ALA A . n A 1 53 TYR 53 48 48 TYR TYR A . n A 1 54 LYS 54 49 49 LYS LYS A . n A 1 55 ASN 55 50 50 ASN ASN A . n A 1 56 VAL 56 51 51 VAL VAL A . n A 1 57 VAL 57 52 52 VAL VAL A . n A 1 58 GLY 58 53 53 GLY GLY A . n A 1 59 GLY 59 54 54 GLY GLY A . n A 1 60 GLN 60 55 55 GLN GLN A . n A 1 61 ARG 61 56 56 ARG ARG A . n A 1 62 ALA 62 57 57 ALA ALA A . n A 1 63 ALA 63 58 58 ALA ALA A . n A 1 64 TRP 64 59 59 TRP TRP A . n A 1 65 ARG 65 60 60 ARG ARG A . n A 1 66 VAL 66 61 61 VAL VAL A . n A 1 67 LEU 67 62 62 LEU LEU A . n A 1 68 SER 68 63 63 SER SER A . n A 1 69 SER 69 64 64 SER SER A . n A 1 70 ILE 70 65 65 ILE ILE A . n A 1 71 GLU 71 66 66 GLU GLU A . n A 1 72 GLN 72 67 67 GLN GLN A . n A 1 73 LYS 73 68 68 LYS LYS A . n A 1 74 SER 74 69 69 SER SER A . n A 1 75 ASN 75 70 70 ASN ASN A . n A 1 76 GLU 76 71 71 GLU GLU A . n A 1 77 GLU 77 72 72 GLU GLU A . n A 1 78 GLY 78 73 73 GLY GLY A . n A 1 79 SER 79 74 74 SER SER A . n A 1 80 GLU 80 75 75 GLU GLU A . n A 1 81 GLU 81 76 76 GLU GLU A . n A 1 82 LYS 82 77 77 LYS LYS A . n A 1 83 GLY 83 78 78 GLY GLY A . n A 1 84 PRO 84 79 79 PRO PRO A . n A 1 85 GLU 85 80 80 GLU GLU A . n A 1 86 VAL 86 81 81 VAL VAL A . n A 1 87 ARG 87 82 82 ARG ARG A . n A 1 88 GLU 88 83 83 GLU GLU A . n A 1 89 TYR 89 84 84 TYR TYR A . n A 1 90 ARG 90 85 85 ARG ARG A . n A 1 91 GLU 91 86 86 GLU GLU A . n A 1 92 LYS 92 87 87 LYS LYS A . n A 1 93 VAL 93 88 88 VAL VAL A . n A 1 94 GLU 94 89 89 GLU GLU A . n A 1 95 THR 95 90 90 THR THR A . n A 1 96 GLU 96 91 91 GLU GLU A . n A 1 97 LEU 97 92 92 LEU LEU A . n A 1 98 GLN 98 93 93 GLN GLN A . n A 1 99 GLY 99 94 94 GLY GLY A . n A 1 100 VAL 100 95 95 VAL VAL A . n A 1 101 CYS 101 96 96 CYS CYS A . n A 1 102 ASP 102 97 97 ASP ASP A . n A 1 103 THR 103 98 98 THR THR A . n A 1 104 VAL 104 99 99 VAL VAL A . n A 1 105 LEU 105 100 100 LEU LEU A . n A 1 106 GLY 106 101 101 GLY GLY A . n A 1 107 LEU 107 102 102 LEU LEU A . n A 1 108 LEU 108 103 103 LEU LEU A . n A 1 109 ASP 109 104 104 ASP ASP A . n A 1 110 SER 110 105 105 SER SER A . n A 1 111 HIS 111 106 106 HIS HIS A . n A 1 112 LEU 112 107 107 LEU LEU A . n A 1 113 ILE 113 108 108 ILE ILE A . n A 1 114 LYS 114 109 109 LYS LYS A . n A 1 115 GLU 115 110 110 GLU GLU A . n A 1 116 ALA 116 111 111 ALA ALA A . n A 1 117 GLY 117 112 112 GLY GLY A . n A 1 118 ASP 118 113 113 ASP ASP A . n A 1 119 ALA 119 114 114 ALA ALA A . n A 1 120 GLU 120 115 115 GLU GLU A . n A 1 121 SER 121 116 116 SER SER A . n A 1 122 ARG 122 117 117 ARG ARG A . n A 1 123 VAL 123 118 118 VAL VAL