data_4JHS # _entry.id 4JHS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4JHS pdb_00004jhs 10.2210/pdb4jhs/pdb RCSB RCSB078062 ? ? WWPDB D_1000078062 ? ? # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.db_id NYSGRC-016193 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 4JHS _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-03-05 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bonanno, J.B.' 1 'Toro, R.' 2 'Gizzi, A.' 3 'Chan, M.K.' 4 'Garrett-Thomson, S.C.' 5 'Patel, H.' 6 'Lim, S.' 7 'Matikainen, B.' 8 'Celikgil, A.' 9 'Garforth, S.' 10 'Hillerich, B.' 11 'Seidel, R.' 12 'Rand, J.H.' 13 'Almo, S.C.' 14 'New York Structural Genomics Research Consortium (NYSGRC)' 15 'Atoms-to-Animals: The Immune Function Network (IFN)' 16 # _citation.id primary _citation.title 'Crystal structure of a C-terminal two domain fragment of human beta-2-glycoprotein 1' _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Bonanno, J.B.' 1 ? primary 'Toro, R.' 2 ? primary 'Gizzi, A.' 3 ? primary 'Chan, M.K.' 4 ? primary 'Garrett-Thomson, S.C.' 5 ? primary 'Patel, H.' 6 ? primary 'Lim, S.' 7 ? primary 'Matikainen, B.' 8 ? primary 'Celikgil, A.' 9 ? primary 'Garforth, S.' 10 ? primary 'Hillerich, B.' 11 ? primary 'Seidel, R.' 12 ? primary 'Rand, J.H.' 13 ? primary 'Almo, S.C.' 14 ? # _cell.length_a 157.790 _cell.length_b 157.790 _cell.length_c 157.790 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 4JHS _cell.pdbx_unique_axis ? _cell.Z_PDB 48 _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.space_group_name_H-M 'I 41 3 2' _symmetry.entry_id 4JHS _symmetry.Int_Tables_number 214 _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Beta-2-glycoprotein 1' 20722.479 1 ? ? 'C-terminal two domain fragment (UNP residues 203-345)' ? 2 non-polymer syn 'SULFATE ION' 96.063 3 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;APC inhibitor, Activated protein C-binding protein, Anticardiolipin cofactor, Apolipoprotein H, Apo-H, Beta-2-glycoprotein I, B2GPI, Beta(2)GPI ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QDYKDDDDKHHHHHHHHHHENLYFQSHVLFIFPRTSGVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEE IECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKC FKEHSSLAFWKTDASDVKPC ; _entity_poly.pdbx_seq_one_letter_code_can ;QDYKDDDDKHHHHHHHHHHENLYFQSHVLFIFPRTSGVKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEE IECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKIQEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKC FKEHSSLAFWKTDASDVKPC ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYSGRC-016193 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 ASP n 1 3 TYR n 1 4 LYS n 1 5 ASP n 1 6 ASP n 1 7 ASP n 1 8 ASP n 1 9 LYS n 1 10 HIS n 1 11 HIS n 1 12 HIS n 1 13 HIS n 1 14 HIS n 1 15 HIS n 1 16 HIS n 1 17 HIS n 1 18 HIS n 1 19 HIS n 1 20 GLU n 1 21 ASN n 1 22 LEU n 1 23 TYR n 1 24 PHE n 1 25 GLN n 1 26 SER n 1 27 HIS n 1 28 VAL n 1 29 LEU n 1 30 PHE n 1 31 ILE n 1 32 PHE n 1 33 PRO n 1 34 ARG n 1 35 THR n 1 36 SER n 1 37 GLY n 1 38 VAL n 1 39 LYS n 1 40 CYS n 1 41 PRO n 1 42 PHE n 1 43 PRO n 1 44 SER n 1 45 ARG n 1 46 PRO n 1 47 ASP n 1 48 ASN n 1 49 GLY n 1 50 PHE n 1 51 VAL n 1 52 ASN n 1 53 TYR n 1 54 PRO n 1 55 ALA n 1 56 LYS n 1 57 PRO n 1 58 THR n 1 59 LEU n 1 60 TYR n 1 61 TYR n 1 62 LYS n 1 63 ASP n 1 64 LYS n 1 65 ALA n 1 66 THR n 1 67 PHE n 1 68 GLY n 1 69 CYS n 1 70 HIS n 1 71 ASP n 1 72 GLY n 1 73 TYR n 1 74 SER n 1 75 LEU n 1 76 ASP n 1 77 GLY n 1 78 PRO n 1 79 GLU n 1 80 GLU n 1 81 ILE n 1 82 GLU n 1 83 CYS n 1 84 THR n 1 85 LYS n 1 86 LEU n 1 87 GLY n 1 88 ASN n 1 89 TRP n 1 90 SER n 1 91 ALA n 1 92 MET n 1 93 PRO n 1 94 SER n 1 95 CYS n 1 96 LYS n 1 97 ALA n 1 98 SER n 1 99 CYS n 1 100 LYS n 1 101 VAL n 1 102 PRO n 1 103 VAL n 1 104 LYS n 1 105 LYS n 1 106 ALA n 1 