data_4NEZ # _entry.id 4NEZ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4NEZ RCSB RCSB083118 WWPDB D_1000083118 # _pdbx_database_related.db_name TargetTrack _pdbx_database_related.db_id NESG-OR276 _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 4NEZ _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-10-30 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry Y _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Guan, R.' 1 'Lin, Y.-R.' 2 'Koga, N.' 3 'Koga, R.' 4 'Castellanos, J.' 5 'Seetharaman, J.' 6 'Maglaqui, M.' 7 'Sahdev, S.' 8 'Mao, L.' 9 'Xiao, R.' 10 'Everett, J.K.' 11 'Baker, D.' 12 'Montelione, G.T.' 13 'Northeast Structural Genomics Consortium (NESG)' 14 # _citation.id primary _citation.title 'Northeast Structural Genomics Consortium Target OR276' _citation.journal_abbrev 'To be published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Guan, R.' 1 primary 'Lin, Y.-R.' 2 primary 'Koga, N.' 3 primary 'Koga, R.' 4 primary 'Castellanos, J.' 5 primary 'Seetharaman, J.' 6 primary 'Maglaqui, M.' 7 primary 'Sahdev, S.' 8 primary 'Mao, L.' 9 primary 'Xiao, R.' 10 primary 'Everett, J.K.' 11 primary 'Baker, D.' 12 primary 'Montelione, G.T.' 13 primary 'Northeast Structural Genomics Consortium (NESG)' 14 # _cell.entry_id 4NEZ _cell.length_a 51.834 _cell.length_b 71.073 _cell.length_c 109.850 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4NEZ _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer syn 'Engineered protein OR276' 20369.045 1 ? ? ? ? 2 non-polymer syn 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 122.143 1 ? ? ? ? 3 non-polymer syn tetrabutylphosphonium 259.431 1 ? ? ? ? 4 water nat water 18.015 20 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)GE(MSE)(MSE)IIFEGDDLEALEKALKE(MSE)IRQARKFAGTVEYWLSGNRL(MSE)IRITGVPEQVRKELAK EAERLKAEFNIQVEYQIRGSGSGSGE(MSE)(MSE)IIFEGDDLEALEKALKE(MSE)IRQARKFAGTVEYWLSGNRL (MSE)IRITGVPEQVRKELAKEAERLKAEFNIQVEYQIRTGSLEHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MGEMMIIFEGDDLEALEKALKEMIRQARKFAGTVEYWLSGNRLMIRITGVPEQVRKELAKEAERLKAEFNIQVEYQIRGS GSGSGEMMIIFEGDDLEALEKALKEMIRQARKFAGTVEYWLSGNRLMIRITGVPEQVRKELAKEAERLKAEFNIQVEYQI RTGSLEHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NESG-OR276 # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLY n 1 3 GLU n 1 4 MSE n 1 5 MSE n 1 6 ILE n 1 7 ILE n 1 8 PHE n 1 9 GLU n 1 10 GLY n 1 11 ASP n 1 12 ASP n 1 13 LEU n 1 14 GLU n 1 15 ALA n 1 16 LEU n 1 17 GLU n 1 18 LYS n 1 19 ALA n 1 20 LEU n 1 21 LYS n 1 22 GLU n 1 23 MSE n 1 24 ILE n 1 25 ARG n 1 26 GLN n 1 27 ALA n 1 28 ARG n 1 29 LYS n 1 30 PHE n 1 31 ALA n 1 32 GLY n 1 33 THR n 1 34 VAL n 1 35 GLU n 1 36 TYR n 1 37 TRP n 1 38 LEU n 1 39 SER n 1 40 GLY n 1 41 ASN n 1 42 ARG n 1 43 LEU n 1 44 MSE n 1 45 ILE n 1 46 ARG n 1 47 ILE n 1 48 THR n 1 49 GLY n 1 50 VAL n 1 51 PRO n 1 52 GLU n 1 53 GLN n 1 54 VAL n 1 55 ARG n 1 56 LYS n 1 57 GLU n 1 58 LEU n 1 59 ALA n 1 60 LYS n 1 61 GLU n 1 62 ALA n 1 63 GLU n 1 64 ARG n 1 65 LEU n 1 66 LYS n 1 67 ALA n 1 68 GLU n 1 69 PHE n 1 70 ASN n 1 71 ILE n 1 72 GLN n 1 73 VAL n 1 74 GLU n 1 75 TYR n 1 76 GLN n 1 77 ILE n 1 78 ARG n 1 79 GLY n 1 80 SER n 1 81 GLY n 1 82 SER n 1 83 GLY n 1 84 SER n 1 85 GLY n 1 86 GLU n 1 87 MSE n 1 88 MSE n 1 89 ILE