data_4JEL # _entry.id 4JEL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4JEL pdb_00004jel 10.2210/pdb4jel/pdb RCSB RCSB077947 ? ? WWPDB D_1000077947 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-09-11 2 'Structure model' 1 1 2024-10-30 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' chem_comp_atom 2 2 'Structure model' chem_comp_bond 3 2 'Structure model' database_2 4 2 'Structure model' pdbx_entry_details 5 2 'Structure model' pdbx_modification_feature 6 2 'Structure model' struct_conn 7 2 'Structure model' struct_ref_seq_dif 8 2 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_database_2.pdbx_DOI' 2 2 'Structure model' '_database_2.pdbx_database_accession' 3 2 'Structure model' '_struct_conn.pdbx_leaving_atom_flag' 4 2 'Structure model' '_struct_ref_seq_dif.details' 5 2 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 2 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 2 'Structure model' '_struct_site.pdbx_auth_seq_id' # _pdbx_database_status.entry_id 4JEL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-02-27 _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4JEM . unspecified PDB 4JEN . unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sikowitz, M.D.' 1 'Cooper, L.E.' 2 'Begley, T.P.' 3 'Kaminski, P.A.' 4 'Ealick, S.E.' 5 # _citation.id primary _citation.title 'Reversal of the substrate specificity of CMP N-glycosidase to dCMP.' _citation.journal_abbrev Biochemistry _citation.journal_volume 52 _citation.page_first 4037 _citation.page_last 4047 _citation.year 2013 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 23659472 _citation.pdbx_database_id_DOI 10.1021/bi400316p # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Sikowitz, M.D.' 1 ? primary 'Cooper, L.E.' 2 ? primary 'Begley, T.P.' 3 ? primary 'Kaminski, P.A.' 4 ? primary 'Ealick, S.E.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'CMP/hydroxymethyl CMP hydrolase' 20549.219 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 water nat water 18.015 108 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GSDKIHHHHHHSSGENLYFQGH(MSE)TTTPKPRTAPAVGSVFLGGPFRQLVDPRTGV(MSE)SSGDQNVFSRLI EHFESRGTTVYNAHRREAWGAEFLSPAEATRLDHDEIKAADVFVAFPGVPASPGTHVEIGWASG(MSE)GKP(MSE)VLL LERDEDYAFLVTGLESQANVEILRFSGTEEIVERLDGAVARVLGR ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSDKIHHHHHHSSGENLYFQGHMTTTPKPRTAPAVGSVFLGGPFRQLVDPRTGVMSSGDQNVFSRLIEHFESRGTTVYN AHRREAWGAEFLSPAEATRLDHDEIKAADVFVAFPGVPASPGTHVEIGWASGMGKPMVLLLERDEDYAFLVTGLESQANV EILRFSGTEEIVERLDGAVARVLGR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 SER n 1 4 ASP n 1 5 LYS n 1 6 ILE n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 HIS n 1 12 HIS n 1 13 SER n 1 14 SER n 1 15 GLY n 1 16 GLU n 1 17 ASN n 1 18 LEU n 1 19 TYR n 1 20 PHE n 1 21 GLN n 1 22 GLY n 1 23 HIS n 1 24 MSE n 1 25 THR n 1 26 THR n 1 27 THR n 1 28 PRO n 1 29 LYS n 1 30 PRO n 1 31 ARG n 1 32 THR n 1 33 ALA n 1 34 PRO n 1 35 ALA n 1 36 VAL n 1 37 GLY n 1 38 SER n 1 39 VAL n 1 40 PHE n 1 41 LEU n 1 42 GLY n 1 43 GLY n 1 44 PRO n 1 45 PHE n 1 46 ARG n 1 47 GLN n 1 48 LEU n 1 49 VAL n 1 50 ASP n 1 51 PRO n 1 52 ARG n 1 53 THR n 1 54 GLY n 1 55 VAL n 1 56 MSE n 1 57 SER n 1 58 SER n 1 59 GLY n 1 60 ASP n 1 61 GLN n 1 62 ASN n 1 63 VAL n 1 64 PHE n 1 65 SER n 1 66 ARG n 1 67 LEU n 1 68 ILE n 1 69 GLU n 1 70 HIS n 1 71 PHE n 1 72 GLU n 1 73 SER n 1 74 ARG n 1 75 GLY n 1 76 THR n 1 77 THR n 1 78 VAL n 1 79 TYR n 1 80 ASN n 1 81 ALA n 1 82 HIS n 1 83 ARG n 1 84 ARG n 1 85 GLU n 1 86 ALA n 1 87 TRP n 1 88 GLY n 1 89 ALA n 1 90 GLU n 1 91 PHE n 1 92 LEU n 1 93 SER n 1 94 PRO n 1 95 ALA n 1 96 GLU n 1 97 ALA n 1 98 THR n 1 99 ARG n 1 100 LEU n 1 101 ASP n 1 102 HIS n 1 103 ASP n 1 104 GLU n 1 105 ILE n 1 106 LYS n 1 107 ALA n 1 108 ALA n 1 109 ASP n 1 110 VAL n 1 111 PHE n 1 112 VAL n 1 113 ALA n 1 114 PHE n 1 115 PRO n 1 116 GLY n 1 117 VAL n 1 118 PRO n 1 119 ALA n 1 120 SER n 1 121 PRO n 1 122 GLY n 1 123 THR n 1 124 HIS n 1 125 VAL n 1 126 GLU n 1 127 ILE n 1 128 GLY n 1 129 TRP n 1 130 ALA n 1 131 SER n 1 132 GLY n 1 133 MSE n 1 134 GLY n 1 135 