107 THR n 1 108 VAL n 1 109 VAL n 1 110 TYR n 1 111 GLN n 1 112 GLY n 1 113 GLU n 1 114 ARG n 1 115 VAL n 1 116 LYS n 1 117 ILE n 1 118 GLN n 1 119 GLU n 1 120 LYS n 1 121 PHE n 1 122 LYS n 1 123 ASN n 1 124 GLY n 1 125 MET n 1 126 LEU n 1 127 HIS n 1 128 GLY n 1 129 ASP n 1 130 LYS n 1 131 VAL n 1 132 SER n 1 133 PHE n 1 134 PHE n 1 135 CYS n 1 136 LYS n 1 137 ASN n 1 138 LYS n 1 139 GLU n 1 140 LYS n 1 141 LYS n 1 142 CYS n 1 143 SER n 1 144 TYR n 1 145 THR n 1 146 GLU n 1 147 ASP n 1 148 ALA n 1 149 GLN n 1 150 CYS n 1 151 ILE n 1 152 ASP n 1 153 GLY n 1 154 THR n 1 155 ILE n 1 156 GLU n 1 157 VAL n 1 158 PRO n 1 159 LYS n 1 160 CYS n 1 161 PHE n 1 162 LYS n 1 163 GLU n 1 164 HIS n 1 165 SER n 1 166 SER n 1 167 LEU n 1 168 ALA n 1 169 PHE n 1 170 TRP n 1 171 LYS n 1 172 THR n 1 173 ASP n 1 174 ALA n 1 175 SER n 1 176 ASP n 1 177 VAL n 1 178 LYS n 1 179 PRO n 1 180 CYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'APOH, B2G1' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'TRICHOPLUSIA NI' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7111 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain BTI-TN-5B1-4 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pIEx _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code APOH_HUMAN _struct_ref.pdbx_db_accession P02749 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;VKCPFPSRPDNGFVNYPAKPTLYYKDKATFGCHDGYSLDGPEEIECTKLGNWSAMPSCKASCKVPVKKATVVYQGERVKI QEKFKNGMLHGDKVSFFCKNKEKKCSYTEDAQCIDGTIEVPKCFKEHSSLAFWKTDASDVKPC ; _struct_ref.pdbx_align_begin 203 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4JHS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 38 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 180 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P02749 _struct_ref_seq.db_align_beg 203 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 345 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 203 _struct_ref_seq.pdbx_auth_seq_align_end 345 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4JHS GLN A 1 ? UNP P02749 ? ? 'expression tag' 166 1 1 4JHS ASP A 2 ? UNP P02749 ? ? 'expression tag' 167 2 1 4JHS TYR A 3 ? UNP P02749 ? ? 'expression tag' 168 3 1 4JHS LYS A 4 ? UNP P02749 ? ? 'expression tag' 169 4 1 4JHS ASP A 5 ? UNP P02749 ? ? 'expression tag' 170 5 1 4JHS ASP A 6 ? UNP P02749 ? ? 'expression tag' 171 6 1 4JHS ASP A 7 ? UNP P02749 ? ? 'expression tag' 172 7 1 4JHS ASP A 8 ? UNP P02749 ? ? 'expression tag' 173 8 1 4JHS LYS A 9 ? UNP P02749 ? ? 'expression tag' 174 9 1 4JHS HIS A 10 ? UNP P02749 ? ? 'expression tag' 175 10 1 4JHS HIS A 11 ? UNP P02749 ? ? 'expression tag' 176 11 1 4JHS HIS A 12 ? UNP P02749 ? ? 'expression tag' 177 12 1 4JHS HIS A 13 ? UNP P02749 ? ? 'expression tag' 178 13 1 4JHS HIS A 14 ? UNP P02749 ? ? 'expression tag' 179 14 1 4JHS HIS A 15 ? UNP P02749 ? ? 'expression tag' 180 15 1 4JHS HIS A 16 ? UNP P02749 ? ? 'expression tag' 181 16 1 4JHS HIS A 17 ? UNP P02749 ? ? 'expression tag' 182 17 1 4JHS HIS A 18 ? UNP P02749 ? ? 'expression tag' 183 18 1 4JHS HIS A 19 ? UNP P02749 ? ? 'expression tag' 184 19 1 4JHS GLU A 20 ? UNP P02749 ? ? 'expression tag' 185 20 1 4JHS ASN A 21 ? UNP P02749 ? ? 'expression tag' 186 21 1 4JHS LEU A 22 ? UNP P02749 ? ? 'expression tag' 187 22 1 4JHS TYR A 23 ? UNP P02749 ? ? 'expression tag' 188 23 1 4JHS PHE A 24 ? UNP P02749 ? ? 'expression tag' 189 24 1 4JHS GLN A 25 ? UNP P02749 ? ? 'expression tag' 190 25 1 4JHS SER A 26 ? UNP P02749 ? ? 'expression tag' 191 26 1 4JHS HIS A 27 ? UNP P02749 ? ? 'expression tag' 192 27 1 4JHS VAL A 28 ? UNP P02749 ? ? 'expression tag' 193 28 1 4JHS LEU A 29 ? UNP P02749 ? ? 'expression tag' 194 29 1 4JHS PHE A 30 ? UNP P02749 ? ? 'expression tag' 195 30 1 4JHS ILE A 31 ? UNP P02749 ? ? 'expression tag' 196 31 1 4JHS PHE A 32 ? UNP P02749 ? ? 