n 1 90 ILE n 1 91 PHE n 1 92 GLU n 1 93 GLY n 1 94 ASP n 1 95 ASP n 1 96 LEU n 1 97 GLU n 1 98 ALA n 1 99 LEU n 1 100 GLU n 1 101 LYS n 1 102 ALA n 1 103 LEU n 1 104 LYS n 1 105 GLU n 1 106 MSE n 1 107 ILE n 1 108 ARG n 1 109 GLN n 1 110 ALA n 1 111 ARG n 1 112 LYS n 1 113 PHE n 1 114 ALA n 1 115 GLY n 1 116 THR n 1 117 VAL n 1 118 GLU n 1 119 TYR n 1 120 TRP n 1 121 LEU n 1 122 SER n 1 123 GLY n 1 124 ASN n 1 125 ARG n 1 126 LEU n 1 127 MSE n 1 128 ILE n 1 129 ARG n 1 130 ILE n 1 131 THR n 1 132 GLY n 1 133 VAL n 1 134 PRO n 1 135 GLU n 1 136 GLN n 1 137 VAL n 1 138 ARG n 1 139 LYS n 1 140 GLU n 1 141 LEU n 1 142 ALA n 1 143 LYS n 1 144 GLU n 1 145 ALA n 1 146 GLU n 1 147 ARG n 1 148 LEU n 1 149 LYS n 1 150 ALA n 1 151 GLU n 1 152 PHE n 1 153 ASN n 1 154 ILE n 1 155 GLN n 1 156 VAL n 1 157 GLU n 1 158 TYR n 1 159 GLN n 1 160 ILE n 1 161 ARG n 1 162 THR n 1 163 GLY n 1 164 SER n 1 165 LEU n 1 166 GLU n 1 167 HIS n 1 168 HIS n 1 169 HIS n 1 170 HIS n 1 171 HIS n 1 172 HIS n # _pdbx_entity_src_syn.entity_id 1 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'artificial gene' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 32630 _pdbx_entity_src_syn.details 'This is a designed protein.' # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 4NEZ _struct_ref.pdbx_db_accession 4NEZ _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4NEZ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 172 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 4NEZ _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 172 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 172 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 4NE non-polymer . tetrabutylphosphonium ? 'C16 H36 P 1' 259.431 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TRS non-polymer . 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL 'TRIS BUFFER' 'C4 H12 N O3 1' 122.143 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4NEZ _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.48 _exptl_crystal.density_percent_sol 50.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.4 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;Protein solution - 100mM NaCl, 5mM DTT, 0.02% NaN3, 10mM Tris-HCl (pH 7.5), Reservoir solution - 25% PEG 3350, 0.1 M Hepes pH 7.4, 5% w/v Tetrabutylphosphonium bromide, VAPOR DIFFUSION, HANGING DROP, temperature 277K ; # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.pdbx_collection_date 2013-05-28 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'Si 111 CHANNEL' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97924 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'NSLS BEAMLINE X4C' _diffrn_source.pdbx_synchrotron_site NSLS _diffrn_source.pdbx_synchrotron_beamline X4C _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.97924 # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4NEZ _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F 2.0 _reflns.d_resolution_low 50 _reflns.d_resolution_high 2.39 _reflns.number_obs 8240 _reflns.number_all 8323 _reflns.percent_possible_obs 99.0 _reflns.pdbx_Rmerge_I_obs 0.076 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 64.930 _reflns.pdbx_redundancy 13.9 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.39 _reflns_shell.d_res_low 2.48 _reflns_shell.percent_possible_all 96.9 _reflns_shell.Rmerge_I_obs 0.516 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy 9.9 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4NEZ _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 8106 _refine.ls_number_reflns_all 8219 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.566 _refine.ls_d_res_high 2.395 _refine.ls_percent_reflns_obs 97.80 _refine.ls_R_factor_obs 0.2209 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2184 _refine.ls_R_factor_R_free 0.2428 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.05 _refine.ls_number_reflns_R_free 815 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min 0.46 _refine.occupancy_max 1.00 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean 94.992 _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.29 _refine.pdbx_overall_phase_error 28.90 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1294 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.number_atoms_solvent 20 _refine_hist.number_atoms_total 1339 _refine_hist.d_res_high 2.395 _refine_hist.d_res_low 27.566 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.002 ? ? 1332 'X-RAY DIFFRACTION' ? f_angle_d 0.487 ? ? 1773 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 11.586 ? ? 536 'X-RAY DIFFRACTION' ? f_chiral_restr 0.041 ? ? 187 'X-RAY DIFFRACTION' ? f_plane_restr 0.001 ? ? 227 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.3953 2.5453 1161 0.3428 96.00 0.3703 . . 130 . . . . 'X-RAY DIFFRACTION' . 2.5453 2.7417 1213 0.3189 97.00 0.3482 . . 133 . . . . 'X-RAY DIFFRACTION' . 2.7417 3.0173 1182 0.2971 98.00 0.2915 . . 134 . . . . 'X-RAY DIFFRACTION' . 3.0173 3.4531 1232 0.2482 99.00 0.2517 . . 139 . . . . 'X-RAY DIFFRACTION' . 3.4531 4.3478 1244 0.2023 99.00 0.2752 . . 139 . . . . 'X-RAY DIFFRACTION' . 4.3478 27.5678 1259 0.1820 96.00 0.1884 . . 140 . . . . # _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.entry_id 4NEZ _pdbx_refine.R_factor_all_no_cutoff ? _pdbx_refine.R_factor_obs_no_cutoff ? _pdbx_refine.free_R_factor_no_cutoff ? _pdbx_refine.free_R_error_no_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff ? _pdbx_refine.free_R_val_test_set_ct_no_cutoff ? _pdbx_refine.R_factor_all_4sig_cutoff ? _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff ? # _struct.entry_id 4NEZ _struct.title 'Crystal Structure of an engineered protein with ferredoxin fold, Northeast Structural Genomics Consortium (NESG) Target OR276' _struct.pdbx_descriptor 'Engineered protein OR276' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4NEZ _struct_keywords.text ;protein engineering, ferredoxin fold, structural Genomics, PSI-Biology, Protein Structure Initiative, Northeast Structural Genomics Consortium, NESG, DE NOVO PROTEIN ; _struct_keywords.pdbx_keywords 'DE NOVO PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details 'dimer,38.91 kD,97.8%' # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 12 ? PHE A 30 ? ASP A 12 PHE A 30 1 ? 19 HELX_P HELX_P2 2 PRO A 51 ? ASN A 70 ? PRO A 51 ASN A 70 1 ? 20 HELX_P HELX_P3 3 ASP A 95 ? PHE A 113 ? ASP A 95 PHE A 113 1 ? 19 HELX_P HELX_P4 4 PRO A 134 ? PHE A 152 ? PRO A 134 PHE A 152 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A GLU 3 C ? ? ? 