LYS n 1 136 PRO n 1 137 MSE n 1 138 VAL n 1 139 LEU n 1 140 LEU n 1 141 LEU n 1 142 GLU n 1 143 ARG n 1 144 ASP n 1 145 GLU n 1 146 ASP n 1 147 TYR n 1 148 ALA n 1 149 PHE n 1 150 LEU n 1 151 VAL n 1 152 THR n 1 153 GLY n 1 154 LEU n 1 155 GLU n 1 156 SER n 1 157 GLN n 1 158 ALA n 1 159 ASN n 1 160 VAL n 1 161 GLU n 1 162 ILE n 1 163 LEU n 1 164 ARG n 1 165 PHE n 1 166 SER n 1 167 GLY n 1 168 THR n 1 169 GLU n 1 170 GLU n 1 171 ILE n 1 172 VAL n 1 173 GLU n 1 174 ARG n 1 175 LEU n 1 176 ASP n 1 177 GLY n 1 178 ALA n 1 179 VAL n 1 180 ALA n 1 181 ARG n 1 182 VAL n 1 183 LEU n 1 184 GLY n 1 185 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene MilB _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Streptomyces rimofaciens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 504097 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'modified pET28a' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 -22 ? ? ? A . n A 1 2 GLY 2 -21 ? ? ? A . n A 1 3 SER 3 -20 ? ? ? A . n A 1 4 ASP 4 -19 ? ? ? A . n A 1 5 LYS 5 -18 ? ? ? A . n A 1 6 ILE 6 -17 ? ? ? A . n A 1 7 HIS 7 -16 ? ? ? A . n A 1 8 HIS 8 -15 ? ? ? A . n A 1 9 HIS 9 -14 ? ? ? A . n A 1 10 HIS 10 -13 ? ? ? A . n A 1 11 HIS 11 -12 ? ? ? A . n A 1 12 HIS 12 -11 ? ? ? A . n A 1 13 SER 13 -10 ? ? ? A . n A 1 14 SER 14 -9 ? ? ? A . n A 1 15 GLY 15 -8 ? ? ? A . n A 1 16 GLU 16 -7 ? ? ? A . n A 1 17 ASN 17 -6 ? ? ? A . n A 1 18 LEU 18 -5 ? ? ? A . n A 1 19 TYR 19 -4 ? ? ? A . n A 1 20 PHE 20 -3 ? ? ? A . n A 1 21 GLN 21 -2 ? ? ? A . n A 1 22 GLY 22 -1 ? ? ? A . n A 1 23 HIS 23 0 ? ? ? A . n A 1 24 MSE 24 1 ? ? ? A . n A 1 25 THR 25 2 ? ? ? A . n A 1 26 THR 26 3 ? ? ? A . n A 1 27 THR 27 4 ? ? ? A . n A 1 28 PRO 28 5 ? ? ? A . n A 1 29 LYS 29 6 ? ? ? A . n A 1 30 PRO 30 7 ? ? ? A . n A 1 31 ARG 31 8 ? ? ? A . n A 1 32 THR 32 9 ? ? ? A . n A 1 33 ALA 33 10 ? ? ? A . n A 1 34 PRO 34 11 11 PRO PRO A . n A 1 35 ALA 35 12 12 ALA ALA A . n A 1 36 VAL 36 13 13 VAL VAL A . n A 1 37 GLY 37 14 14 GLY GLY A . n A 1 38 SER 38 15 15 SER SER A . n A 1 39 VAL 39 16 16 VAL VAL A . n A 1 40 PHE 40 17 17 PHE PHE A . n A 1 41 LEU 41 18 18 LEU LEU A . n A 1 42 GLY 42 19 19 GLY GLY A . n A 1 43 GLY 43 20 20 GLY GLY A . n A 1 44 PRO 44 21 21 PRO PRO A . n A 1 45 PHE 45 22 22 PHE PHE A . n A 1 46 ARG 46 23 23 ARG ARG A . n A 1 47 GLN 47 24 24 GLN GLN A . n A 1 48 LEU 48 25 25 LEU LEU A . n A 1 49 VAL 49 26 26 VAL VAL A . n A 1 50 ASP 50 27 27 ASP ASP A . n A 1 51 PRO 51 28 28 PRO PRO A . n A 1 52 ARG 52 29 29 ARG ARG A . n A 1 53 THR 53 30 30 THR THR A . n A 1 54 GLY 54 31 31 GLY GLY A . n A 1 55 VAL 55 32 32 VAL VAL A . n A 1 56 MSE 56 33 33 MSE MSE A . n A 1 57 SER 57 34 34 SER SER A . n A 1 58 SER 58 35 35 SER SER A . n A 1 59 GLY 59 36 36 GLY GLY A . n A 1 60 ASP 60 37 37 ASP ASP A . n A 1 61 GLN 61 38 38 GLN GLN A . n A 1 62 ASN 62 39 39 ASN ASN A . n A 1 63 VAL 63 40 40 VAL VAL A . n A 1 64 PHE 64 41 41 PHE PHE A . n A 1 65 SER 65 42 42 SER SER A . n A 1 66 ARG 66 43 43 ARG ARG A . n A 1 67 LEU 67 44 44 LEU LEU A . n A 1 68 ILE 68 45 45 ILE ILE A . n A 1 69 GLU 69 46 46 GLU GLU A . n A 1 70 HIS 70 47 47 HIS HIS A . n A 1 71 PHE 71 48 48 PHE PHE A . n A 1 72 GLU 72 49 49 GLU GLU A . n A 1 73 SER 73 50 50 SER SER A . n A 1 74 ARG 74 51 51 ARG ARG A . n A 1 75 GLY 75 52 52 GLY GLY A . n A 1 76 THR 76 53 53 THR THR A . n A 1 77 THR 77 54 54 THR THR A . n A 1 78 VAL 78 55 55 VAL VAL A . n A 1 79 TYR 79 56 56 TYR TYR A . n A 1 80 ASN 80 57 57 ASN ASN A . n A 1 81 ALA 81 58 58 ALA ALA A . n A 1 82 HIS 82 59 59 HIS HIS A . n A 1 83 ARG 83 60 60 ARG ARG A . n A 1 84 ARG 84 61 61 ARG ARG A . n A 1 85 GLU 85 62 62 GLU GLU A . n A 1 86 ALA 86 63 63 ALA ALA A . n A 1 87 TRP 87 64 64 TRP TRP A . n A 1 88 GLY 88 65 65 GLY GLY A . n A 1 89 ALA 89 66 66 ALA ALA A . n A 1 90 GLU 90 67 67 GLU GLU A . n A 1 91 PHE 91 68 68 PHE PHE A . n A 1 92 LEU 92 69 69 LEU LEU A . n A 1 93 SER 93 70 70 SER SER A . n A 1 94 PRO 94 71 71 PRO PRO A . n A 1 95 ALA 95 72 72 ALA ALA A . n A 1 96 GLU 96 73 73 GLU GLU A . n A 1 97 ALA 97 74 74 ALA ALA A . n A 1 98 THR 98 75 