data_4NLA # _entry.id 4NLA # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4NLA pdb_00004nla 10.2210/pdb4nla/pdb RCSB RCSB083345 ? ? WWPDB D_1000083345 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 4MYP _pdbx_database_related.details 'same protein, but with heme bound' _pdbx_database_related.content_type unspecified # _pdbx_database_status.entry_id 4NLA _pdbx_database_status.status_code REL _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.recvd_initial_deposition_date 2013-11-14 _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Malmirchegini, G.R.' 1 'Sawaya, M.R.' 2 'Clubb, R.T.' 3 # _citation.id primary _citation.title 'Novel Mechanism of Hemin Capture by Hbp2, the Hemoglobin-binding Hemophore from Listeria monocytogenes.' _citation.journal_abbrev J.Biol.Chem. _citation.journal_volume 289 _citation.page_first 34886 _citation.page_last 34899 _citation.year 2014 _citation.journal_id_ASTM JBCHA3 _citation.country US _citation.journal_id_ISSN 0021-9258 _citation.journal_id_CSD 0071 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25315777 _citation.pdbx_database_id_DOI 10.1074/jbc.M114.583013 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Malmirchegini, G.R.' 1 ? primary 'Sjodt, M.' 2 ? primary 'Shnitkind, S.' 3 ? primary 'Sawaya, M.R.' 4 ? primary 'Rosinski, J.' 5 ? primary 'Newton, S.M.' 6 ? primary 'Klebba, P.E.' 7 ? primary 'Clubb, R.T.' 8 ? # _cell.entry_id 4NLA _cell.length_a 89.300 _cell.length_b 89.300 _cell.length_c 89.300 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4NLA _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Iron-regulated surface determinant protein A' 13545.126 1 ? ? 'unp residues 183-303' ? 2 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 3 water nat water 18.015 9 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'P64 protein, Surface virulence-associated protein A' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;STLSDGIYTIPFVAKKANDDSNSSMQNYFNNPAWLKVKNGKKMVAMTVNDNKTVTALKTTLAGTLQDVKVVSEDKDANTR IVEFEVEDLNQPLAAHVNYEAPFNGSVYKGQADFRYVFDTAK ; _entity_poly.pdbx_seq_one_letter_code_can ;STLSDGIYTIPFVAKKANDDSNSSMQNYFNNPAWLKVKNGKKMVAMTVNDNKTVTALKTTLAGTLQDVKVVSEDKDANTR IVEFEVEDLNQPLAAHVNYEAPFNGSVYKGQADFRYVFDTAK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 THR n 1 3 LEU n 1 4 SER n 1 5 ASP n 1 6 GLY n 1 7 ILE n 1 8 TYR n 1 9 THR n 1 10 ILE n 1 11 PRO n 1 12 PHE n 1 13 VAL n 1 14 ALA n 1 15 LYS n 1 16 LYS n 1 17 ALA n 1 18 ASN n 1 19 ASP n 1 20 ASP n 1 21 SER n 1 22 ASN n 1 23 SER n 1 24 SER n 1 25 MET n 1 26 GLN n 1 27 ASN n 1 28 TYR n 1 29 PHE n 1 30 ASN n 1 31 ASN n 1 32 PRO n 1 33 ALA n 1 34 TRP n 1 35 LEU n 1 36 LYS n 1 37 VAL n 1 38 LYS n 1 39 ASN n 1 40 GLY n 1 41 LYS n 1 42 LYS n 1 43 MET n 1 44 VAL n 1 45 ALA n 1 46 MET n 1 47 THR n 1 48 VAL n 1 49 ASN n 1 50 ASP n 1 51 ASN n 1 52 LYS n 1 53 THR n 1 54 VAL n 1 55 THR n 1 56 ALA n 1 57 LEU n 1 58 LYS n 1 59 THR n 1 60 THR n 1 61 LEU n 1 62 ALA n 1 63 GLY n 1 64 THR n 1 65 LEU n 1 66 GLN n 1 67 ASP n 1 68 VAL n 1 69 LYS n 1 70 VAL n 1 71 VAL n 1 72 SER n 1 73 GLU n 1 74 ASP n 1 75 LYS n 1 76 ASP n 1 77 ALA n 1 78 ASN n 1 79 THR n 1 80 ARG n 1 81 ILE n 1 82 VAL n 1 83 GLU n 1 84 PHE n 1 85 GLU n 1 86 VAL n 1 87 GLU n 1 88 ASP n 1 89 LEU n 1 90 ASN n 1 91 GLN n 1 92 PRO n 1 93 LEU n 1 94 ALA n 1 95 ALA n 1 96 HIS n 1 97 VAL n 1 98 ASN n 1 99 TYR n 1 100 GLU n 1 101 ALA n 1 102 PRO n 1 103 PHE n 1 104 ASN n 1 105 GLY n 1 106 SER n 1 107 VAL n 1 108 TYR n 1 109 LYS n 1 110 GLY n 1 111 GLN n 1 112 ALA n 1 113 ASP n 1 114 PHE n 1 115 ARG n 1 116 TYR n 1 117 VAL n 1 118 PHE n 1 119 ASP n 1 120 THR n 1 121 ALA n 1 122 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BN418_2635, lmo2185, M639_06195' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain EGD-e _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Listeria monocytogenes' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1639 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pHIS-SUMO _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q9KGV9_LISMN _struct_ref.pdbx_db_accession Q9KGV9 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;TLSDGIYTIPFVAKKANDDSNSSMQNYFNNPAWLKVKNGKKMVAMTVNDNKTVTALKTTLAGTLQDVKVVSEDKDANTRI VEFEVEDLNQPLAAHVNYEAPFNGSVYKGQADFRYVFDTAK ; _struct_ref.pdbx_align_begin 183 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4NLA _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 122 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9KGV9 _struct_ref_seq.db_align_beg 183 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 303 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 183 _struct_ref_seq.pdbx_auth_seq_align_end 303 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4NLA _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9KGV9 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 182 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4NLA _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.19 _exptl_crystal.density_percent_sol 43.85 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 5.4 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details ;100 mM sodium citrate tribasic dihydrate, 200 mM potassium sodium tartrate tetrahydrate, 2.0 M ammonium sulfate, pH 5.4, vapor diffusion, temperature 298K, EVAPORATION ; # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2013-06-06 _diffrn_detector.details 'MIRRORS. BENT CYLINDERS, STRIPES OF PT, RH AND CLEAR.' # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'SI 111' _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.97950 1.0 2 0.9686 1.0 3 1.5418 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 24-ID-C' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 24-ID-C _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list '0.97950, 0.9686, 1.5418' # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4NLA _reflns.observed_criterion_sigma_I -3.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 63.140 _reflns.d_resolution_high 2.700 _reflns.number_obs 3370 _reflns.number_all ? _reflns.percent_possible_obs 100.0 _reflns.pdbx_Rmerge_I_obs 0.05200 _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI 35.3000 _reflns.B_iso_Wilson_estimate 109.36 _reflns.pdbx_redundancy 21.400 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_ordinal 1 _reflns_shell.d_res_high 2.70 _reflns_shell.d_res_low 2.85 _reflns_shell.percent_possible_all 100.0 _reflns_shell.Rmerge_I_obs 0.47100 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs 6.300 _reflns_shell.pdbx_redundancy 22.80 _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4NLA _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 3370 _refine.ls_number_reflns_all 5408 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 63.14 _refine.ls_d_res_high 2.70 _refine.ls_percent_reflns_obs 100.0 _refine.ls_R_factor_obs 0.258 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.254 _refine.ls_R_factor_R_free 0.293 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 10.000 _refine.ls_number_reflns_R_free 337 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min 1.000 _refine.occupancy_max 1.000 _refine.correlation_coeff_Fo_to_Fc 0.939 _refine.correlation_coeff_Fo_to_Fc_free 0.926 _refine.B_iso_mean 120.65 _refine.aniso_B[1][1] 0.00000 _refine.aniso_B[2][2] 0.00000 _refine.aniso_B[3][3] 0.00000 _refine.aniso_B[1][2] 0.00000 _refine.aniso_B[1][3] 0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 'PDB ENTRY 3SZ6' _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI 0.4570 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.entry_id 4NLA _refine_analyze.Luzzati_coordinate_error_obs 0.968 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 947 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 5 _refine_hist.number_atoms_solvent 9 _refine_hist.number_atoms_total 961 _refine_hist.d_res_high 2.70 _refine_hist.d_res_low 63.14 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function t_bond_d 0.008 ? 