1_555 A MSE 4 N ? ? A GLU 3 A MSE 4 1_555 ? ? ? ? ? ? ? 1.330 ? covale2 covale ? ? A MSE 4 C ? ? ? 1_555 A MSE 5 N ? ? A MSE 4 A MSE 5 1_555 ? ? ? ? ? ? ? 1.328 ? covale3 covale ? ? A MSE 5 C ? ? ? 1_555 A ILE 6 N ? ? A MSE 5 A ILE 6 1_555 ? ? ? ? ? ? ? 1.330 ? covale4 covale ? ? A GLU 22 C ? ? ? 1_555 A MSE 23 N ? ? A GLU 22 A MSE 23 1_555 ? ? ? ? ? ? ? 1.331 ? covale5 covale ? ? A MSE 23 C ? ? ? 1_555 A ILE 24 N ? ? A MSE 23 A ILE 24 1_555 ? ? ? ? ? ? ? 1.329 ? covale6 covale ? ? A LEU 43 C ? ? ? 1_555 A MSE 44 N ? ? A LEU 43 A MSE 44 1_555 ? ? ? ? ? ? ? 1.329 ? covale7 covale ? ? A MSE 44 C ? ? ? 1_555 A ILE 45 N ? ? A MSE 44 A ILE 45 1_555 ? ? ? ? ? ? ? 1.329 ? covale8 covale ? ? A GLU 86 C ? ? ? 1_555 A MSE 87 N ? ? A GLU 86 A MSE 87 1_555 ? ? ? ? ? ? ? 1.329 ? covale9 covale ? ? A MSE 87 C ? ? ? 1_555 A MSE 88 N ? ? A MSE 87 A MSE 88 1_555 ? ? ? ? ? ? ? 1.330 ? covale10 covale ? ? A MSE 88 C ? ? ? 1_555 A ILE 89 N ? ? A MSE 88 A ILE 89 1_555 ? ? ? ? ? ? ? 1.329 ? covale11 covale ? ? A GLU 105 C ? ? ? 1_555 A MSE 106 N ? ? A GLU 105 A MSE 106 1_555 ? ? ? ? ? ? ? 1.331 ? covale12 covale ? ? A MSE 106 C ? ? ? 1_555 A ILE 107 N ? ? A MSE 106 A ILE 107 1_555 ? ? ? ? ? ? ? 1.330 ? covale13 covale ? ? A LEU 126 C ? ? ? 1_555 A MSE 127 N ? ? A LEU 126 A MSE 127 1_555 ? ? ? ? ? ? ? 1.329 ? covale14 covale ? ? A MSE 127 C ? ? ? 1_555 A ILE 128 N ? ? A MSE 127 A ILE 128 1_555 ? ? ? ? ? ? ? 1.330 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 GLY 81 A . ? GLY 81 A SER 82 A ? SER 82 A 1 0.11 2 GLY 83 A . ? GLY 83 A SER 84 A ? SER 84 A 1 -0.49 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 33 ? SER A 39 ? THR A 33 SER A 39 A 2 ARG A 42 ? THR A 48 ? ARG A 42 THR A 48 A 3 GLU A 3 ? GLU A 9 ? GLU A 3 GLU A 9 A 4 GLN A 72 ? ARG A 78 ? GLN A 72 ARG A 78 B 1 THR A 116 ? SER A 122 ? THR A 116 SER A 122 B 2 ARG A 125 ? THR A 131 ? ARG A 125 THR A 131 B 3 GLU A 86 ? GLU A 92 ? GLU A 86 GLU A 92 B 4 GLN A 155 ? ARG A 161 ? GLN A 155 ARG A 161 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N GLU A 35 ? N GLU A 35 O ARG A 46 ? O ARG A 46 A 2 3 O ILE A 45 ? O ILE A 45 N ILE A 6 ? N ILE A 6 A 3 4 N ILE A 7 ? N ILE A 7 O GLU A 74 ? O GLU A 74 B 1 2 N GLU A 118 ? N GLU A 118 O ARG A 129 ? O ARG A 129 B 2 3 O ILE A 130 ? O ILE A 130 N MSE A 87 ? N MSE A 87 B 3 4 N ILE A 90 ? N ILE A 90 O GLU A 157 ? O GLU A 157 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 6 'BINDING SITE FOR RESIDUE TRS A 201' AC2 Software ? ? ? ? 7 'BINDING SITE FOR RESIDUE 4NE A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 6 GLU A 92 ? GLU A 92 . ? 3_555 ? 2 AC1 6 GLU A 92 ? GLU A 92 . ? 1_555 ? 3 AC1 6 GLU A 157 ? GLU A 157 . ? 1_555 ? 4 AC1 6 GLU A 157 ? GLU A 157 . ? 3_555 ? 5 AC1 6 HOH D . ? HOH A 320 . ? 3_555 ? 6 AC1 6 HOH D . ? HOH A 320 . ? 1_555 ? 7 AC2 7 TRP A 37 ? TRP A 37 . ? 3_555 ? 8 AC2 7 TRP A 37 ? TRP A 37 . ? 1_555 ? 9 AC2 7 MSE A 44 ? MSE A 44 . ? 1_555 ? 10 AC2 7 GLU A 118 ? GLU A 118 . ? 1_555 ? 11 AC2 7 GLU A 118 ? GLU A 118 . ? 3_555 ? 12 AC2 7 TRP A 120 ? TRP A 120 . ? 3_555 ? 13 AC2 7 TRP A 120 ? TRP A 120 . ? 