A . n A 1 124 PHE 124 119 119 PHE PHE A . n A 1 125 TYR 125 120 120 TYR TYR A . n A 1 126 LEU 126 121 121 LEU LEU A . n A 1 127 LYS 127 122 122 LYS LYS A . n A 1 128 MET 128 123 123 MET MET A . n A 1 129 LYS 129 124 124 LYS LYS A . n A 1 130 GLY 130 125 125 GLY GLY A . n A 1 131 ASP 131 126 126 ASP ASP A . n A 1 132 TYR 132 127 127 TYR TYR A . n A 1 133 TYR 133 128 128 TYR TYR A . n A 1 134 ARG 134 129 129 ARG ARG A . n A 1 135 TYR 135 130 130 TYR TYR A . n A 1 136 LEU 136 131 131 LEU LEU A . n A 1 137 ALA 137 132 132 ALA ALA A . n A 1 138 GLU 138 133 133 GLU GLU A . n A 1 139 VAL 139 134 134 VAL VAL A . n A 1 140 ALA 140 135 135 ALA ALA A . n A 1 141 THR 141 136 136 THR THR A . n A 1 142 GLY 142 137 137 GLY GLY A . n A 1 143 ASP 143 138 138 ASP ASP A . n A 1 144 ASP 144 139 139 ASP ASP A . n A 1 145 LYS 145 140 140 LYS LYS A . n A 1 146 LYS 146 141 141 LYS LYS A . n A 1 147 ARG 147 142 142 ARG ARG A . n A 1 148 ILE 148 143 143 ILE ILE A . n A 1 149 ILE 149 144 144 ILE ILE A . n A 1 150 ASP 150 145 145 ASP ASP A . n A 1 151 SER 151 146 146 SER SER A . n A 1 152 ALA 152 147 147 ALA ALA A . n A 1 153 ARG 153 148 148 ARG ARG A . n A 1 154 SER 154 149 149 SER SER A . n A 1 155 ALA 155 150 150 ALA ALA A . n A 1 156 TYR 156 151 151 TYR TYR A . n A 1 157 GLN 157 152 152 GLN GLN A . n A 1 158 GLU 158 153 153 GLU GLU A . n A 1 159 ALA 159 154 154 ALA ALA A . n A 1 160 MET 160 155 155 MET MET A . n A 1 161 ASP 161 156 156 ASP ASP A . n A 1 162 ILE 162 157 157 ILE ILE A . n A 1 163 SER 163 158 158 SER SER A . n A 1 164 LYS 164 159 159 LYS LYS A . n A 1 165 LYS 165 160 160 LYS LYS A . n A 1 166 GLU 166 161 161 GLU GLU A . n A 1 167 MET 167 162 162 MET MET A . n A 1 168 PRO 168 163 163 PRO PRO A . n A 1 169 PRO 169 164 164 PRO PRO A . n A 1 170 THR 170 165 165 THR THR A . n A 1 171 ASN 171 166 166 ASN ASN A . n A 1 172 PRO 172 167 167 PRO PRO A . n A 1 173 ILE 173 168 168 ILE ILE A . n A 1 174 ARG 174 169 169 ARG ARG A . n A 1 175 LEU 175 170 170 LEU LEU A . n A 1 176 GLY 176 171 171 GLY GLY A . n A 1 177 LEU 177 172 172 LEU LEU A . n A 1 178 ALA 178 173 173 ALA ALA A . n A 1 179 LEU 179 174 174 LEU LEU A . n A 1 180 ASN 180 175 175 ASN ASN A . n A 1 181 PHE 181 176 176 PHE PHE A . n A 1 182 SER 182 177 177 SER SER A . n A 1 183 VAL 183 178 178 VAL VAL A . n A 1 184 PHE 184 179 179 PHE PHE A . n A 1 185 HIS 185 180 180 HIS HIS A . n A 1 186 TYR 186 181 181 TYR TYR A . n A 1 187 GLU 187 182 182 GLU GLU A . n A 1 188 ILE 188 183 183 ILE ILE A . n A 1 189 ALA 189 184 184 ALA