2.000 968 'X-RAY DIFFRACTION' HARMONIC t_angle_deg 1.02 ? 2.000 1315 'X-RAY DIFFRACTION' HARMONIC t_dihedral_angle_d ? ? 2.000 331 'X-RAY DIFFRACTION' SINUSOIDAL t_incorr_chiral_ct ? ? ? ? 'X-RAY DIFFRACTION' ? t_pseud_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_trig_c_planes ? ? 2.000 31 'X-RAY DIFFRACTION' HARMONIC t_gen_planes ? ? 5.000 136 'X-RAY DIFFRACTION' HARMONIC t_it ? ? 20.000 968 'X-RAY DIFFRACTION' HARMONIC t_nbd ? ? ? ? 'X-RAY DIFFRACTION' ? t_omega_torsion 1.790 ? ? ? 'X-RAY DIFFRACTION' ? t_other_torsion 19.660 ? ? ? 'X-RAY DIFFRACTION' ? t_improper_torsion ? ? ? ? 'X-RAY DIFFRACTION' ? t_chiral_improper_torsion ? ? 5.000 129 'X-RAY DIFFRACTION' SEMIHARMONIC t_sum_occupancies ? ? ? ? 'X-RAY DIFFRACTION' ? t_utility_distance ? ? ? ? 'X-RAY DIFFRACTION' ? t_utility_angle ? ? ? ? 'X-RAY DIFFRACTION' ? t_utility_torsion ? ? ? ? 'X-RAY DIFFRACTION' ? t_ideal_dist_contact ? ? 4.000 1000 'X-RAY DIFFRACTION' SEMIHARMONIC # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 5 _refine_ls_shell.d_res_high 2.70 _refine_ls_shell.d_res_low 3.02 _refine_ls_shell.number_reflns_R_work 837 _refine_ls_shell.R_factor_R_work 0.3553 _refine_ls_shell.percent_reflns_obs 100.0 _refine_ls_shell.R_factor_R_free 0.4147 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 9.90 _refine_ls_shell.number_reflns_R_free 92 _refine_ls_shell.number_reflns_all 929 _refine_ls_shell.R_factor_all 0.3616 _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _struct.entry_id 4NLA _struct.title 'Structure of the central NEAT domain, N2, of the listerial Hbp2 protein, apo form' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4NLA _struct_keywords.text 'Heme, NEAT domain, listeria, hemoglobin, N2, Hbp, Hbp2, HEME-BINDING PROTEIN, PROTEIN BINDING, HEME BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # _struct_biol.id 1 _struct_biol.details 'The authors state that the biological unit is not known' # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id SER _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 23 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id PHE _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 29 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id SER _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 204 _struct_conf.end_auth_comp_id PHE _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 210 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 7 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ASN _struct_mon_prot_cis.label_seq_id 31 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ASN _struct_mon_prot_cis.auth_seq_id 212 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 32 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 213 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -0.97 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 5 ? B ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 GLY A 6 ? ILE A 10 ? GLY A 187 ILE A 191 A 2 ALA A 33 ? LYS A 38 ? ALA A 214 LYS A 219 A 3 LYS A 41 ? VAL A 48 ? LYS A 222 VAL A 229 A 4 THR A 79 ? GLU A 85 ? THR A 260 GLU A 266 A 5 LYS A 69 ? ASP A 74 ? LYS A 250 ASP A 255 B 1 PHE A 12 ? LYS A 16 ? PHE A 193 LYS A 197 B 2 LYS A 109 ? PHE A 118 ? LYS A 290 PHE A 299 B 3 LEU A 93 ? GLU A 100 ? LEU A 274 GLU A 281 B 4 VAL A 54 ? LEU A 61 ? VAL A 235 LEU A 242 B 5 THR A 64 ? ASP A 67 ? THR