1_555 ? # _atom_sites.entry_id 4NEZ _atom_sites.fract_transf_matrix[1][1] 0.019292 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014070 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009103 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O P SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 GLY 2 2 2 GLY GLY A . n A 1 3 GLU 3 3 3 GLU GLU A . n A 1 4 MSE 4 4 4 MSE MSE A . n A 1 5 MSE 5 5 5 MSE MSE A . n A 1 6 ILE 6 6 6 ILE ILE A . n A 1 7 ILE 7 7 7 ILE ILE A . n A 1 8 PHE 8 8 8 PHE PHE A . n A 1 9 GLU 9 9 9 GLU GLU A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 ASP 12 12 12 ASP ASP A . n A 1 13 LEU 13 13 13 LEU LEU A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 GLU 17 17 17 GLU GLU A . n A 1 18 LYS 18 18 18 LYS LYS A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 LYS 21 21 21 LYS LYS A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 MSE 23 23 23 MSE MSE A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 GLN 26 26 26 GLN GLN A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ARG 28 28 28 ARG ARG A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 PHE 30 30 30 PHE PHE A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 GLY 32 32 32 GLY GLY A . n A 1 33 THR 33 33 33 THR THR A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 GLU 35 35 35 GLU GLU A . n A 1 36 TYR 36 36 36 TYR TYR A . n A 1 37 TRP 37 37 37 TRP TRP A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 SER 39 39 39 SER SER A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 ASN 41 41 41 ASN ASN A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 MSE 44 44 44 MSE MSE A . n A 1 45 ILE 45 45 45 ILE ILE A . n A 1 46 ARG 46 46 46 ARG ARG A . n A 1 47 ILE 47 47 47 ILE ILE A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 GLY 49 49 49 GLY GLY A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 GLU 52 52 52 GLU GLU A . n A 1 53 GLN 53 53 53 GLN GLN A . n A 1 54 VAL 54 54 54 VAL VAL A . n A 1 55 ARG 55 55 55 ARG ARG A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 GLU 57 57 57 GLU GLU A . n A 1 58 LEU 58 58 58 LEU LEU A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 GLU 61 61 61 GLU GLU A . n A 1 62 ALA 62 62 62 ALA ALA A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 LEU 65 65 65 LEU LEU A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 ALA 67 67 67 ALA ALA A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 PHE 69 69 69 PHE PHE A . n A 1 70 ASN 70 70 70 ASN ASN A . n A 1 71 ILE 71 71 71 ILE ILE A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLU 74 74 74 GLU GLU A . n A 1 75 TYR 75 75 75 TYR TYR A . n A 1 76 GLN 76 76 76 GLN GLN A . n A 1 77 ILE 77 77 77 ILE ILE A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 GLY 79 79 79 GLY GLY A . n A 1 80 SER 80 80 80 SER SER A . n A 1 81 GLY 81 81 81 GLY GLY A . n A 1 82 SER 82 82 82 SER SER A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 SER 84 84 84 SER SER A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 MSE 87 87 87 MSE MSE A . n A 1 88 MSE 88 88 88 MSE MSE A . n A 1 89 ILE 89 89 89 ILE ILE A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 PHE 91 91 91 PHE PHE A . n A 1 92 GLU 92 92 92 GLU GLU A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 ASP 94 94 94 ASP ASP A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 LEU 96 96 