ALA A . n A 1 190 ASN 190 185 185 ASN ASN A . n A 1 191 SER 191 186 186 SER SER A . n A 1 192 PRO 192 187 187 PRO PRO A . n A 1 193 GLU 193 188 188 GLU GLU A . n A 1 194 GLU 194 189 189 GLU GLU A . n A 1 195 ALA 195 190 190 ALA ALA A . n A 1 196 ILE 196 191 191 ILE ILE A . n A 1 197 SER 197 192 192 SER SER A . n A 1 198 LEU 198 193 193 LEU LEU A . n A 1 199 ALA 199 194 194 ALA ALA A . n A 1 200 LYS 200 195 195 LYS LYS A . n A 1 201 THR 201 196 196 THR THR A . n A 1 202 THR 202 197 197 THR THR A . n A 1 203 PHE 203 198 198 PHE PHE A . n A 1 204 ASP 204 199 199 ASP ASP A . n A 1 205 GLU 205 200 200 GLU GLU A . n A 1 206 ALA 206 201 201 ALA ALA A . n A 1 207 MET 207 202 202 MET MET A . n A 1 208 ALA 208 203 203 ALA ALA A . n A 1 209 ASP 209 204 204 ASP ASP A . n A 1 210 LEU 210 205 205 LEU LEU A . n A 1 211 HIS 211 206 206 HIS HIS A . n A 1 212 THR 212 207 207 THR THR A . n A 1 213 LEU 213 208 208 LEU LEU A . n A 1 214 SER 214 209 209 SER SER A . n A 1 215 GLU 215 210 210 GLU GLU A . n A 1 216 ASP 216 211 211 ASP ASP A . n A 1 217 SER 217 212 212 SER SER A . n A 1 218 TYR 218 213 213 TYR TYR A . n A 1 219 LYS 219 214 214 LYS LYS A . n A 1 220 ASP 220 215 215 ASP ASP A . n A 1 221 SER 221 216 216 SER SER A . n A 1 222 THR 222 217 217 THR THR A . n A 1 223 LEU 223 218 218 LEU LEU A . n A 1 224 ILE 224 219 219 ILE ILE A . n A 1 225 MET 225 220 220 MET MET A . n A 1 226 GLN 226 221 221 GLN GLN A . n A 1 227 LEU 227 222 222 LEU LEU A . n A 1 228 LEU 228 223 223 LEU LEU A . n A 1 229 ARG 229 224 224 ARG ARG A . n A 1 230 ASP 230 225 225 ASP ASP A . n A 1 231 ASN 231 226 226 ASN ASN A . n A 1 232 LEU 232 227 227 LEU LEU A . n A 1 233 THR 233 228 228 THR THR A . n A 1 234 LEU 234 229 229 LEU LEU A . n A 1 235 TRP 235 230 230 TRP TRP A . n A 1 236 THR 236 231 231 THR THR A . n B 2 1 THR 1 585 ? ? ? B . n B 2 2 GLY 2 586 ? ? ? B . n B 2 3 GLU 3 587 ? ? ? B . n B 2 4 ALA 4 588 ? ? ? B . n B 2 5 GLU 5 589 ? ? ? B . n B 2 6 GLY 6 590 ? ? ? B . n B 2 7 PHE 7 591 591 PHE PHE B . n B 2 8 PRO 8 592 592 PRO PRO B . n B 2 9 ALA 9 593 593 ALA ALA B . n B 2 10 TPO 10 594 594 TPO TPO B . n B 2 11 VAL 11 595 595 VAL VAL B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 MG 1 301 1 MG MG A . D 3 MG 1 302 1 MG MG A . E 3 MG 1 303 1 MG MG A . F 4 HOH 1 401 1 HOH HOH A . F 4 HOH 2 402 3 HOH HOH A . F 4 HOH 3 403 5 HOH HOH A . F 4 HOH 4 404 6 HOH HOH A . F 4 HOH 5 405 7 HOH HOH A . F 4 HOH 6 406 8 HOH HOH A . F 4 HOH 7 407 9 HOH HOH A . F 4 HOH 8 408 10 HOH HOH A . F 4 HOH 9 409 11 HOH