A 245 ASP A 248 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ILE A 10 ? N ILE A 191 O ALA A 33 ? O ALA A 214 A 2 3 N TRP A 34 ? N TRP A 215 O ALA A 45 ? O ALA A 226 A 3 4 N VAL A 48 ? N VAL A 229 O ARG A 80 ? O ARG A 261 A 4 5 O ILE A 81 ? O ILE A 262 N SER A 72 ? N SER A 253 B 1 2 N LYS A 15 ? N LYS A 196 O ARG A 115 ? O ARG A 296 B 2 3 O TYR A 116 ? O TYR A 297 N LEU A 93 ? N LEU A 274 B 3 4 O ASN A 98 ? O ASN A 279 N ALA A 56 ? N ALA A 237 B 4 5 N LEU A 61 ? N LEU A 242 O THR A 64 ? O THR A 245 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id SO4 _struct_site.pdbx_auth_seq_id 401 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 3 _struct_site.details 'BINDING SITE FOR RESIDUE SO4 A 401' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 LYS A 16 ? LYS A 197 . ? 1_555 ? 2 AC1 3 SER A 23 ? SER A 204 . ? 1_555 ? 3 AC1 3 SER A 24 ? SER A 205 . ? 1_555 ? # _atom_sites.entry_id 4NLA _atom_sites.fract_transf_matrix[1][1] 0.011198 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011198 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011198 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 182 182 SER SER A . n A 1 2 THR 2 183 183 THR THR A . n A 1 3 LEU 3 184 184 LEU LEU A . n A 1 4 SER 4 185 185 SER SER A . n A 1 5 ASP 5 186 186 ASP ASP A . n A 1 6 GLY 6 187 187 GLY GLY A . n A 1 7 ILE 7 188 188 ILE ILE A . n A 1 8 TYR 8 189 189 TYR TYR A . n A 1 9 THR 9 190 190 THR THR A . n A 1 10 ILE 10 191 191 ILE ILE A . n A 1 11 PRO 11 192 192 PRO PRO A . n A 1 12 PHE 12 193 193 PHE PHE A . n A 1 13 VAL 13 194 194 VAL VAL A . n A 1 14 ALA 14 195 195 ALA ALA A . n A 1 15 LYS 15 196 196 LYS LYS A . n A 1 16 LYS 16 197 197 LYS LYS A . n A 1 17 ALA 17 198 198 ALA ALA A . n A 1 18 ASN 18 199 199 ASN ASN A . n A 1 19 ASP 19 200 200 ASP ASP A . n A 1 20 ASP 20 201 201 ASP ASP A . n A 1 21 SER 21 202 202 SER SER A . n A 1 22 ASN 22 203 203 ASN ASN A . n A 1 23 SER 23 204 204 SER SER A . n A 1 24 SER 24 205 205 SER SER A . n A 1 25 MET 25 206 206 MET MET A . n A 1 26 GLN 26 207 207 GLN GLN A . n A 1 27 ASN 27 208 208 ASN ASN A . n A 1 28 TYR 28 209 209 TYR TYR A . n A 1 29 PHE 29 210 210 PHE PHE A . n A 1 30 ASN 30 211 211 ASN ASN A . n A 1 31 ASN 31 212 212 ASN ASN A . n A 1 32 PRO 32 213 213 PRO PRO A . n A 1 33 ALA 33 214 214 ALA ALA A . n A 1 34 TRP 34 215 215 TRP TRP A . n A 1 35 LEU 35 216 216 LEU LEU A . n A 1 36 LYS 36 217 217 LYS LYS A . n A 1 37 VAL 37 218 218 VAL VAL A . n A 1 38 LYS 38 219 219 LYS LYS A . n A 1 39 ASN 39 220 220 ASN ASN A . n A 1 40 GLY 40 221 221 GLY GLY A . n A 1 41 LYS 41 222 222 LYS LYS A . n A 1 42 LYS 42 223 223 LYS LYS A . n A 1 43 MET 43 224 224 MET MET A . n A 1 44 VAL 44 225 225 VAL VAL A . n A 1 45 ALA 45 226 226 ALA ALA A . n A 1 46 MET 46 227 227 MET MET A . n A 1 47 THR 47 228 228 THR THR A . n A 1 48 VAL 48 229 229 VAL VAL A . n A 1 49 ASN 49 230 230 ASN ASN A . n A 1 50 ASP 50 231 231 ASP ASP A . n A 1 51 ASN 51 232 232 ASN ASN A . n A 1 52 LYS 52 233 233 LYS LYS A . n A 1 53 THR 53 234 234 THR THR A . n A 1 54 VAL 54 235 235 VAL VAL A . n A 1 55 THR 55 236 236 THR THR A . n A 1 56 ALA 56 237 237 ALA ALA A . n A 1 57 LEU 57 238 238 LEU LEU A . n A 1 58 LYS 58 239 239 LYS LYS A . n A 1 59 THR 59 240 240 THR THR A . n A 1 60 THR 60 241 241 THR THR A . n A 1 61 LEU 61 242 242 LEU LEU A . n A 1 62 ALA 62 243 243 ALA ALA A . n A 1 63 GLY 63 244 244 GLY GLY A . n A 1 64 THR 64 245 245 THR THR A . n A 1 65 LEU 65 246 246 LEU LEU A . n A 1 66 GLN 66 247 247 GLN GLN A . n A 1 67 ASP 67 248 248 ASP ASP A . n A 1 68 VAL 68 249 249 VAL VAL A . n A 1 69 LYS 69 250 250 LYS LYS A . n A 1 70 VAL 70 251 251 VAL VAL A . n A 1 71 VAL 71 252 252 VAL VAL A . n A 1 72 SER 72 253 253 SER SER A . n A 1 73 GLU 73 254 254 GLU GLU A . n A 1 74 ASP 74 255 255 