75 THR THR A . n A 1 99 ARG 99 76 76 ARG ARG A . n A 1 100 LEU 100 77 77 LEU LEU A . n A 1 101 ASP 101 78 78 ASP ASP A . n A 1 102 HIS 102 79 79 HIS HIS A . n A 1 103 ASP 103 80 80 ASP ASP A . n A 1 104 GLU 104 81 81 GLU GLU A . n A 1 105 ILE 105 82 82 ILE ILE A . n A 1 106 LYS 106 83 83 LYS LYS A . n A 1 107 ALA 107 84 84 ALA ALA A . n A 1 108 ALA 108 85 85 ALA ALA A . n A 1 109 ASP 109 86 86 ASP ASP A . n A 1 110 VAL 110 87 87 VAL VAL A . n A 1 111 PHE 111 88 88 PHE PHE A . n A 1 112 VAL 112 89 89 VAL VAL A . n A 1 113 ALA 113 90 90 ALA ALA A . n A 1 114 PHE 114 91 91 PHE PHE A . n A 1 115 PRO 115 92 92 PRO PRO A . n A 1 116 GLY 116 93 93 GLY GLY A . n A 1 117 VAL 117 94 94 VAL VAL A . n A 1 118 PRO 118 95 95 PRO PRO A . n A 1 119 ALA 119 96 96 ALA ALA A . n A 1 120 SER 120 97 97 SER SER A . n A 1 121 PRO 121 98 98 PRO PRO A . n A 1 122 GLY 122 99 99 GLY GLY A . n A 1 123 THR 123 100 100 THR THR A . n A 1 124 HIS 124 101 101 HIS HIS A . n A 1 125 VAL 125 102 102 VAL VAL A . n A 1 126 GLU 126 103 103 GLU GLU A . n A 1 127 ILE 127 104 104 ILE ILE A . n A 1 128 GLY 128 105 105 GLY GLY A . n A 1 129 TRP 129 106 106 TRP TRP A . n A 1 130 ALA 130 107 107 ALA ALA A . n A 1 131 SER 131 108 108 SER SER A . n A 1 132 GLY 132 109 109 GLY GLY A . n A 1 133 MSE 133 110 110 MSE MSE A . n A 1 134 GLY 134 111 111 GLY GLY A . n A 1 135 LYS 135 112 112 LYS LYS A . n A 1 136 PRO 136 113 113 PRO PRO A . n A 1 137 MSE 137 114 114 MSE MSE A . n A 1 138 VAL 138 115 115 VAL VAL A . n A 1 139 LEU 139 116 116 LEU LEU A . n A 1 140 LEU 140 117 117 LEU LEU A . n A 1 141 LEU 141 118 118 LEU LEU A . n A 1 142 GLU 142 119 119 GLU GLU A . n A 1 143 ARG 143 120 120 ARG ARG A . n A 1 144 ASP 144 121 121 ASP ASP A . n A 1 145 GLU 145 122 122 GLU GLU A . n A 1 146 ASP 146 123 123 ASP ASP A . n A 1 147 TYR 147 124 124 TYR TYR A . n A 1 148 ALA 148 125 125 ALA ALA A . n A 1 149 PHE 149 126 126 PHE PHE A . n A 1 150 LEU 150 127 127 LEU LEU A . n A 1 151 VAL 151 128 128 VAL VAL A . n A 1 152 THR 152 129 129 THR THR A . n A 1 153 GLY 153 130 130 GLY GLY A . n A 1 154 LEU 154 131 131 LEU LEU A . n A 1 155 GLU 155 132 132 GLU GLU A . n A 1 156 SER 156 133 133 SER SER A . n A 1 157 GLN 157 134 134 GLN GLN A . n A 1 158 ALA 158 135 135 ALA ALA A . n A 1 159 ASN 159 136 136 ASN ASN A . n A 1 160 VAL 160 137 137 VAL VAL A . n A 1 161 GLU 161 138 138 GLU GLU A . n A 1 162 ILE 162 139 139 ILE ILE A . n A 1 163 LEU 163 140 140 LEU LEU A . n A 1 164 ARG 164 141 141 ARG ARG A . n A 1 165 PHE 165 142 142 PHE PHE A . n A 1 166 SER 166 143 143 SER SER A . n A 1 167 GLY 167 144 144 GLY GLY A . n A 1 168 THR 168 145 145 THR THR A . n A 1 169 GLU 169 146 146 GLU GLU A . n A 1 170 GLU 170 147 147 GLU GLU A . n A 1 171 ILE 171 148 148 ILE ILE A . n A 1 172 VAL 172 149 149 VAL VAL A . n A 1 173 GLU 173 150 150 GLU GLU A . n A 1 174 ARG 174 151 151 ARG ARG A . n A 1 175 LEU 175 152 152 LEU LEU A . n A 1 176 ASP 176 153 153 ASP ASP A . n A 1 177 GLY 177 154 154 GLY GLY A . n A 1 178 ALA 178 155 155 ALA ALA A . n A 1 179 VAL 179 156 156 VAL VAL A . n A 1 180 ALA 180 157 157 ALA ALA A . n A 1 181 ARG 181 158 158 ARG ARG A . n A 1 182 VAL 182 159 159 VAL VAL A . n A 1 183 LEU 183 160 160 LEU LEU A . n A 1 184 GLY 184 161 161 GLY GLY A . n A 1 185 ARG 185 162 162 ARG ARG A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 201 1 SO4 SO4 A . C 2 SO4 1 202 2 SO4 SO4 A . D 3 HOH 1 301 1 HOH HOH A . D 3 HOH 2 302 2 HOH HOH A . D 3 HOH 3 303 3 HOH HOH A . D 3 HOH 4 304 4 HOH HOH A . D 3 HOH 5 305 5 HOH HOH A . D 3 HOH 6 306 6 HOH HOH A . D 3 HOH 7 307 7 HOH HOH A . D 3 HOH 8 308 8 HOH HOH A . D 3 HOH 9 309 9 HOH HOH A . D 3 HOH 10 310 10 HOH HOH A . D 3 HOH 11 311 11 HOH HOH A . D 3 HOH 12 312 12 HOH HOH A . D 3 HOH 13 313 13 HOH HOH A . D 3 HOH 14 314 14 HOH HOH A . D 3 HOH 15 315 15 HOH HOH A . D 3 HOH 16 316 16 HOH HOH A . D 3 HOH 17 317 17 HOH HOH A . D 3 HOH 18 318 18 HOH HOH A . D 3 HOH 19 319 19 HOH HOH A . D 3 HOH 20 320 20 HOH HOH A . D 3 HOH 21 321 21 HOH HOH A . D 3 HOH 22 322 22 HOH HOH A . D 3 HOH 23 323 23 HOH HOH A . D 3 HOH 