'expression tag' 197 32 1 4JHS PRO A 33 ? UNP P02749 ? ? 'expression tag' 198 33 1 4JHS ARG A 34 ? UNP P02749 ? ? 'expression tag' 199 34 1 4JHS THR A 35 ? UNP P02749 ? ? 'expression tag' 200 35 1 4JHS SER A 36 ? UNP P02749 ? ? 'expression tag' 201 36 1 4JHS GLY A 37 ? UNP P02749 ? ? 'expression tag' 202 37 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.crystals_number 1 _exptl.entry_id 4JHS _exptl.method 'X-RAY DIFFRACTION' # _exptl_crystal.id 1 _exptl_crystal.density_Matthews 3.95 _exptl_crystal.density_meas ? _exptl_crystal.density_percent_sol 68.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION' _exptl_crystal_grow.pH 4.6 _exptl_crystal_grow.temp 294 _exptl_crystal_grow.pdbx_details '100mM sodium acetate trihydrate pH 4.6, 2.0M ammonium sulfate, vapor diffusion, temperature 294K' _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.pdbx_collection_date 2011-06-19 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97950 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X29A' _diffrn_source.pdbx_wavelength_list 0.97950 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X29A # _reflns.entry_id 4JHS _reflns.d_resolution_high 3.0 _reflns.d_resolution_low 50.0 _reflns.number_all 7030 _reflns.number_obs 7030 _reflns.pdbx_netI_over_sigmaI 16.900 _reflns.pdbx_Rsym_value 0.180 _reflns.pdbx_redundancy 21.500 _reflns.percent_possible_obs 100.000 _reflns.observed_criterion_sigma_F -3 _reflns.observed_criterion_sigma_I -3 _reflns.pdbx_Rmerge_I_obs ? _reflns.B_iso_Wilson_estimate 70.3 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.number_measured_obs _reflns_shell.number_measured_all _reflns_shell.number_unique_obs _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_obs _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_redundancy _reflns_shell.percent_possible_obs _reflns_shell.number_unique_all _reflns_shell.percent_possible_all _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id 3.000 3.160 ? 21340 ? 0.819 1.000 0.819 ? 21.400 ? 999 100.000 1 1 3.160 3.350 ? 20768 ? 0.514 1.500 0.514 ? 21.800 ? 951 100.000 2 1 3.350 3.590 ? 19731 ? 0.344 2.300 0.344 ? 22.100 ? 892 100.000 3 1 3.590 3.870 ? 18342 ? 0.233 3.300 0.233 ? 22.200 ? 825 100.000 4 1 3.870 4.240 ? 17162 ? 0.150 5.000 0.150 ? 22.100 ? 777 100.000 5 1 4.240 4.740 ? 15184 ? 0.119 6.200 0.119 ? 21.600 ? 702 100.000 6 1 4.740 5.480 ? 13456 ? 0.120 6.100 0.120 ? 21.100 ? 639 100.000 7 1 5.480 6.710 ? 10528 ? 0.114 6.100 0.114 ? 19.500 ? 541 100.000 8 1 6.710 9.490 ? 9214 ? 0.073 9.000 0.073 ? 21.300 ? 433 100.000 9 1 9.490 49.898 ? 5088 ? 0.059 9.700 0.059 ? 18.800 ? 271 99.400 10 1 # _refine.entry_id 4JHS _refine.ls_d_res_high 3.0 _refine.ls_d_res_low 20.0 _refine.pdbx_ls_sigma_F 0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.ls_percent_reflns_obs 99.95 _refine.ls_number_reflns_obs 6984 _refine.ls_number_reflns_all 6987 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_R_Free_selection_details Random _refine.details ? _refine.ls_R_factor_all 0.2086 _refine.ls_R_factor_obs ? _refine.ls_R_factor_R_work 0.2066 _refine.ls_wR_factor_R_work 0.1818 _refine.ls_R_factor_R_free 0.2496 _refine.ls_wR_factor_R_free 0.2260 _refine.ls_percent_reflns_R_free ? _refine.ls_number_reflns_R_free 331 _refine.ls_R_factor_R_free_error ? _refine.B_iso_mean 53.8027 _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.pdbx_isotropic_thermal_model ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.overall_SU_R_Cruickshank_DPI 0.4440 _refine.overall_SU_R_free 0.3104 _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.overall_SU_B ? _refine.solvent_model_details ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.pdbx_starting_model 1C1Z _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.overall_FOM_work_R_set 