HOH A . F 4 HOH 10 410 12 HOH HOH A . F 4 HOH 11 411 13 HOH HOH A . F 4 HOH 12 412 14 HOH HOH A . F 4 HOH 13 413 15 HOH HOH A . F 4 HOH 14 414 16 HOH HOH A . F 4 HOH 15 415 17 HOH HOH A . F 4 HOH 16 416 18 HOH HOH A . F 4 HOH 17 417 19 HOH HOH A . F 4 HOH 18 418 20 HOH HOH A . F 4 HOH 19 419 21 HOH HOH A . F 4 HOH 20 420 22 HOH HOH A . F 4 HOH 21 421 23 HOH HOH A . F 4 HOH 22 422 24 HOH HOH A . F 4 HOH 23 423 25 HOH HOH A . F 4 HOH 24 424 26 HOH HOH A . F 4 HOH 25 425 27 HOH HOH A . F 4 HOH 26 426 28 HOH HOH A . F 4 HOH 27 427 29 HOH HOH A . F 4 HOH 28 428 30 HOH HOH A . F 4 HOH 29 429 31 HOH HOH A . F 4 HOH 30 430 32 HOH HOH A . F 4 HOH 31 431 33 HOH HOH A . F 4 HOH 32 432 34 HOH HOH A . F 4 HOH 33 433 35 HOH HOH A . F 4 HOH 34 434 36 HOH HOH A . F 4 HOH 35 435 37 HOH HOH A . F 4 HOH 36 436 38 HOH HOH A . F 4 HOH 37 437 39 HOH HOH A . F 4 HOH 38 438 40 HOH HOH A . F 4 HOH 39 439 41 HOH HOH A . F 4 HOH 40 440 42 HOH HOH A . F 4 HOH 41 441 43 HOH HOH A . F 4 HOH 42 442 44 HOH HOH A . F 4 HOH 43 443 45 HOH HOH A . F 4 HOH 44 444 46 HOH HOH A . F 4 HOH 45 445 47 HOH HOH A . F 4 HOH 46 446 48 HOH HOH A . F 4 HOH 47 447 49 HOH HOH A . F 4 HOH 48 448 50 HOH HOH A . F 4 HOH 49 449 51 HOH HOH A . F 4 HOH 50 450 52 HOH HOH A . F 4 HOH 51 451 53 HOH HOH A . F 4 HOH 52 452 54 HOH HOH A . F 4 HOH 53 453 55 HOH HOH A . F 4 HOH 54 454 56 HOH HOH A . F 4 HOH 55 455 57 HOH HOH A . F 4 HOH 56 456 58 HOH HOH A . F 4 HOH 57 457 59 HOH HOH A . F 4 HOH 58 458 60 HOH HOH A . F 4 HOH 59 459 61 HOH HOH A . F 4 HOH 60 460 62 HOH HOH A . F 4 HOH 61 461 63 HOH HOH A . F 4 HOH 62 462 64 HOH HOH A . F 4 HOH 63 463 65 HOH HOH A . F 4 HOH 64 464 66 HOH HOH A . F 4 HOH 65 465 67 HOH HOH A . F 4 HOH 66 466 68 HOH HOH A . F 4 HOH 67 467 69 HOH HOH A . F 4 HOH 68 468 70 HOH HOH A . F 4 HOH 69 469 71 HOH HOH A . F 4 HOH 70 470 72 HOH HOH A . F 4 HOH 71 471 73 HOH HOH A . F 4 HOH 72 472 74 HOH HOH A . F 4 HOH 73 473 75 HOH HOH A . F 4 HOH 74 474 76 HOH HOH A . F 4 HOH 75 475 77 HOH HOH A . F 4 HOH 76 476 78 HOH HOH A . F 4 HOH 77 477 79 HOH HOH A . F 4 HOH 78 478 80 HOH HOH A . F 4 HOH 79 479 81 HOH HOH A . F 4 HOH 80 480 82 HOH HOH A . F 4 HOH 81 481 84 HOH HOH A . F 4 HOH 82 482 85 HOH HOH A . F 4 HOH 83 483 86 HOH HOH A . F 4 HOH 84 484 87 HOH HOH A . F 4 HOH 85 485 88 HOH HOH A . F 4 HOH 86 486 89 HOH HOH A . F 4 HOH 87 487 90 HOH HOH A . F 4 HOH 88 488 91 HOH HOH A . F 4 HOH 89 489 92 HOH HOH A . F 4 HOH 90 490 93 HOH HOH A . F 4 HOH 91 491 94 HOH HOH A . F 4 HOH 92 492 95 HOH HOH A . F 4 HOH 