24 324 24 HOH HOH A . D 3 HOH 25 325 25 HOH HOH A . D 3 HOH 26 326 26 HOH HOH A . D 3 HOH 27 327 27 HOH HOH A . D 3 HOH 28 328 28 HOH HOH A . D 3 HOH 29 329 29 HOH HOH A . D 3 HOH 30 330 30 HOH HOH A . D 3 HOH 31 331 31 HOH HOH A . D 3 HOH 32 332 32 HOH HOH A . D 3 HOH 33 333 33 HOH HOH A . D 3 HOH 34 334 34 HOH HOH A . D 3 HOH 35 335 35 HOH HOH A . D 3 HOH 36 336 36 HOH HOH A . D 3 HOH 37 337 37 HOH HOH A . D 3 HOH 38 338 39 HOH HOH A . D 3 HOH 39 339 40 HOH HOH A . D 3 HOH 40 340 41 HOH HOH A . D 3 HOH 41 341 42 HOH HOH A . D 3 HOH 42 342 43 HOH HOH A . D 3 HOH 43 343 44 HOH HOH A . D 3 HOH 44 344 45 HOH HOH A . D 3 HOH 45 345 46 HOH HOH A . D 3 HOH 46 346 47 HOH HOH A . D 3 HOH 47 347 48 HOH HOH A . D 3 HOH 48 348 49 HOH HOH A . D 3 HOH 49 349 50 HOH HOH A . D 3 HOH 50 350 51 HOH HOH A . D 3 HOH 51 351 52 HOH HOH A . D 3 HOH 52 352 53 HOH HOH A . D 3 HOH 53 353 54 HOH HOH A . D 3 HOH 54 354 55 HOH HOH A . D 3 HOH 55 355 56 HOH HOH A . D 3 HOH 56 356 57 HOH HOH A . D 3 HOH 57 357 58 HOH HOH A . D 3 HOH 58 358 59 HOH HOH A . D 3 HOH 59 359 60 HOH HOH A . D 3 HOH 60 360 61 HOH HOH A . D 3 HOH 61 361 62 HOH HOH A . D 3 HOH 62 362 63 HOH HOH A . D 3 HOH 63 363 64 HOH HOH A . D 3 HOH 64 364 65 HOH HOH A . D 3 HOH 65 365 66 HOH HOH A . D 3 HOH 66 366 67 HOH HOH A . D 3 HOH 67 367 68 HOH HOH A . D 3 HOH 68 368 69 HOH HOH A . D 3 HOH 69 369 70 HOH HOH A . D 3 HOH 70 370 71 HOH HOH A . D 3 HOH 71 371 72 HOH HOH A . D 3 HOH 72 372 73 HOH HOH A . D 3 HOH 73 373 74 HOH HOH A . D 3 HOH 74 374 75 HOH HOH A . D 3 HOH 75 375 76 HOH HOH A . D 3 HOH 76 376 77 HOH HOH A . D 3 HOH 77 377 78 HOH HOH A . D 3 HOH 78 378 79 HOH HOH A . D 3 HOH 79 379 80 HOH HOH A . D 3 HOH 80 380 81 HOH HOH A . D 3 HOH 81 381 82 HOH HOH A . D 3 HOH 82 382 83 HOH HOH A . D 3 HOH 83 383 84 HOH HOH A . D 3 HOH 84 384 85 HOH HOH A . D 3 HOH 85 385 86 HOH HOH A . D 3 HOH 86 386 87 HOH HOH A . D 3 HOH 87 387 88 HOH HOH A . D 3 HOH 88 388 90 HOH HOH A . D 3 HOH 89 389 91 HOH HOH A . D 3 HOH 90 390 92 HOH HOH A . D 3 HOH 91 391 93 HOH HOH A . D 3 HOH 92 392 94 HOH HOH A . D 3 HOH 93 393 95 HOH HOH A . D 3 HOH 94 394 96 HOH HOH A . D 3 HOH 95 395 97 HOH HOH A . D 3 HOH 96 396 99 HOH HOH A . D 3 HOH 97 397 100 HOH HOH A . D 3 HOH 98 398 101 HOH HOH A . D 3 HOH 99 399 102 HOH HOH A . D 3 HOH 100 400 103 HOH HOH A . D 3 HOH 101 401 104 HOH HOH A . D 3 HOH 102 402 105 HOH HOH A . D 3 HOH 103 403 106 HOH HOH A . D 3 HOH 104 404 108 HOH HOH A . D 3 HOH 105 405 109 HOH HOH A . D 3 HOH 106 406 110 HOH HOH A . D 3 HOH 107 407 113 HOH HOH A . D 3 HOH 108 408 114 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 67 ? CG ? A GLU 90 CG 2 1 Y 1 A GLU 67 ? CD ? A GLU 90 CD 3 1 Y 1 A GLU 67 ? OE1 ? A GLU 90 OE1 4 1 Y 1 A GLU 67 ? OE2 ? A GLU 90 OE2 5 1 Y 1 A ARG 76 ? CG ? A ARG 99 CG 6 1 Y 1 A ARG 76 ? CD ? A ARG 99 CD 7 1 Y 1 A ARG 76 ? NE ? A ARG 99 NE 8 1 Y 1 A ARG 76 ? CZ ? A ARG 99 CZ 9 1 Y 1 A ARG 76 ? NH1 ? A ARG 99 NH1 10 1 Y 1 A ARG 76 ? NH2 ? A ARG 99 NH2 11 1 Y 1 A GLU 146 ? CG ? A GLU 169 CG 12 1 Y 1 A GLU 146 ? CD ? A GLU 169 CD 13 1 Y 1 A GLU 146 ? OE1 ? A GLU 169 OE1 14 1 Y 1 A GLU 146 ? OE2 ? A GLU 169 OE2 15 1 Y 1 A LEU 160 ? CG ? A LEU 183 CG 16 1 Y 1 A LEU 160 ? CD1 ? A LEU 183 CD1 17 1 Y 1 A LEU 160 ? CD2 ? A LEU 183 CD2 # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 PHENIX 1.8.1_1168 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 2 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 3 ADSC Quantum ? ? ? ? 'data collection' ? ? ? 4 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 5 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? 