ASP ASP A . n A 1 75 LYS 75 256 256 LYS LYS A . n A 1 76 ASP 76 257 257 ASP ASP A . n A 1 77 ALA 77 258 258 ALA ALA A . n A 1 78 ASN 78 259 259 ASN ASN A . n A 1 79 THR 79 260 260 THR THR A . n A 1 80 ARG 80 261 261 ARG ARG A . n A 1 81 ILE 81 262 262 ILE ILE A . n A 1 82 VAL 82 263 263 VAL VAL A . n A 1 83 GLU 83 264 264 GLU GLU A . n A 1 84 PHE 84 265 265 PHE PHE A . n A 1 85 GLU 85 266 266 GLU GLU A . n A 1 86 VAL 86 267 267 VAL VAL A . n A 1 87 GLU 87 268 268 GLU GLU A . n A 1 88 ASP 88 269 269 ASP ASP A . n A 1 89 LEU 89 270 270 LEU LEU A . n A 1 90 ASN 90 271 271 ASN ASN A . n A 1 91 GLN 91 272 272 GLN GLN A . n A 1 92 PRO 92 273 273 PRO PRO A . n A 1 93 LEU 93 274 274 LEU LEU A . n A 1 94 ALA 94 275 275 ALA ALA A . n A 1 95 ALA 95 276 276 ALA ALA A . n A 1 96 HIS 96 277 277 HIS HIS A . n A 1 97 VAL 97 278 278 VAL VAL A . n A 1 98 ASN 98 279 279 ASN ASN A . n A 1 99 TYR 99 280 280 TYR TYR A . n A 1 100 GLU 100 281 281 GLU GLU A . n A 1 101 ALA 101 282 282 ALA ALA A . n A 1 102 PRO 102 283 283 PRO PRO A . n A 1 103 PHE 103 284 284 PHE PHE A . n A 1 104 ASN 104 285 285 ASN ASN A . n A 1 105 GLY 105 286 286 GLY GLY A . n A 1 106 SER 106 287 287 SER SER A . n A 1 107 VAL 107 288 288 VAL VAL A . n A 1 108 TYR 108 289 289 TYR TYR A . n A 1 109 LYS 109 290 290 LYS LYS A . n A 1 110 GLY 110 291 291 GLY GLY A . n A 1 111 GLN 111 292 292 GLN GLN A . n A 1 112 ALA 112 293 293 ALA ALA A . n A 1 113 ASP 113 294 294 ASP ASP A . n A 1 114 PHE 114 295 295 PHE PHE A . n A 1 115 ARG 115 296 296 ARG ARG A . n A 1 116 TYR 116 297 297 TYR TYR A . n A 1 117 VAL 117 298 298 VAL VAL A . n A 1 118 PHE 118 299 299 PHE PHE A . n A 1 119 ASP 119 300 300 ASP ASP A . n A 1 120 THR 120 301 301 THR THR A . n A 1 121 ALA 121 302 302 ALA ALA A . n A 1 122 LYS 122 303 303 LYS LYS A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 401 1 SO4 SO4 A . C 3 HOH 1 501 2 HOH HOH A . C 3 HOH 2 502 3 HOH HOH A . C 3 HOH 3 503 4 HOH HOH A . C 3 HOH 4 504 5 HOH HOH A . C 3 HOH 5 505 6 HOH HOH A . C 3 HOH 6 506 7 HOH HOH A . C 3 HOH 7 507 8 HOH HOH A . C 3 HOH 8 508 9 HOH HOH A . C 3 HOH 9 509 10 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4720 ? 1 MORE -76 ? 1 'SSA (A^2)' 18090 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 5_555 z,x,y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 9_555 y,z,x 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-10-22 2 'Structure model' 1 1 2014-12-31 3 'Structure model' 1 2 2023-09-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model 5 3 'Structure model' struct_ref_seq_dif 6 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' 3 3 'Structure model' '_struct_ref_seq_dif.details' 4 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 5 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 6 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # _diffrn_reflns.diffrn_id 1 _diffrn_reflns.pdbx_d_res_high 2.690 _diffrn_reflns.pdbx_d_res_low ? _diffrn_reflns.pdbx_number_obs 6256 _diffrn_reflns.pdbx_Rmerge_I_obs 0.057 _diffrn_reflns.pdbx_Rsym_value ? _diffrn_reflns.pdbx_chi_squared ? _diffrn_reflns.av_sigmaI_over_netI ? _diffrn_reflns.pdbx_redundancy ? _diffrn_reflns.pdbx_percent_possible_obs 100.00 _diffrn_reflns.number 126252 _diffrn_reflns.pdbx_observed_criterion ? _diffrn_reflns.limit_h_max ? _diffrn_reflns.limit_h_min ? _diffrn_reflns.limit_k_max ? _diffrn_reflns.limit_k_min ? _diffrn_reflns.limit_l_max ? _diffrn_reflns.limit_l_min ? # loop_ _pdbx_diffrn_reflns_shell.diffrn_id _pdbx_diffrn_reflns_shell.d_res_high _pdbx_diffrn_reflns_shell.d_res_low _pdbx_diffrn_reflns_shell.number_obs _pdbx_diffrn_reflns_shell.rejects _pdbx_diffrn_reflns_shell.Rmerge_I_obs _pdbx_diffrn_reflns_shell.Rsym_value _pdbx_diffrn_reflns_shell.chi_squared _pdbx_diffrn_reflns_shell.redundancy _pdbx_diffrn_reflns_shell.percent_possible_obs 1 2.69 2.76 490 ? 