0.8611 _refine.B_iso_max 110.960 _refine.B_iso_min 25.750 _refine.pdbx_overall_phase_error ? _refine.occupancy_max 1.000 _refine.occupancy_min 1.000 _refine.pdbx_ls_sigma_I ? _refine.ls_redundancy_reflns_obs ? _refine.ls_R_factor_R_free_error_details ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.overall_FOM_free_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1097 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 15 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1112 _refine_hist.d_res_high 3.0 _refine_hist.d_res_low 20.0 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id r_bond_refined_d 0.010 ? ? ? ? 'X-RAY DIFFRACTION' r_angle_refined_deg 1.370 ? ? ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_1_deg 7.206 ? ? ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_2_deg 37.724 ? ? ? ? 'X-RAY DIFFRACTION' r_chiral_restr 0.071 ? ? ? ? 'X-RAY DIFFRACTION' r_gen_planes_refined 0.005 ? ? ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_3_deg 22.262 ? ? ? ? 'X-RAY DIFFRACTION' r_dihedral_angle_4_deg 23.261 ? ? ? ? 'X-RAY DIFFRACTION' # _refine_ls_shell.d_res_high 3.000 _refine_ls_shell.d_res_low 3.076 _refine_ls_shell.number_reflns_obs 492 _refine_ls_shell.number_reflns_R_free 24 _refine_ls_shell.R_factor_R_work 0.285 _refine_ls_shell.R_factor_R_free 0.421 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_obs 100.00 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.pdbx_total_number_of_bins_used ? _refine_ls_shell.number_reflns_R_work ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4JHS _struct.title 'Crystal structure of a C-terminal two domain fragment of human beta-2-glycoprotein 1' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4JHS _struct_keywords.text ;STRUCTURAL GENOMICS, GLYCOPROTEIN, PSI-Biology, New York Structural Genomics Research Consortium, NYSGRC, Atoms-to-Animals: The Immune Function Network, IFN, SIGNALING PROTEIN ; _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 2 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ILE A 117 ? PHE A 121 ? ILE A 282 PHE A 286 1 ? 5 HELX_P HELX_P2 2 ASP A 173 ? VAL A 177 ? ASP A 338 VAL A 342 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role disulf1 disulf ? ? A CYS 40 SG ? ? ? 1_555 A CYS 83 SG ? ? A CYS 205 A CYS 248 1_555 ? ? ? ? ? ? ? 2.040 ? ? disulf2 disulf ? ? A CYS 69 SG ? ? ? 1_555 A CYS 95 SG ? ? A CYS 234 A CYS 260 1_555 ? ? ? ? ? ? ? 2.071 ? ? disulf3 disulf ? ? A CYS 99 SG ? ? ? 1_555 A CYS 150 SG ? ? A CYS 264 A CYS 315 1_555 ? ? ? ? ? ? ? 2.053 ? ? disulf4 disulf ? ? A CYS 135 SG ? ? ? 1_555 A CYS 160 SG ? ? A CYS 300 A CYS 325 1_555 ? ? ? ? ? ? ? 2.092 ? ? disulf5 disulf ? ? A CYS 142 SG ? ? ? 1_555 A CYS 180 SG ? ? A CYS 307 A CYS 345 1_555 ? ? ? ? ? ? ? 2.047 ? ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel C 1 2 ? anti-parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 49 ? ASN A 52 ? GLY A 214 ASN A 217 A 2 LYS A 64 ? CYS A 69 ? LYS A 229 CYS A 234 A 3 GLU A 80 ? GLU A 82 ? GLU A 245 GLU A 247 B 1 TYR A 73 ? ASP A 76 ? TYR A 238 ASP A 241 B 2 SER A 94 ? ALA A 97 ? SER A 259 ALA A 262 C 1 GLU A 113 ? LYS A 116 ? GLU A 278 LYS A 281 C 2 THR A 107 ? TYR A 110 ? THR A 272 TYR A 275 C 3 LYS A 130 ? ASN A 137 ? LYS A 295 ASN A 302 C 4 CYS A 142 ? GLN A 149 ? CYS A 307 GLN A 314 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N PHE A 50 ? N PHE A 215 O GLY A 68 ? O GLY A 233 A 2 3 N ALA A 65 ? N ALA A 230 O ILE A 81 ? O ILE A 246 B 1 2 N ASP A 76 ? N ASP A 241 O SER A 94 ? O SER A 259 C 1 2 O VAL A 115 ? O VAL A 280 N VAL A 108 ? N VAL A 273 C 2 3 N VAL A 109 ? N VAL A 274 O SER A 132 ? O SER A 297 C 3 4 N CYS A 135 ? N CYS A 300 O TYR A 144 ? O TYR A 309 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 401 ? 4 'BINDING SITE FOR RESIDUE SO4 A 401' AC2 Software A SO4 402 ? 