6 AutoSol . ? ? ? ? phasing ? ? ? # _cell.length_a 97.819 _cell.length_b 97.819 _cell.length_c 61.893 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4JEL _cell.pdbx_unique_axis ? _cell.Z_PDB 12 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.entry_id 4JEL _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.Int_Tables_number 180 _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # _exptl.crystals_number 1 _exptl.entry_id 4JEL _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 2.09 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 41.13 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.pH 4.2 _exptl_crystal_grow.temp 291 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_details '8% PEG 1000, 0.1 M phosphate-citrate, 0.2 M lithium sulfate, pH 4.2, VAPOR DIFFUSION, HANGING DROP, temperature 291K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2010-10-20 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Cryo-cooled Si(111) double crystal' _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97918 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97918 _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 24-ID-C # _reflns.entry_id 4JEL _reflns.B_iso_Wilson_estimate 27.960 _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I -3 _reflns.d_resolution_high 1.95 _reflns.d_resolution_low 50 _reflns.number_all 24181 _reflns.number_obs 23697 _reflns.percent_possible_obs 98.2 _reflns.pdbx_Rmerge_I_obs 0.052 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 40.1 _reflns.pdbx_redundancy 5.8 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.percent_possible_obs _reflns_shell.percent_possible_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_redundancy _reflns_shell.number_unique_all _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_unique_obs _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 1.95 1.98 ? 96.9 ? ? ? ? ? ? ? ? ? 1 1 1.98 2.02 ? 97.8 ? ? ? ? ? ? ? ? ? 2 1 2.02 2.06 ? 96.7 ? ? ? ? ? ? ? ? ? 3 1 2.06 2.10 ? 97.9 ? ? ? ? ? ? ? ? ? 4 1 2.10 2.15 ? 97.7 ? ? ? ? ? ? ? ? ? 5 1 2.15 2.20 ? 97.5 ? ? ? ? ? ? ? ? ? 6 1 # _refine.entry_id 4JEL _refine.ls_d_res_high 1.9520 _refine.ls_d_res_low 42.3570 _refine.pdbx_ls_sigma_F 1.890 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 98.2700 _refine.ls_number_reflns_obs 23688 _refine.ls_number_reflns_all 23697 _refine.pdbx_ls_cross_valid_method ? _refine.pdbx_R_Free_selection_details random _refine.details ? _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2002 _refine.ls_R_factor_R_work 0.1981 _refine.ls_wR_factor_R_work ? _refine.ls_R_factor_R_free 0.2434 _refine.ls_wR_factor_R_free ? _refine.ls_percent_reflns_R_free 4.9300 _refine.ls_number_reflns_R_free 1168 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 26.5855 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.1800 _refine.overall_SU_B ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8582 _refine.B_iso_max 51.420 _refine.B_iso_min 12.430 _refine.pdbx_overall_phase_error 21.1700 _refine.occupancy_max 1.000 _refine.occupancy_min 1.000 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1149 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 10 _refine_hist.number_atoms_solvent 108 _refine_hist.number_atoms_total 1267 _refine_hist.d_res_high 1.9520 _refine_hist.d_res_low 42.3570 # loop_ _refine_ls_restr.type _refine_ls_restr.number _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 1183 0.007 ? ? ? 'X-RAY DIFFRACTION' f_angle_d 1607 1.083 ? ? ? 'X-RAY DIFFRACTION' f_chiral_restr 176 0.071 ? ? ? 'X-RAY DIFFRACTION' f_plane_restr 212 0.005 ? ? ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 417 11.833 ? ? ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id 1.9524 2.0412 8 97.0000 2780 . 0.1987 0.2421 . 167 . 2947 . . 'X-RAY DIFFRACTION' 2.0412 2.1488 8 98.0000 2753 . 0.1891 0.2283 . 163 . 2916 . . 'X-RAY DIFFRACTION' 2.1488 2.2835 8 98.0000 2802 . 0.1926 0.2431 . 155 . 2957 . . 'X-RAY DIFFRACTION' 2.2835 2.4597 8 98.0000 2836 . 0.1935 0.2471 . 122 . 2958 . . 'X-RAY DIFFRACTION' 2.4597 2.7072 8 98.0000 2804 . 0.2003 0.2490 . 146 . 2950 . . 'X-RAY DIFFRACTION' 2.7072 3.0989 8 99.0000 2824 . 0.2041 0.2386 . 156 . 2980 . . 'X-RAY DIFFRACTION' 3.0989 3.9038 8 99.0000 2843 . 0.1959 0.2373 . 131 . 2974 . . 'X-RAY DIFFRACTION' 3.9038 42.3668 8 99.0000 2878 . 0.2005 0.2525 . 128 . 3006 . . 