93 493 96 HOH HOH A . F 4 HOH 94 494 97 HOH HOH A . F 4 HOH 95 495 99 HOH HOH A . F 4 HOH 96 496 100 HOH HOH A . F 4 HOH 97 497 101 HOH HOH A . F 4 HOH 98 498 103 HOH HOH A . F 4 HOH 99 499 104 HOH HOH A . F 4 HOH 100 500 105 HOH HOH A . F 4 HOH 101 501 106 HOH HOH A . F 4 HOH 102 502 107 HOH HOH A . F 4 HOH 103 503 108 HOH HOH A . F 4 HOH 104 504 109 HOH HOH A . F 4 HOH 105 505 110 HOH HOH A . F 4 HOH 106 506 111 HOH HOH A . F 4 HOH 107 507 112 HOH HOH A . F 4 HOH 108 508 113 HOH HOH A . F 4 HOH 109 509 114 HOH HOH A . F 4 HOH 110 510 115 HOH HOH A . F 4 HOH 111 511 116 HOH HOH A . F 4 HOH 112 512 117 HOH HOH A . F 4 HOH 113 513 118 HOH HOH A . F 4 HOH 114 514 119 HOH HOH A . F 4 HOH 115 515 120 HOH HOH A . F 4 HOH 116 516 121 HOH HOH A . F 4 HOH 117 517 122 HOH HOH A . F 4 HOH 118 518 123 HOH HOH A . F 4 HOH 119 519 124 HOH HOH A . F 4 HOH 120 520 125 HOH HOH A . F 4 HOH 121 521 126 HOH HOH A . F 4 HOH 122 522 127 HOH HOH A . F 4 HOH 123 523 128 HOH HOH A . F 4 HOH 124 524 129 HOH HOH A . F 4 HOH 125 525 130 HOH HOH A . F 4 HOH 126 526 131 HOH HOH A . F 4 HOH 127 527 132 HOH HOH A . F 4 HOH 128 528 133 HOH HOH A . F 4 HOH 129 529 134 HOH HOH A . F 4 HOH 130 530 135 HOH HOH A . F 4 HOH 131 531 136 HOH HOH A . F 4 HOH 132 532 137 HOH HOH A . F 4 HOH 133 533 138 HOH HOH A . F 4 HOH 134 534 139 HOH HOH A . F 4 HOH 135 535 140 HOH HOH A . F 4 HOH 136 536 141 HOH HOH A . F 4 HOH 137 537 142 HOH HOH A . F 4 HOH 138 538 143 HOH HOH A . F 4 HOH 139 539 144 HOH HOH A . F 4 HOH 140 540 145 HOH HOH A . F 4 HOH 141 541 146 HOH HOH A . F 4 HOH 142 542 147 HOH HOH A . F 4 HOH 143 543 148 HOH HOH A . F 4 HOH 144 544 149 HOH HOH A . F 4 HOH 145 545 150 HOH HOH A . F 4 HOH 146 546 151 HOH HOH A . F 4 HOH 147 547 152 HOH HOH A . F 4 HOH 148 548 153 HOH HOH A . F 4 HOH 149 549 154 HOH HOH A . F 4 HOH 150 550 155 HOH HOH A . F 4 HOH 151 551 156 HOH HOH A . F 4 HOH 152 552 157 HOH HOH A . F 4 HOH 153 553 158 HOH HOH A . F 4 HOH 154 554 159 HOH HOH A . F 4 HOH 155 555 160 HOH HOH A . F 4 HOH 156 556 161 HOH HOH A . F 4 HOH 157 557 162 HOH HOH A . F 4 HOH 158 558 163 HOH HOH A . F 4 HOH 159 559 164 HOH HOH A . F 4 HOH 160 560 165 HOH HOH A . F 4 HOH 161 561 167 HOH HOH A . F 4 HOH 162 562 169 HOH HOH A . F 4 HOH 163 563 170 HOH HOH A . F 4 HOH 164 564 171 HOH HOH A . F 4 HOH 165 565 172 HOH HOH A . F 4 HOH 166 566 173 HOH HOH A . F 4 HOH 167 567 174 HOH HOH A . F 4 HOH 168 568 175 HOH HOH A . F 4 HOH 169 569 176 HOH HOH A . G 4 HOH 1 601 83 HOH HOH B . G 4 HOH 2 602 180 HOH HOH B . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id TPO _pdbx_struct_mod_residue.label_seq_id 10 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id TPO _pdbx_struct_mod_residue.auth_seq_id 594 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id THR _pdbx_struct_mod_residue.details PHOSPHOTHREONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4240 ? 1 MORE -43 ? 1 'SSA (A^2)' 23750 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_555 x,-y,-z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # _pdbx_struct_special_symmetry.id 1 _pdbx_struct_special_symmetry.PDB_model_num 1 _pdbx_struct_special_symmetry.auth_asym_id A _pdbx_struct_special_symmetry.auth_comp_id MG _pdbx_struct_special_symmetry.auth_seq_id 302 _pdbx_struct_special_symmetry.PDB_ins_code ? _pdbx_struct_special_symmetry.label_asym_id D _pdbx_struct_special_symmetry.label_comp_id MG _pdbx_struct_special_symmetry.label_seq_id . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE2 ? A GLU 94 ? A GLU 89 ? 1_555 MG ? E MG . ? A MG 303 ? 1_555 O ? F HOH . ? A HOH 560 ? 1_555 103.5 ? 2 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 566 ? 1_555 69.4 ? 3 OE1 ? A GLU 7 ? A GLU 2 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 439 ? 1_555 66.9 ? 4 O ? F HOH . ? A HOH 566 ? 1_555 MG ? D MG . ? A MG 302 ? 1_555 O ? F HOH . ? A HOH 439 ? 1_555 136.2 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-05-15 2 'Structure model' 1 1 2017-06-07 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal MAR345dtb 'data collection' . ? 1 PHASER phasing . ? 2 REFMAC refinement 5.6.0117 ? 3 XDS 'data reduction' . ? 4 XDS 'data scaling' . ? 5 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 439 ? ? 1_555 O A HOH 566 ? ? 3_654 1.34 2 1 OE2 A GLU 110 ? ? 1_555 OH A TYR 213 ? ? 8_555 2.16 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 HIS A 106 ? ? -143.85 36.38 2 1 THR A 136 ? ? -144.87 16.07 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 71 ? CD ? A GLU 76 CD 2 1 Y 1 A GLU 71 ? OE1 ? A GLU 76 OE1 3 1 Y 1 A GLU 71 ? OE2 ? A GLU 76 OE2 4 1 Y 1 A GLU 72 ? CG ? A GLU 77 CG 5 1 Y 1 A GLU 72 ? CD ? A GLU 77 CD 6 1 Y 1 A GLU 72 ? OE1 ? A GLU 77 OE1 7 1 Y 1 A GLU 72 ? OE2 ? A GLU 77 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 B THR 585 ? B THR 1 2 1 Y 1 B GLY 586 ? B GLY 2 3 1 Y 1 B GLU 587 ? B GLU 3 4 1 Y 1 B ALA 588 ? B ALA 4 5 1 Y 1 B GLU 589 ? B GLU 5 6 1 Y 1 B GLY 590 ? B GLY 6 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'MAGNESIUM ION' MG 4 water HOH #