5 'BINDING SITE FOR RESIDUE SO4 A 402' AC3 Software A SO4 403 ? 3 'BINDING SITE FOR RESIDUE SO4 A 403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 LYS A 136 ? LYS A 301 . ? 1_555 ? 2 AC1 4 LYS A 138 ? LYS A 303 . ? 1_555 ? 3 AC1 4 HIS A 164 ? HIS A 329 . ? 1_555 ? 4 AC1 4 LYS A 171 ? LYS A 336 . ? 1_555 ? 5 AC2 5 LYS A 136 ? LYS A 301 . ? 1_555 ? 6 AC2 5 LYS A 138 ? LYS A 303 . ? 1_555 ? 7 AC2 5 TRP A 170 ? TRP A 335 . ? 1_555 ? 8 AC2 5 LYS A 171 ? LYS A 336 . ? 1_555 ? 9 AC2 5 THR A 172 ? THR A 337 . ? 1_555 ? 10 AC3 3 ARG A 45 ? ARG A 210 . ? 1_555 ? 11 AC3 3 ASN A 48 ? ASN A 213 . ? 1_555 ? 12 AC3 3 HIS A 70 ? HIS A 235 . ? 1_555 ? # _atom_sites.entry_id 4JHS _atom_sites.fract_transf_matrix[1][1] 0.006338 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.006338 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.006338 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 166 ? ? ? A . n A 1 2 ASP 2 167 ? ? ? A . n A 1 3 TYR 3 168 ? ? ? A . n A 1 4 LYS 4 169 ? ? ? A . n A 1 5 ASP 5 170 ? ? ? A . n A 1 6 ASP 6 171 ? ? ? A . n A 1 7 ASP 7 172 ? ? ? A . n A 1 8 ASP 8 173 ? ? ? A . n A 1 9 LYS 9 174 ? ? ? A . n A 1 10 HIS 10 175 ? ? ? A . n A 1 11 HIS 11 176 ? ? ? A . n A 1 12 HIS 12 177 ? ? ? A . n A 1 13 HIS 13 178 ? ? ? A . n A 1 14 HIS 14 179 ? ? ? A . n A 1 15 HIS 15 180 ? ? ? A . n A 1 16 HIS 16 181 ? ? ? A . n A 1 17 HIS 17 182 ? ? ? A . n A 1 18 HIS 18 183 ? ? ? A . n A 1 19 HIS 19 184 ? ? ? A . n A 1 20 GLU 20 185 ? ? ? A . n A 1 21 ASN 21 186 ? ? ? A . n A 1 22 LEU 22 187 ? ? ? A . n A 1 23 TYR 23 188 ? ? ? A . n A 1 24 PHE 24 189 ? ? ? A . n A 1 25 GLN 25 190 ? ? ? A . n A 1 26 SER 26 191 ? ? ? A . n A 1 27 HIS 27 192 ? ? ? A . n A 1 28 VAL 28 193 ? ? ? A . n A 1 29 LEU 29 194 ? ? ? A . n A 1 30 PHE 30 195 ? ? ? A . n A 1 31 ILE 31 196 ? ? ? A . n A 1 32 PHE 32 197 ? ? ? A . n A 1 33 PRO 33 198 ? ? ? A . n A 1 34 ARG 34 199 ? ? ? A . n A 1 35 THR 35 200 ? ? ? A . n A 1 36 SER 36 201 ? ? ? A . n A 1 37 GLY 37 202 ? ? ? A . n A 1 38 VAL 38 203 ? ? ? A . n A 1 39 LYS 39 204 204 LYS LYS A . n A 1 40 CYS 40 205 205 CYS CYS A . n A 1 41 PRO 41 206 206 PRO PRO A . n A 1 42 PHE 42 207 207 PHE PHE A . n A 1 43 PRO 43 208 208 PRO PRO A . n A 1 44 SER 44 209 209 SER SER A . n A 1 45 ARG 45 210 210 ARG ARG A . n A 1 46 PRO 46 211 211 PRO PRO A . n A 1 47 ASP 47 212 212 ASP ASP A . n A 1 48 ASN 48 213 213 ASN ASN A . n A 1 49 GLY 49 214 214 GLY GLY A . n A 1 50 PHE 50 215 215 PHE PHE A . n A 1 51 VAL 51 216 216 VAL VAL A . n A 1 52 ASN 52 217 217 ASN ASN A . n A 1 53 TYR 53 218 218 TYR TYR A . n A 1 54 PRO 54 219 219 PRO PRO A . n A 1 55 ALA 55 220 220 ALA ALA A . n A 1 56 LYS 56 221 221 LYS LYS A . n A 1 57 PRO 57 222 222 PRO PRO A . n A 1 58 THR 58 223 223 THR THR A . n A 1 59 LEU 59 224 224 LEU LEU A . n A 1 60 TYR 60 225 225 TYR TYR A . n A 1 61 TYR 61 226 226 TYR TYR A . n A 1 62 LYS 62 227 227 LYS LYS A . n A 1 63 ASP 63 228 228 ASP ASP A . n A 1 64 LYS 64 229 229 LYS LYS A . n A 1 65 ALA 65 230 230 ALA ALA A . n A 1 66 THR 66 231 231 THR THR A . n A 1 67 PHE 67 232 232 PHE PHE A . n A 1 68 GLY 68 233 233 GLY GLY A . n A 1 69 CYS 69 234 234 CYS CYS A . n A 1 70 HIS 70 235 235 HIS HIS A . n A 1 71 ASP 71 236 236 ASP ASP A . n A 1 72 GLY 72 237 237 GLY GLY A . n A 1 73 TYR 73 238 238 TYR TYR A . n A 1 74 SER 74 239 239 SER SER A . n A 1 75 LEU 75 240 240 LEU LEU A . n A 1 76 ASP 76 241 241 ASP ASP A . n A 1 77 GLY 77 242 242 GLY GLY A . n A 1 78 PRO 78 243 243 PRO PRO A . n A 1 79 GLU 79 244 244 GLU GLU A . n A 1 80 GLU 80 245 245 GLU GLU A . n A 1 81 ILE 81 246 246 ILE ILE A . n A 1 82 GLU 82 247 247 GLU GLU A . n A 1 83 CYS 83 248 248 CYS CYS A . n A 1 84 THR 84 249 249 THR THR A . n A 1 85 LYS 85 250 250 LYS LYS A . n A 1 86 LEU 86 251 251 LEU LEU A . n A 1 87 GLY 87 252 252 GLY GLY A . n A 1 88 ASN 88 253 253 ASN ASN A . n A 1 89 TRP 89 254 254 TRP TRP A . n A 1 90 SER 90 255 255 SER SER A . n A 1 91 ALA 91 256 256 ALA ALA A . n A 1 92 MET 92 257 257 MET MET A . n A 1 93 PRO 93 258 258 PRO PRO A . n A 1 94 SER 94 259 259 SER SER A . n A 1 95 CYS 95 260 260 CYS CYS A . n A 1 96 LYS 96 261 261 LYS LYS A . n A 1 97 ALA 97 262 262 ALA ALA A . n A 1 98 SER 98 263 263 SER SER A . n A 1 99 CYS 99 264 264 CYS CYS A . n A 1 100 LYS 100 265 265 LYS LYS A . n A 1 101 VAL 101 266 266 VAL VAL A . n A 1 102 PRO 102 267 267 PRO PRO A . n A 1 103 VAL 103 268 268 VAL VAL A . n A 1 104 LYS 104 269 269 LYS LYS A . n A 1 105 LYS 105 270 270 LYS LYS A . n A 1 106 ALA 106 271 271 ALA ALA A . n A 1 107 THR 107 272 272 THR THR A . n A 1 108 VAL 108 273 273 VAL VAL A . n A 1 109 VAL 109 274 274 VAL VAL A . n A 1 110 TYR 110 275 275 TYR TYR A . n A 1 111 GLN 111 276 276 GLN GLN A . n A 1 112 GLY 112 277 277 GLY GLY A . n A 1 113 GLU 113 278 278 GLU GLU A . n A 1 114 ARG 114 279 279 ARG ARG A . n A 1 115 VAL 115 280 280 VAL VAL A . n A 1 116 LYS 116 281 281 LYS LYS A . n A 1 117 ILE 117 282 282 ILE ILE A . n A 1 118 GLN 118 283 283 GLN GLN A . n A 1 119 GLU 119 284 284 GLU GLU A . n A 1 120 LYS 120 285 285 LYS LYS A . n A 1 121 PHE 121 286 286 PHE PHE A . n A 1 122 LYS 122 287 287 LYS LYS A . n A 1 123 ASN 123 288 288 ASN ASN A . n A 1 124 GLY 124 289 289 GLY GLY A . n A 1 125 MET 125 290 290 MET MET A . n A 1 126 LEU 126 291 291 LEU LEU A . n A 1 127 HIS 127 292 292 HIS HIS A . n A 1 128 GLY 128 293 293 GLY GLY A . n A 1 129 ASP 129 294 294 ASP ASP A . n A 1 130 LYS 130 295 295 LYS LYS A . n A 1 131 VAL 131 296 296 VAL VAL A . n A 1 132 SER 132 297 297 SER SER A . n A 1 133 PHE 133 298 298 PHE PHE A . n A 1 134 PHE 134 299 299 PHE PHE A . n A 1 135 CYS 135 300 300 CYS CYS A . n A 1 136 LYS 136 301 301 LYS LYS A . n A 1 137 ASN 137 302 302 ASN ASN A . n A 1 138 LYS 138 303 303 LYS LYS A . n A 1 139 GLU 139 304 304 GLU GLU A . n A 1 140 LYS 140 305 305 LYS LYS A . n A 1 141 LYS 141 306 306 LYS LYS A . n A 1 142 CYS 142 307 307 CYS CYS A . n A 1 143 SER 143 308 308 SER SER A . n A 1 144 TYR 144 309 309 TYR TYR A . n A 1 145 THR 145 310 310 THR THR A . n A 1 146 GLU 146 311 311 GLU GLU A . n A 1 147 ASP 147 312 312 ASP ASP A . n A 1 148 ALA 148 313 313 ALA ALA A . n A 1 149 GLN 149 314 314 GLN GLN A . n A 1 150 CYS 150 315 315 CYS CYS A . n A 1 151 ILE 151 316 316 ILE ILE A . n A 1 152 ASP 152 317 317 ASP ASP A . n A 1 153 GLY 153 318 318 GLY GLY A . n A 1 154 THR 154 319 319 THR THR A . n A 1 155 ILE 155 320 320 ILE ILE A . n A 1 156 GLU 156 321 321 GLU GLU A . n A 1 157 VAL 157 322 322 VAL VAL A . n A 1 158 PRO 158 323 323 PRO PRO A . n A 1 159 LYS 159 324 324 LYS LYS A . n A 1 160 CYS 160 325 325 CYS CYS A . n A 1 161 PHE 161 326 326 PHE PHE A . n A 1 162 LYS 162 327 327 LYS LYS A . n A 1 163 GLU 163 328 328 GLU GLU A . n A 1 164 HIS 164 329 329 HIS HIS A . n A 1 165 SER 165 330 330 SER SER A . n A 1 166 SER 166 331 331 SER SER A . n A 1 167 LEU 167 332 332 LEU LEU A . n A 1 168 ALA 168 333 333 ALA ALA A . n A 1 169 PHE 169 334 334 PHE PHE A . n A 1 170 TRP 170 335 335 TRP TRP A . n A 1 171 LYS 171 336 336 LYS LYS A . n A 1 172 THR 172 337 337 THR THR A . n A 1 173 ASP 173 338 338 ASP ASP A . n A 1 174 ALA 174 339 339 ALA ALA A . n A 1 175 SER 175 340 340 SER SER A . n A 1 176 ASP 176 341 341 ASP ASP A . n A 1 177 VAL 177 342 342 VAL VAL A . n A 1 178 LYS 178 343 343 LYS LYS A . n A 1 179 PRO 179 344 344 PRO PRO A . n A 1 180 CYS 180 345 345 CYS CYS A . n # loop_ _pdbx_SG_project.id _pdbx_SG_project.project_name _pdbx_SG_project.full_name_of_center _pdbx_SG_project.initial_of_center 1 PSI:Biology 'New York Structural Genomics Research Consortium' NYSGRC 2 PSI:Biology 'Atoms-to-Animals: The Immune Function Network' IFN # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 401 1 SO4 SO4 A . C 2 SO4 1 402 2 SO4 SO4 A . D 2 SO4 1 403 3 SO4 SO4 A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2013-04-24 2 'Structure model' 1 1 2017-11-15 3 'Structure model' 1 2 2023-09-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Refinement description' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' software 2 3 'Structure model' chem_comp_atom 3 3 'Structure model' chem_comp_bond 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_initial_refinement_model 6 3 'Structure model' struct_ref_seq_dif 7 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_software.name' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_struct_ref_seq_dif.details' 5 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 6 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 7 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 SCALA 3.3.20 2011/05/18 other 'Phil R. Evans' pre@mrc-lmb.cam.ac.uk 'data scaling' http://www.ccp4.ac.uk/dist/html/scala.html Fortran_77 ? 2 REFMAC . ? program 'Garib N. Murshudov' garib@ysbl.york.ac.uk refinement http://www.ccp4.ac.uk/dist/html/refmac5.html Fortran_77 ? 3 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 4 MAR345 . ? ? ? ? 'data collection' ? ? ? 5 MOSFLM . ? ? ? ? 'data reduction' ? ? ? 6 MOLREP . ? ? ? ? phasing ? ? ? 7 Coot . ? ? ? ? 'model building' ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 226 ? ? 164.24 142.69 2 1 LYS A 227 ? ? 62.17 -8.04 3 1 SER A 255 ? ? -58.38 -6.65 4 1 ALA A 256 ? ? 179.10 178.41 5 1 MET A 257 ? ? -153.47 86.61 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 227 ? CG ? A LYS 62 CG 2 1 Y 1 A LYS 227 ? CD ? A LYS 62 CD 3 1 Y 1 A LYS 227 ? CE ? A LYS 62 CE 4 1 Y 1 A LYS 227 ? NZ ? A LYS 62 NZ 5 1 Y 1 A LYS 250 ? CG ? A LYS 85 CG 6 1 Y 1 A LYS 250 ? CD ? A LYS 85 CD 7 1 Y 1 A LYS 250 ? CE ? A LYS 85 CE 8 1 Y 1 A LYS 250 ? NZ ? A LYS 85 NZ 9 1 Y 1 A LEU 251 ? CG ? A LEU 86 CG 10 1 Y 1 A LEU 251 ? CD1 ? A LEU 86 CD1 11 1 Y 1 A LEU 251 ? CD2 ? A LEU 86 CD2 12 1 Y 1 A GLU 304 ? CG ? A GLU 139 CG 13 1 Y 1 A GLU 304 ? CD ? A GLU 139 CD 14 1 Y 1 A GLU 304 ? OE1 ? A GLU 139 OE1 15 1 Y 1 A GLU 304 ? OE2 ? A GLU 139 OE2 16 1 Y 1 A LYS 306 ? CG ? A LYS 141 CG 17 1 Y 1 A LYS 306 ? CD ? A LYS 141 CD 18 1 Y 1 A LYS 306 ? CE ? A LYS 141 CE 19 1 Y 1 A LYS 306 ? NZ ? A LYS 141 NZ # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLN 166 ? A GLN 1 2 1 Y 1 A ASP 167 ? A ASP 2 3 1 Y 1 A TYR 168 ? A TYR 3 4 1 Y 1 A LYS 169 ? A LYS 4 5 1 Y 1 A ASP 170 ? A ASP 5 6 1 Y 1 A ASP 171 ? A ASP 6 7 1 Y 1 A ASP 172 ? A ASP 7 8 1 Y 1 A ASP 173 ? A ASP 8 9 1 Y 1 A LYS 174 ? A LYS 9 10 1 Y 1 A HIS 175 ? A HIS 10 11 1 Y 1 A HIS 176 ? A HIS 11 12 1 Y 1 A HIS 177 ? A HIS 12 13 1 Y 1 A HIS 178 ? A HIS 13 14 1 Y 1 A HIS 179 ? A HIS 14 15 1 Y 1 A HIS 180 ? A HIS 15 16 1 Y 1 A HIS 181 ? A HIS 16 17 1 Y 1 A HIS 182 ? A HIS 17 18 1 Y 1 A HIS 183 ? A HIS 18 19 1 Y 1 A HIS 184 ? A HIS 19 20 1 Y 1 A GLU 185 ? A GLU 20 21 1 Y 1 A ASN 186 ? A ASN 21 22 1 Y 1 A LEU 187 ? A LEU 22 23 1 Y 1 A TYR 188 ? A TYR 23 24 1 Y 1 A PHE 189 ? A PHE 24 25 1 Y 1 A GLN 190 ? A GLN 25 26 1 Y 1 A SER 191 ? A SER 26 27 1 Y 1 A HIS 192 ? A HIS 27 28 1 Y 1 A VAL 193 ? A VAL 28 29 1 Y 1 A LEU 194 ? A LEU 29 30 1 Y 1 A PHE 195 ? A PHE 30 31 1 Y 1 A ILE 196 ? A ILE 31 32 1 Y 1 A PHE 197 ? A PHE 32 33 1 Y 1 A PRO 198 ? A PRO 33 34 1 Y 1 A ARG 199 ? A ARG 34 35 1 Y 1 A THR 200 ? A THR 35 36 1 Y 1 A SER 201 ? A SER 36 37 1 Y 1 A GLY 202 ? A GLY 37 38 1 Y 1 A VAL 203 ? A VAL 38 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 SO4 S S N N 301 SO4 O1 O N N 302 SO4 O2 O N N 303 SO4 O3 O N N 304 SO4 O4 O N N 305 THR N N N N 306 THR CA C N S 307 THR C C N N 308 THR O O N N 309 THR CB C N R 310 THR OG1 O N N 311 THR CG2 C N N 312 