'X-RAY DIFFRACTION' # _struct.entry_id 4JEL _struct.title 'Structure of MilB Streptomyces rimofaciens CMP N-glycosidase' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4JEL _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'CMP N-glycosidase, mildiomycin biosynthesis, Hydrolase' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code B4Y381_9ACTO _struct_ref.pdbx_db_accession B4Y381 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MTTTPKPRTAPAVGSVFLGGPFRQLVDPRTGVMSSGDQNVFSRLIEHFESRGTTVYNAHRREAWGAEFLSPAEATRLDHD EIKAADVFVAFPGVPASPGTHVEIGWASGMGKPMVLLLERDEDYAFLVTGLESQANVEILRFSGTEEIVERLDGAVARVL GR ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4JEL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 24 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 185 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession B4Y381 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 162 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 162 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4JEL MSE A 1 ? UNP B4Y381 ? ? 'expression tag' -22 1 1 4JEL GLY A 2 ? UNP B4Y381 ? ? 'expression tag' -21 2 1 4JEL SER A 3 ? UNP B4Y381 ? ? 'expression tag' -20 3 1 4JEL ASP A 4 ? UNP B4Y381 ? ? 'expression tag' -19 4 1 4JEL LYS A 5 ? UNP B4Y381 ? ? 'expression tag' -18 5 1 4JEL ILE A 6 ? UNP B4Y381 ? ? 'expression tag' -17 6 1 4JEL HIS A 7 ? UNP B4Y381 ? ? 'expression tag' -16 7 1 4JEL HIS A 8 ? UNP B4Y381 ? ? 'expression tag' -15 8 1 4JEL HIS A 9 ? UNP B4Y381 ? ? 'expression tag' -14 9 1 4JEL HIS A 10 ? UNP B4Y381 ? ? 'expression tag' -13 10 1 4JEL HIS A 11 ? UNP B4Y381 ? ? 'expression tag' -12 11 1 4JEL HIS A 12 ? UNP B4Y381 ? ? 'expression tag' -11 12 1 4JEL SER A 13 ? UNP B4Y381 ? ? 'expression tag' -10 13 1 4JEL SER A 14 ? UNP B4Y381 ? ? 'expression tag' -9 14 1 4JEL GLY A 15 ? UNP B4Y381 ? ? 'expression tag' -8 15 1 4JEL GLU A 16 ? UNP B4Y381 ? ? 'expression tag' -7 16 1 4JEL ASN A 17 ? UNP B4Y381 ? ? 'expression tag' -6 17 1 4JEL LEU A 18 ? UNP B4Y381 ? ? 'expression tag' -5 18 1 4JEL TYR A 19 ? UNP B4Y381 ? ? 'expression tag' -4 19 1 4JEL PHE A 20 ? UNP B4Y381 ? ? 'expression tag' -3 20 1 4JEL GLN A 21 ? UNP B4Y381 ? ? 'expression tag' -2 21 1 4JEL GLY A 22 ? UNP B4Y381 ? ? 'expression tag' -1 22 1 4JEL HIS A 23 ? UNP B4Y381 ? ? 'expression tag' 0 23 # loop_ _pdbx_struct_assembly.id _pdbx_struct_assembly.details _pdbx_struct_assembly.method_details _pdbx_struct_assembly.oligomeric_details _pdbx_struct_assembly.oligomeric_count 1 author_and_software_defined_assembly PISA dimeric 2 2 author_and_software_defined_assembly PISA dimeric 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 3020 ? 1 MORE -80 ? 1 'SSA (A^2)' 13140 ? 2 'ABSA (A^2)' 1980 ? 2 MORE -61 ? 2 'SSA (A^2)' 14180 ? # loop_ _pdbx_struct_assembly_gen.assembly_id _pdbx_struct_assembly_gen.oper_expression _pdbx_struct_assembly_gen.asym_id_list 1 1,2 A,B,C,D 2 1,3 A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 11_556 -x+y,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 61.8930000000 3 'crystal symmetry operation' 7_556 y,x,-z+5/3 -0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 103.1550000000 # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 PHE A 45 ? VAL A 49 ? PHE A 22 VAL A 26 5 ? 5 HELX_P HELX_P2 2 SER A 57 ? SER A 73 ? SER A 34 SER A 50 1 ? 17 HELX_P HELX_P3 3 ALA A 81 ? GLU A 85 ? ALA A 58 GLU A 62 1 ? 5 HELX_P HELX_P4 4 ALA A 86 ? ALA A 89 ? ALA A 63 ALA A 66 5 ? 4 HELX_P HELX_P5 5 SER A 93 ? ALA A 108 ? SER A 70 ALA A 85 1 ? 16 HELX_P HELX_P6 6 SER A 120 ? GLY A 134 ? SER A 97 GLY A 111 1 ? 15 HELX_P HELX_P7 7 ALA A 148 ? GLY A 153 ? ALA A 125 GLY A 130 1 ? 6 HELX_P HELX_P8 8 GLY A 167 ? GLY A 184 ? GLY A 144 GLY A 161 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A VAL 55 C ? ? ? 1_555 A MSE 56 N ? ? A VAL 32 A MSE 33 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale2 covale both ? A MSE 56 C ? ? ? 1_555 A SER 57 N ? ? A MSE 33 A SER 34 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale3 covale both ? A GLY 132 C ? ? ? 1_555 A MSE 133 N ? ? A GLY 109 A MSE 110 1_555 ? ? ? ? ? ? ? 1.330 ? ? covale4 covale both ? A MSE 133 C ? ? ? 1_555 A GLY 134 N ? ? A MSE 110 A GLY 111 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale5 covale both ? A PRO 136 C ? ? ? 