0.723 ? ? ? 99.40 1 2.76 2.84 467 ? 0.543 ? ? ? 100.00 1 2.84 2.92 419 ? 0.416 ? ? ? 100.00 1 2.92 3.01 436 ? 0.297 ? ? ? 100.00 1 3.01 3.11 380 ? 0.193 ? ? ? 100.00 1 3.11 3.22 410 ? 0.135 ? ? ? 100.00 1 3.22 3.34 387 ? 0.104 ? ? ? 100.00 1 3.34 3.48 375 ? 0.091 ? ? ? 100.00 1 3.48 3.63 335 ? 0.072 ? ? ? 100.00 1 3.81 4.01 307 ? 0.057 ? ? ? 100.00 1 4.01 4.26 314 ? 0.053 ? ? ? 100.00 1 4.26 4.55 268 ? 0.047 ? ? ? 100.00 1 4.55 4.92 281 ? 0.046 ? ? ? 100.00 1 4.92 5.39 236 ? 0.045 ? ? ? 100.00 1 5.39 6.02 226 ? 0.048 ? ? ? 100.00 1 6.02 6.95 200 ? 0.046 ? ? ? 100.00 1 6.95 8.52 165 ? 0.042 ? ? ? 100.00 1 8.52 12.04 124 ? 0.041 ? ? ? 100.00 # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 16.3047 _pdbx_refine_tls.origin_y 37.9763 _pdbx_refine_tls.origin_z 28.8459 _pdbx_refine_tls.T[1][1] -0.2241 _pdbx_refine_tls.T[2][2] -0.2330 _pdbx_refine_tls.T[3][3] 0.0790 _pdbx_refine_tls.T[1][2] 0.0180 _pdbx_refine_tls.T[1][3] 0.0340 _pdbx_refine_tls.T[2][3] -0.2749 _pdbx_refine_tls.L[1][1] 10.7995 _pdbx_refine_tls.L[2][2] 6.9195 _pdbx_refine_tls.L[3][3] 5.4550 _pdbx_refine_tls.L[1][2] 4.8158 _pdbx_refine_tls.L[1][3] 2.1070 _pdbx_refine_tls.L[2][3] 2.8230 _pdbx_refine_tls.S[1][1] 0.1176 _pdbx_refine_tls.S[1][2] -0.1677 _pdbx_refine_tls.S[1][3] 1.0885 _pdbx_refine_tls.S[2][1] 0.6502 _pdbx_refine_tls.S[2][2] -0.7062 _pdbx_refine_tls.S[2][3] 1.0200 _pdbx_refine_tls.S[3][1] 0.0405 _pdbx_refine_tls.S[3][2] -0.7576 _pdbx_refine_tls.S[3][3] 0.5886 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details '{ A|* }' # loop_ _pdbx_phasing_MAD_set.id _pdbx_phasing_MAD_set.d_res_high _pdbx_phasing_MAD_set.d_res_low _pdbx_phasing_MAD_set.reflns_acentric _pdbx_phasing_MAD_set.loc_acentric _pdbx_phasing_MAD_set.power_acentric _pdbx_phasing_MAD_set.R_cullis_acentric _pdbx_phasing_MAD_set.reflns_centric _pdbx_phasing_MAD_set.loc_centric _pdbx_phasing_MAD_set.power_centric _pdbx_phasing_MAD_set.R_cullis_centric 1 2.60 19.85 2728 15.300 0.440 0.970 401 13.400 0.570 0.920 2 2.60 19.85 2912 15.200 0.220 0.980 418 13.500 0.270 1.000 3 2.60 19.85 3245 0.300 0.000 2.040 450 0.200 0.000 1.000 4 2.60 19.85 3045 11.600 0.600 0.920 420 12.400 0.700 0.810 # loop_ _pdbx_phasing_MAD_set_shell.id _pdbx_phasing_MAD_set_shell.d_res_high _pdbx_phasing_MAD_set_shell.d_res_low _pdbx_phasing_MAD_set_shell.reflns_acentric _pdbx_phasing_MAD_set_shell.loc_acentric _pdbx_phasing_MAD_set_shell.power_acentric _pdbx_phasing_MAD_set_shell.R_cullis_acentric _pdbx_phasing_MAD_set_shell.reflns_centric _pdbx_phasing_MAD_set_shell.loc_centric _pdbx_phasing_MAD_set_shell.power_centric _pdbx_phasing_MAD_set_shell.R_cullis_centric 1 10.85 19.85 33 18.700 1.270 0.800 18 41.000 0.490 0.840 1 7.47 10.85 84 8.900 2.130 0.580 30 10.200 1.490 0.560 1 5.69 7.47 166 17.300 0.810 0.890 39 9.700 1.340 0.740 1 4.60 5.69 267 36.600 0.300 1.000 54 14.500 0.710 1.140 1 3.86 4.60 403 14.000 0.580 1.010 59 11.400 0.640 0.950 1 3.32 3.86 571 17.100 0.340 1.010 72 13.800 0.400 1.020 1 2.92 3.32 748 10.400 0.390 0.990 85 12.800 0.240 0.990 1 2.60 2.92 456 10.100 0.290 0.970 44 9.800 0.310 0.960 2 10.85 19.85 33 16.200 0.630 1.100 18 42.500 0.210 0.950 2 7.47 10.85 84 9.300 0.880 0.920 30 12.100 0.550 1.050 2 5.69 7.47 166 22.400 0.280 1.030 39 10.400 0.560 1.080 2 4.60 5.69 267 42.700 0.110 0.970 54 21.500 0.220 1.010 2 3.86 4.60 403 11.100 0.340 1.010 59 12.000 0.270 0.980 2 3.32 3.86 571 16.700 0.170 0.970 72 11.500 0.230 1.010 2 2.92 3.32 748 9.300 0.260 0.980 85 9.800 0.200 0.970 2 2.60 2.92 640 10.700 0.170 0.980 61 9.800 0.200 0.990 3 10.85 19.85 33 0.700 0.000 0.830 18 0.600 0.000 1.000 3 7.47 10.85 84 0.500 0.000 0.940 30 0.600 0.000 1.000 3 5.69 7.47 166 0.500 0.000 1.330 39 0.300 