96 LEU LEU A . n A 1 97 GLU 97 97 97 GLU GLU A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 LYS 101 101 101 LYS LYS A . n A 1 102 ALA 102 102 102 ALA ALA A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 LYS 104 104 104 LYS LYS A . n A 1 105 GLU 105 105 105 GLU GLU A . n A 1 106 MSE 106 106 106 MSE MSE A . n A 1 107 ILE 107 107 107 ILE ILE A . n A 1 108 ARG 108 108 108 ARG ARG A . n A 1 109 GLN 109 109 109 GLN GLN A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 LYS 112 112 112 LYS LYS A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 ALA 114 114 114 ALA ALA A . n A 1 115 GLY 115 115 115 GLY GLY A . n A 1 116 THR 116 116 116 THR THR A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 TYR 119 119 119 TYR TYR A . n A 1 120 TRP 120 120 120 TRP TRP A . n A 1 121 LEU 121 121 121 LEU LEU A . n A 1 122 SER 122 122 122 SER SER A . n A 1 123 GLY 123 123 123 GLY GLY A . n A 1 124 ASN 124 124 124 ASN ASN A . n A 1 125 ARG 125 125 125 ARG ARG A . n A 1 126 LEU 126 126 126 LEU LEU A . n A 1 127 MSE 127 127 127 MSE MSE A . n A 1 128 ILE 128 128 128 ILE ILE A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 ILE 130 130 130 ILE ILE A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 GLY 132 132 132 GLY GLY A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 GLU 135 135 135 GLU GLU A . n A 1 136 GLN 136 136 136 GLN GLN A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 LYS 139 139 139 LYS LYS A . n A 1 140 GLU 140 140 140 GLU GLU A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ALA 142 142 142 ALA ALA A . n A 1 143 LYS 143 143 143 LYS LYS A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 GLU 146 146 146 GLU GLU A . n A 1 147 ARG 147 147 147 ARG ARG A . n A 1 148 LEU 148 148 148 LEU LEU A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 ALA 150 150 150 ALA ALA A . n A 1 151 GLU 151 151 151 GLU GLU A . n A 1 152 PHE 152 152 152 PHE PHE A . n A 1 153 ASN 153 153 153 ASN ASN A . n A 1 154 ILE 154 154 154 ILE ILE A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 VAL 156 156 156 VAL VAL A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 TYR 158 158 158 TYR TYR A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 ILE 160 160 160 ILE ILE A . n A 1 161 ARG 161 161 161 ARG ARG A . n A 1 162 THR 162 162 ? ? ? A . n A 1 163 GLY 163 163 ? ? ? A . n A 1 164 SER 164 164 ? ? ? A . n A 1 165 LEU 165 165 ? ? ? A . n A 1 166 GLU 166 166 ? ? ? A . n A 1 167 HIS 167 167 ? ? ? A . n A 1 168 HIS 168 168 ? ? ? A . n A 1 169 HIS 169 169 ? ? ? A . n A 1 170 HIS 170 170 ? ? ? A . n A 1 171 HIS 171 171 ? ? ? A . n A 1 172 HIS 172 172 ? ? ? A . n # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'Northeast Structural Genomics Consortium' _pdbx_SG_project.initial_of_center NESG # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 TRS 1 201 1 TRS TRS A . C 3 4NE 1 202 1 4NE LIG A . D 4 HOH 1 301 1 HOH HOH A . D 4 HOH 2 302 2 HOH HOH A . D 4 HOH 3 303 3 HOH HOH A . D 4 HOH 4 304 4 HOH HOH A . D 4 HOH 5 305 5 HOH HOH A . D 4 HOH 6 306 6 HOH HOH A . D 4 HOH 7 307 7 HOH HOH A . D 4 HOH 8 308 8 HOH HOH A . D 4 HOH 9 309 9 HOH HOH A . D 4 HOH 10 310 10 HOH HOH A . D 4 HOH 11 311 11 HOH HOH A . D 4 HOH 12 312 12 HOH HOH A . D 4 HOH 13 313 13 HOH HOH A . D 4 HOH 14 314 14 HOH HOH A . D 4 HOH 15 315 15 HOH HOH A . D 4 HOH 16 316 16 HOH HOH A . D 4 HOH 17 317 17 HOH HOH A . D 4 HOH 18 318 18 HOH HOH A . D 4 HOH 19 319 19 HOH HOH A . D 4 HOH 20 320 20 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 4 A MSE 4 ? MET SELENOMETHIONINE 2 A MSE 5 A MSE 5 ? MET SELENOMETHIONINE 3 A MSE 23 A MSE 23 ? MET SELENOMETHIONINE 4 A MSE 44 A MSE 44 ? MET SELENOMETHIONINE 5 A MSE 87 A MSE 87 ? MET SELENOMETHIONINE 6 A MSE 88 A MSE 88 ? MET SELENOMETHIONINE 7 A MSE 106 A MSE 106 ? MET SELENOMETHIONINE 8 A MSE 127 A MSE 127 ? MET SELENOMETHIONINE # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2640 ? 1 MORE -2 ? 1 'SSA (A^2)' 16630 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_555 -x,y,-z+1/2 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 54.9250000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A TRS 201 ? B TRS . 2 1 A 4NE 202 ? C 4NE . 3 1 A HOH 301 ? D HOH . 4 1 A HOH 308 ? D HOH . 5 1 A HOH 320 ? D HOH . # _pdbx_audit_revision_history.ordinal 1 _pdbx_audit_revision_history.data_content_type 'Structure model' _pdbx_audit_revision_history.major_revision 1 _pdbx_audit_revision_history.minor_revision 0 _pdbx_audit_revision_history.revision_date 2014-01-15 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 7.7953 _pdbx_refine_tls.origin_y 40.7593 _pdbx_refine_tls.origin_z 30.5393 _pdbx_refine_tls.T[1][1] 0.2620 _pdbx_refine_tls.T[2][2] 0.4656 _pdbx_refine_tls.T[3][3] 0.5462 _pdbx_refine_tls.T[1][2] -0.0817 _pdbx_refine_tls.T[1][3] 0.0130 _pdbx_refine_tls.T[2][3] -0.0494 _pdbx_refine_tls.L[1][1] 1.5082 _pdbx_refine_tls.L[2][2] 3.5917 _pdbx_refine_tls.L[3][3] 2.9349 _pdbx_refine_tls.L[1][2] -0.6779 _pdbx_refine_tls.L[1][3] 0.1314 _pdbx_refine_tls.L[2][3] 2.2683 _pdbx_refine_tls.S[1][1] -0.2700 _pdbx_refine_tls.S[1][2] -0.0989 _pdbx_refine_tls.S[1][3] 0.1707 _pdbx_refine_tls.S[2][1] 0.4910 _pdbx_refine_tls.S[2][2] 0.5158 _pdbx_refine_tls.S[2][3] -0.8918 _pdbx_refine_tls.S[3][1] -0.3697 _pdbx_refine_tls.S[3][2] 0.4614 _pdbx_refine_tls.S[3][3] 0.3534 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details 'chain A' # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 PHENIX 1.8.2_1309 ? package 'Paul D. Adams' PDAdams@lbl.gov refinement http://www.phenix-online.org/ C++ ? 2 PDB_EXTRACT 3.100 'Jan. 22, 2010' package PDB help@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 3 MAR345dtb . ? ? ? ? 'data collection' ? ? ? 4 HKL-2000 . ? ? ? ? 'data reduction' ? ? ? 5 HKL-2000 . ? ? ? ? 'data scaling' ? ? ? 6 PHENIX 1.8.2_1309 ? ? ? ? phasing ? ? ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 84 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -123.20 _pdbx_validate_torsion.psi -111.56 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A THR 162 ? A THR 162 3 1 Y 1 A GLY 163 ? A GLY 163 4 1 Y 1 A SER 164 ? A SER 164 5 1 Y 1 A LEU 165 ? A LEU 165 6 1 Y 1 A GLU 166 ? A GLU 166 7 1 Y 1 A HIS 167 ? A HIS 167 8 1 Y 1 A HIS 168 ? A HIS 168 9 1 Y 1 A HIS 169 ? A HIS 169 10 1 Y 1 A HIS 170 ? A HIS 170 11 1 Y 1 A HIS 171 ? A HIS 171 12 1 Y 1 A HIS 172 ? A HIS 172 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 2-AMINO-2-HYDROXYMETHYL-PROPANE-1,3-DIOL TRS 3 tetrabutylphosphonium 4NE 4 water HOH #