1_555 A MSE 137 N ? ? A PRO 113 A MSE 114 1_555 ? ? ? ? ? ? ? 1.331 ? ? covale6 covale both ? A MSE 137 C ? ? ? 1_555 A VAL 138 N ? ? A MSE 114 A VAL 115 1_555 ? ? ? ? ? ? ? 1.325 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 56 ? . . . . MSE A 33 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 133 ? . . . . MSE A 110 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 137 ? . . . . MSE A 114 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 117 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 94 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 118 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 95 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -2.13 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? parallel A 3 4 ? parallel A 4 5 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 77 ? ASN A 80 ? THR A 54 ASN A 57 A 2 SER A 38 ? GLY A 42 ? SER A 15 GLY A 19 A 3 VAL A 110 ? ALA A 113 ? VAL A 87 ALA A 90 A 4 MSE A 137 ? GLU A 142 ? MSE A 114 GLU A 119 A 5 VAL A 160 ? PHE A 165 ? VAL A 137 PHE A 142 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 O TYR A 79 ? O TYR A 56 N LEU A 41 ? N LEU A 18 A 2 3 N PHE A 40 ? N PHE A 17 O VAL A 112 ? O VAL A 89 A 3 4 N ALA A 113 ? N ALA A 90 O LEU A 140 ? O LEU A 117 A 4 5 N LEU A 139 ? N LEU A 116 O LEU A 163 ? O LEU A 140 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 201 ? 10 'BINDING SITE FOR RESIDUE SO4 A 201' AC2 Software A SO4 202 ? 3 'BINDING SITE FOR RESIDUE SO4 A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 10 PHE A 45 ? PHE A 22 . ? 1_555 ? 2 AC1 10 ARG A 46 ? ARG A 23 . ? 1_555 ? 3 AC1 10 SER A 120 ? SER A 97 . ? 1_555 ? 4 AC1 10 PRO A 121 ? PRO A 98 . ? 1_555 ? 5 AC1 10 GLY A 122 ? GLY A 99 . ? 1_555 ? 6 AC1 10 HOH D . ? HOH A 321 . ? 11_556 ? 7 AC1 10 HOH D . ? HOH A 328 . ? 1_555 ? 8 AC1 10 HOH D . ? HOH A 339 . ? 11_556 ? 9 AC1 10 HOH D . ? HOH A 351 . ? 1_555 ? 10 AC1 10 HOH D . ? HOH A 370 . ? 11_556 ? 11 AC2 3 ARG A 74 ? ARG A 51 . ? 7_556 ? 12 AC2 3 ARG A 143 ? ARG A 120 . ? 1_555 ? 13 AC2 3 HOH D . ? HOH A 325 . ? 1_555 ? # _pdbx_entry_details.entry_id 4JEL _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id PHE _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 22 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -126.07 _pdbx_validate_torsion.psi -76.77 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 56 A MSE 33 ? MET SELENOMETHIONINE 2 A MSE 133 A MSE 110 ? MET SELENOMETHIONINE 3 A MSE 137 A MSE 114 ? MET SELENOMETHIONINE # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 330 ? D HOH . 2 1 A HOH 340 ? D HOH . 3 1 A HOH 406 ? D HOH . # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE -22 ? A MSE 1 2 1 Y 1 A GLY -21 ? A GLY 2 3 1 Y 1 A SER -20 ? A SER 3 4 1 Y 1 A ASP -19 ? A ASP 4 5 1 Y 1 A LYS -18 ? A LYS 5 6 1 Y 1 A ILE -17 ? A ILE 6 7 1 Y 1 A HIS -16 ? A HIS 7 8 1 Y 1 A HIS -15 ? A HIS 8 9 1 Y 1 A HIS -14 ? A HIS 9 10 1 Y 1 A HIS -13 ? A HIS 10 11 1 Y 1 A HIS -12 ? A HIS 11 12 1 Y 1 A HIS -11 ? A HIS 12 13 1 Y 1 A SER -10 ? A SER 13 14 1 Y 1 A SER -9 ? A SER 14 15 1 Y 1 A GLY -8 ? A GLY 15 16 1 Y 1 A GLU -7 ? A GLU 16 17 1 Y 1 A ASN -6 ? A ASN 17 18 1 Y 1 A LEU -5 ? A LEU 18 19 1 Y 1 A TYR -4 ? A TYR 19 20 1 Y 1 A PHE -3 ? A PHE 20 21 1 Y 1 A GLN -2 ? A GLN 21 22 1 Y 1 A GLY -1 ? A GLY 22 23 1 Y 1 A HIS 0 ? A HIS 23 24 1 Y 1 A MSE 1 ? A MSE 24 25 1 Y 1 A THR 2 ? A THR 25 26 1 Y 1 A THR 3 ? A THR 26 27 1 Y 1 A THR 4 ? A THR 27 28 1 Y 1 A PRO 5 ? A PRO 28 29 1 Y 1 A LYS 6 ? A LYS 29 30 1 Y 1 A PRO 7 ? A PRO 30 31 1 Y 1 A ARG 8 ? A ARG 31 32 1 Y 1 A THR 9 ? A THR 32 33 1 Y 1 A ALA 10 ? A ALA 33 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MSE N N N N 216 MSE CA C N S 217 MSE C C N N 218 MSE O O N N 219 MSE OXT O N N 220 MSE CB C N N 221 MSE CG C N N 222 MSE SE SE N N 223 MSE CE C N N 224 MSE H H N N 225 MSE H2 H N N 226 MSE HA H N N 227 MSE HXT H N N 228 MSE HB2 H N N 229 MSE HB3 H N N 230 MSE HG2 H N N 231 MSE HG3 H N N 232 MSE HE1 H N N 233 MSE HE2 H N N 