0.000 1.000 3 4.60 5.69 267 1.400 0.000 4.390 54 0.300 0.000 1.000 3 3.86 4.60 403 0.300 0.000 1.140 59 0.300 0.000 1.000 3 3.32 3.86 571 0.400 0.000 2.390 72 0.100 0.000 1.000 3 2.92 3.32 748 0.100 0.000 1.690 85 0.100 0.000 1.000 3 2.60 2.92 973 0.100 0.000 2.620 93 0.000 0.000 1.000 4 10.85 19.85 31 24.200 1.430 0.610 16 23.100 1.170 0.730 4 7.47 10.85 79 13.100 2.080 0.540 26 16.100 1.490 0.520 4 5.69 7.47 166 10.000 1.980 0.580 37 12.100 1.480 0.470 4 4.60 5.69 263 35.100 0.400 0.990 51 19.900 0.670 0.980 4 3.86 4.60 396 9.500 0.980 0.900 58 13.600 0.600 0.830 4 3.32 3.86 570 15.200 0.380 1.010 72 12.500 0.430 1.030 4 2.92 3.32 748 6.000 0.560 0.990 85 7.300 0.380 0.950 4 2.60 2.92 792 7.000 0.260 0.990 75 8.900 0.210 0.980 # loop_ _pdbx_phasing_MAD_set_site.id _pdbx_phasing_MAD_set_site.atom_type_symbol _pdbx_phasing_MAD_set_site.fract_x _pdbx_phasing_MAD_set_site.fract_y _pdbx_phasing_MAD_set_site.fract_z _pdbx_phasing_MAD_set_site.b_iso _pdbx_phasing_MAD_set_site.occupancy_iso _pdbx_phasing_MAD_set_site.occupancy 1 Sz -0.834 -0.689 -0.097 36.947 0.060 0.557 2 Sz -0.716 -0.740 -0.062 65.116 0.072 0.491 3 Sz -0.941 -0.604 -0.046 69.089 0.060 0.573 4 Sz -0.918 -0.587 -0.025 162.980 0.051 0.674 5 Sy -0.836 -0.688 -0.098 23.191 0.025 0.401 6 Sy -0.717 -0.743 -0.064 116.200 0.043 0.591 7 Sy -0.942 -0.602 -0.048 32.036 0.022 0.350 8 Sy -0.919 -0.585 -0.021 40.402 0.020 0.347 9 Sy -0.836 -0.689 -0.097 74.752 0.000 0.540 10 Sy -0.718 -0.742 -0.062 86.527 0.000 0.389 11 Sy -0.942 -0.601 -0.048 81.423 0.000 0.421 12 Sy -0.919 -0.584 -0.023 92.034 0.000 0.366 13 Se -0.836 -0.688 -0.097 78.099 0.110 0.722 14 Se -0.719 -0.742 -0.062 100.519 0.109 0.630 15 Se -0.942 -0.603 -0.047 86.901 0.077 0.586 16 Se -0.919 -0.584 -0.022 83.902 0.049 0.473 # loop_ _pdbx_phasing_MAD_shell.d_res_high _pdbx_phasing_MAD_shell.d_res_low _pdbx_phasing_MAD_shell.reflns _pdbx_phasing_MAD_shell.fom _pdbx_phasing_MAD_shell.reflns_centric _pdbx_phasing_MAD_shell.fom_centric _pdbx_phasing_MAD_shell.reflns_acentric _pdbx_phasing_MAD_shell.fom_acentric 10.85 19.85 51 0.703 18 0.466 33 0.832 7.47 10.85 114 0.846 30 0.734 84 0.886 5.69 7.47 205 0.809 39 0.705 166 0.833 4.60 5.69 321 0.457 54 0.097 267 0.530 3.86 4.60 462 0.624 59 0.460 403 0.648 3.32 3.86 643 0.409 72 0.099 571 0.449 2.92 3.32 833 0.421 85 0.201 748 0.446 2.60 2.92 1066 0.233 93 0.120 973 0.244 # _pdbx_phasing_dm.entry_id 4NLA _pdbx_phasing_dm.method 'Solvent flattening and Histogram matching' _pdbx_phasing_dm.reflns 3695 # loop_ _pdbx_phasing_dm_shell.d_res_high _pdbx_phasing_dm_shell.d_res_low _pdbx_phasing_dm_shell.delta_phi_final _pdbx_phasing_dm_shell.delta_phi_initial _pdbx_phasing_dm_shell.fom_acentric _pdbx_phasing_dm_shell.fom_centric _pdbx_phasing_dm_shell.fom _pdbx_phasing_dm_shell.reflns_acentric _pdbx_phasing_dm_shell.reflns_centric _pdbx_phasing_dm_shell.reflns 5.130 100.000 56.500 ? ? ? 0.822 ? ? 504 4.040 5.130 56.100 ? ? ? 0.836 ? ? 508 3.520 4.040 66.200 ? ? ? 0.720 ? ? 507 3.190 3.520 74.500 ? ? ? 0.753 ? ? 512 2.950 3.190 73.400 ? ? ? 0.770 ? ? 511 2.770 2.950 79.100 ? ? ? 0.709 ? ? 513 2.600 2.770 80.800 ? ? ? 0.644 ? ? 640 # _phasing.method MAD # _phasing_MAD.entry_id 4NLA _phasing_MAD.pdbx_d_res_high 2.60 _phasing_MAD.pdbx_d_res_low 19.85 _phasing_MAD.pdbx_reflns 3695 _phasing_MAD.pdbx_fom 0.432 _phasing_MAD.pdbx_reflns_centric 450 _phasing_MAD.pdbx_fom_centric 0.279 _phasing_MAD.pdbx_reflns_acentric 3245 _phasing_MAD.pdbx_fom_acentric 0.453 # loop_ _software.pdbx_ordinal _software.name _software.version _software.date _software.type _software.contact_author _software.contact_author_email _software.classification _software.location _software.language _software.citation_id 1 SCALEPACK . ? program 'Zbyszek Otwinowski' hkl@hkl-xray.com 'data scaling' http://www.hkl-xray.com/ ? ? 