THR OXT O N N 313 THR H H N N 314 THR H2 H N N 315 THR HA H N N 316 THR HB H N N 317 THR HG1 H N N 318 THR HG21 H N N 319 THR HG22 H N N 320 THR HG23 H N N 321 THR HXT H N N 322 TRP N N N N 323 TRP CA C N S 324 TRP C C N N 325 TRP O O N N 326 TRP CB C N N 327 TRP CG C Y N 328 TRP CD1 C Y N 329 TRP CD2 C Y N 330 TRP NE1 N Y N 331 TRP CE2 C Y N 332 TRP CE3 C Y N 333 TRP CZ2 C Y N 334 TRP CZ3 C Y N 335 TRP CH2 C Y N 336 TRP OXT O N N 337 TRP H H N N 338 TRP H2 H N N 339 TRP HA H N N 340 TRP HB2 H N N 341 TRP HB3 H N N 342 TRP HD1 H N N 343 TRP HE1 H N N 344 TRP HE3 H N N 345 TRP HZ2 H N N 346 TRP HZ3 H N N 347 TRP HH2 H N N 348 TRP HXT H N N 349 TYR N N N N 350 TYR CA C N S 351 TYR C C N N 352 TYR O O N N 353 TYR CB C N N 354 TYR CG C Y N 355 TYR CD1 C Y N 356 TYR CD2 C Y N 357 TYR CE1 C Y N 358 TYR CE2 C Y N 359 TYR CZ C Y N 360 TYR OH O N N 361 TYR OXT O N N 362 TYR H H N N 363 TYR H2 H N N 364 TYR HA H N N 365 TYR HB2 H N N 366 TYR HB3 H N N 367 TYR HD1 H N N 368 TYR HD2 H N N 369 TYR HE1 H N N 370 TYR HE2 H N N 371 TYR HH H N N 372 TYR HXT H N N 373 VAL N N N N 374 VAL CA C N S 375 VAL C C N N 376 VAL O O N N 377 VAL CB C N N 378 VAL CG1 C N N 379 VAL CG2 C N N 380 VAL OXT O N N 381 VAL H H N N 382 VAL H2 H N N 383 VAL HA H N N 384 VAL HB H N N 385 VAL HG11 H N N 386 VAL HG12 H N N 387 VAL HG13 H N N 388 VAL HG21 H N N 389 VAL HG22 H N N 390 VAL HG23 H N N 391 VAL HXT H N N 392 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 SO4 S O1 doub N N 288 SO4 S O2 doub N N 289 SO4 S O3 sing N N 290 SO4 S O4 sing N N 291 THR N CA sing N N 292 THR N H sing N N 293 THR N H2 sing N N 294 THR CA C sing N N 295 THR CA CB sing N N 296 THR CA HA sing N N 297 THR C O doub N N 298 THR C OXT sing N N 299 THR CB OG1 sing N N 300 THR CB CG2 sing N N 301 THR CB HB sing N N 302 THR OG1 HG1 sing N N 303 THR CG2 HG21 sing N N 304 THR CG2 HG22 sing N N 305 THR CG2 HG23 sing N N 306 THR OXT HXT sing N N 307 TRP N CA sing N N 308 TRP N H sing N N 309 TRP N H2 sing N N 310 TRP CA C sing N N 311 TRP CA CB sing N N 312 TRP CA HA sing N N 313 TRP C O doub N N 314 TRP C OXT sing N N 315 TRP CB CG sing N N 316 TRP CB HB2 sing N N 317 TRP CB HB3 sing N N 318 TRP CG CD1 doub Y N 319 TRP CG CD2 sing Y N 320 TRP CD1 NE1 sing Y N 321 TRP CD1 HD1 sing N N 322 TRP CD2 CE2 doub Y N 323 TRP CD2 CE3 sing Y N 324 TRP NE1 CE2 sing Y N 325 TRP NE1 HE1 sing N N 326 TRP CE2 CZ2 sing Y N 327 TRP CE3 CZ3 doub Y N 328 TRP CE3 HE3 sing N N 329 TRP CZ2 CH2 doub Y N 330 TRP CZ2 HZ2 sing N N 331 TRP CZ3 CH2 sing Y N 332 TRP CZ3 HZ3 sing N N 333 TRP CH2 HH2 sing N N 334 TRP OXT HXT sing N N 335 TYR N CA sing N N 336 TYR N H sing N N 337 TYR N H2 sing N N 338 TYR CA C sing N N 339 TYR CA CB sing N N 340 TYR CA HA sing N N 341 TYR C O doub N N 342 TYR C OXT sing N N 343 TYR CB CG sing N N 344 TYR CB HB2 sing N N 345 TYR CB HB3 sing N N 346 TYR CG CD1 doub Y N 347 TYR CG CD2 sing Y N 348 TYR CD1 CE1 sing Y N 349 TYR CD1 HD1 sing N N 350 TYR CD2 CE2 doub Y N 351 TYR CD2 HD2 sing N N 352 TYR CE1 CZ doub Y N 353 TYR CE1 HE1 sing N N 354 TYR CE2 CZ sing Y N 355 TYR CE2 HE2 sing N N 356 TYR CZ OH sing N N 357 TYR OH HH sing N N 358 TYR OXT HXT sing N N 359 VAL N CA sing N N 360 VAL N H sing N N 361 VAL N H2 sing N N 362 VAL CA C sing N N 363 VAL CA CB sing N N 364 VAL CA HA sing N N 365 VAL C O doub N N 366 VAL C OXT sing N N 367 VAL CB CG1 sing N N 368 VAL CB CG2 sing N N 369 VAL CB HB sing N N 370 VAL CG1 HG11 sing N N 371 VAL CG1 HG12 sing N N 372 VAL CG1 HG13 sing N N 373 VAL CG2 HG21 sing N N 374 VAL CG2 HG22 sing N N 375 VAL CG2 HG23 sing N N 376 VAL OXT HXT sing N N 377 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'SULFATE ION' _pdbx_entity_nonpoly.comp_id SO4 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1C1Z _pdbx_initial_refinement_model.details ? #