234 MSE HE3 H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 SO4 S S N N 290 SO4 O1 O N N 291 SO4 O2 O N N 292 SO4 O3 O N N 293 SO4 O4 O N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 TRP N N N N 312 TRP CA C N S 313 TRP C C N N 314 TRP O O N N 315 TRP CB C N N 316 TRP CG C Y N 317 TRP CD1 C Y N 318 TRP CD2 C Y N 319 TRP NE1 N Y N 320 TRP CE2 C Y N 321 TRP CE3 C Y N 322 TRP CZ2 C Y N 323 TRP CZ3 C Y N 324 TRP CH2 C Y N 325 TRP OXT O N N 326 TRP H H N N 327 TRP H2 H N N 328 TRP HA H N N 329 TRP HB2 H N N 330 TRP HB3 H N N 331 TRP HD1 H N N 332 TRP HE1 H N N 333 TRP HE3 H N N 334 TRP HZ2 H N N 335 TRP HZ3 H N N 336 TRP HH2 H N N 337 TRP HXT H N N 338 TYR N N N N 339 TYR CA C N S 340 TYR C C N N 341 TYR O O N N 342 TYR CB C N N 343 TYR CG C Y N 344 TYR CD1 C Y N 345 TYR CD2 C Y N 346 TYR CE1 C Y N 347 TYR CE2 C Y N 348 TYR CZ C Y N 349 TYR OH O N N 350 TYR OXT O N N 351 TYR H H N N 352 TYR H2 H N N 353 TYR HA H N N 354 TYR HB2 H N N 355 TYR HB3 H N N 356 TYR HD1 H N N 357 TYR HD2 H N N 358 TYR HE1 H N N 359 TYR HE2 H N N 360 TYR HH H N N 361 TYR HXT H N N 362 VAL N N N N 363 VAL CA C N S 364 VAL C C N N 365 VAL O O N N 366 VAL CB C N N 367 VAL CG1 C N N 368 VAL CG2 C N N 369 VAL OXT O N N 370 VAL H H N N 371 VAL H2 H N N 372 VAL HA H N N 373 VAL HB H N N 374 VAL HG11 H N N 375 VAL HG12 H N N 376 VAL HG13 H N N 377 VAL HG21 H N N 378 VAL HG22 H N N 379 VAL HG23 H N N 380 VAL HXT H N N 381 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MSE N CA sing N N 205 MSE N H sing N N 206 MSE N H2 sing N N 207 MSE CA C sing N N 208 MSE CA CB sing N N 209 MSE CA HA sing N N 210 MSE C O doub N N 211 MSE C OXT sing N N 212 MSE OXT HXT sing N N 213 MSE CB CG sing N N 214 MSE CB HB2 sing N N 215 MSE CB HB3 sing N N 216 MSE CG SE sing N N 217 MSE CG HG2 sing N N 218 MSE CG HG3 sing N N 219 MSE SE CE sing N N 220 MSE CE HE1 sing N N 221 MSE CE HE2 sing N N 222 MSE CE HE3 sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 SO4 S O1 doub N N 277 SO4 S O2 doub N N 278 SO4 S O3 sing N N 279 SO4 S O4 sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 TRP N CA sing N N 297 TRP N H sing N N 298 TRP N H2 sing N N 299 TRP CA C sing N N 300 TRP CA CB sing N N 301 TRP CA HA sing N N 302 TRP C O doub N N 303 TRP C OXT sing N N 304 TRP CB CG sing N N 305 TRP CB HB2 sing N N 306 TRP CB HB3 sing N N 307 TRP CG CD1 doub Y N 308 TRP CG CD2 sing Y N 309 TRP CD1 NE1 sing Y N 310 TRP CD1 HD1 sing N N 311 TRP CD2 CE2 doub Y N 312 TRP CD2 CE3 sing Y N 313 TRP NE1 CE2 sing Y N 314 TRP NE1 HE1 sing N N 315 TRP CE2 CZ2 sing Y N 316 TRP CE3 CZ3 doub Y N 317 TRP CE3 HE3 sing N N 318 TRP CZ2 CH2 doub Y N 319 TRP CZ2 HZ2 sing N N 320 TRP CZ3 CH2 sing Y N 321 TRP CZ3 HZ3 sing N N 322 TRP CH2 HH2 sing N N 323 TRP OXT HXT sing N N 324 TYR N CA sing N N 325 TYR N H sing N N 326 TYR N H2 sing N N 327 TYR CA C sing N N 328 TYR CA CB sing N N 329 TYR CA HA sing N N 330 TYR C O doub N N 331 TYR C OXT sing N N 332 TYR CB CG sing N N 333 TYR CB HB2 sing N N 334 TYR CB HB3 sing N N 335 TYR CG CD1 doub Y N 336 TYR CG CD2 sing Y N 337 TYR CD1 CE1 sing Y N 338 TYR CD1 HD1 sing N N 339 TYR CD2 CE2 doub Y N 340 TYR CD2 HD2 sing N N 341 TYR CE1 CZ doub Y N 342 TYR CE1 HE1 sing N N 343 TYR CE2 CZ sing Y N 344 TYR CE2 HE2 sing N N 345 TYR CZ OH sing N N 346 TYR OH HH sing N N 347 TYR OXT HXT sing N N 348 VAL N CA sing N N 349 VAL N H sing N N 350 VAL N H2 sing N N 351 VAL CA C sing N N 352 VAL CA CB sing N N 353 VAL CA HA sing N N 354 VAL C O doub N N 355 VAL C OXT sing N N 356 VAL CB CG1 sing N N 357 VAL CB CG2 sing N N 358 VAL CB HB sing N N 359 VAL CG1 HG11 sing N N 360 VAL CG1 HG12 sing N N 361 VAL CG1 HG13 sing N N 362 VAL CG2 HG21 sing N N 363 VAL CG2 HG22 sing N N 364 VAL CG2 HG23 sing N N 365 VAL OXT HXT sing N N 366 # _atom_sites.entry_id 4JEL _atom_sites.fract_transf_matrix[1][1] 0.010223 _atom_sites.fract_transf_matrix[1][2] 0.005902 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011804 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.016157 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_