2 MLPHARE . ? other 'Eleanor J. Dodson' ccp4@ccp4.ac.uk phasing http://www.ccp4.ac.uk/dist/html/mlphare.html Fortran_77 ? 3 DM 6.2 ? program 'Kevin Cowtan' kowtan@ysbl.york.ac.uk phasing http://www.ccp4.ac.uk/dist/html/dm.html Fortran_77 ? 4 BUSTER-TNT . ? program 'Gerard Bricogne' buster-develop@GlobalPhasing.com refinement http://www.globalphasing.com/buster/ ? ? 5 PDB_EXTRACT 3.11 'April 22, 2011' package PDB deposit@deposit.rcsb.org 'data extraction' http://sw-tools.pdb.org/apps/PDB_EXTRACT/ C++ ? 6 XSCALE . ? ? ? ? 'data scaling' ? ? ? 7 BUSTER 2.10.0 ? ? ? ? refinement ? ? ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 THR A 183 ? ? -65.57 89.78 2 1 ASP A 201 ? ? -80.97 38.20 3 1 TYR A 289 ? ? -157.01 -23.02 4 1 ASP A 300 ? ? -88.34 -134.35 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 303 ? O ? A LYS 122 O 2 1 Y 1 A LYS 303 ? CG ? A LYS 122 CG 3 1 Y 1 A LYS 303 ? CD ? A LYS 122 CD 4 1 Y 1 A LYS 303 ? CE ? A LYS 122 CE 5 1 Y 1 A LYS 303 ? NZ ? A LYS 122 NZ # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 SO4 S S N N 290 SO4 O1 O N N 291 SO4 O2 O N N 292 SO4 O3 O N N 293 SO4 O4 O N N 294 THR N N N N 295 THR CA C N S 296 THR C C N N 297 THR O O N N 298 THR CB C N R 299 THR OG1 O N N 300 THR CG2 C N N 301 THR OXT O N N 302 THR H H N N 303 THR H2 H N N 304 THR HA H N N 305 THR HB H N N 306 THR HG1 H N N 307 THR HG21 H N N 308 THR HG22 H N N 309 THR HG23 H N N 310 THR HXT H N N 311 TRP N N N N 312 TRP CA C N S 313 TRP C C N N 314 TRP O O N N 315 TRP CB C N N 316 TRP CG C Y N 317 TRP CD1 C Y N 318 TRP CD2 C Y N 319 TRP NE1 N Y N 320 TRP CE2 C Y N 321 TRP CE3 C Y N 322 TRP CZ2 C Y N 323 TRP CZ3 C Y N 324 TRP CH2 C Y N 325 TRP OXT O N N 326 TRP H H N N 327 TRP H2 H N N 328 TRP HA H N N 329 TRP HB2 H N N 330 TRP HB3 H N N 331 TRP HD1 H N N 332 TRP HE1 H N N 333 TRP HE3 H N N 334 TRP HZ2 H N N 335 TRP HZ3 H N N 336 TRP HH2 H N N 337 TRP HXT H N N 338 TYR N N N N 339 TYR CA C N S 340 TYR C C N N 341 TYR O O N N 342 TYR CB C N N 343 TYR CG C Y N 344 TYR CD1 C Y N 345 TYR CD2 C Y N 346 TYR CE1 C Y N 347 TYR CE2 C Y N 348 TYR CZ C Y N 349 TYR OH O N N 350 TYR OXT O N N 351 TYR H H N N 352 TYR H2 H N N 353 TYR HA H N N 354 TYR HB2 H N N 355 TYR HB3 H N N 356 TYR HD1 H N N 357 TYR HD2 H N N 358 TYR HE1 H N N 359 TYR HE2 H N N 360 TYR HH H N N 361 TYR HXT H N N 362 VAL N N N N 363 VAL CA C N S 364 VAL C C N N 365 VAL O O N N 366 VAL CB C N N 367 VAL CG1 C N N 368 VAL CG2 C N N 369 VAL OXT O N N 370 VAL H H N N 371 VAL H2 H N N 372 VAL HA H N N 373 VAL HB H N N 374 VAL HG11 H N N 375 VAL HG12 H N N 376 VAL HG13 H N N 377 VAL HG21 H N N 378 VAL HG22 H N N 379 VAL HG23 H N N 380 VAL HXT H N N 381 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 SO4 S O1 doub N N 277 SO4 S O2 doub N N 278 SO4 S O3 sing N N 279 SO4 S O4 sing N N 280 THR N CA sing N N 281 THR N H sing N N 282 THR N H2 sing N N 283 THR CA C sing N N 284 THR CA CB sing N N 285 THR CA HA sing N N 286 THR C O doub N N 287 THR C OXT sing N N 288 THR CB OG1 sing N N 289 THR CB CG2 sing N N 290 THR CB HB sing N N 291 THR OG1 HG1 sing N N 292 THR CG2 HG21 sing N N 293 THR CG2 HG22 sing N N 294 THR CG2 HG23 sing N N 295 THR OXT HXT sing N N 296 TRP N CA sing N N 297 TRP N H sing N N 298 TRP N H2 sing N N 299 TRP CA C sing N N 300 TRP CA CB sing N N 301 TRP CA HA sing N N 302 TRP C O doub N N 303 TRP C OXT sing N N 304 TRP CB CG sing N N 305 TRP CB HB2 sing N N 306 TRP CB HB3 sing N N 307 TRP CG CD1 doub Y N 308 TRP CG CD2 sing Y N 309 TRP CD1 NE1 sing Y N 310 TRP CD1 HD1 sing N N 311 TRP CD2 CE2 doub Y N 312 TRP CD2 CE3 sing Y N 313 TRP NE1 CE2 sing Y N 314 TRP NE1 HE1 sing N N 315 TRP CE2 CZ2 sing Y N 316 TRP CE3 CZ3 doub Y N 317 TRP CE3 HE3 sing N N 318 TRP CZ2 CH2 doub Y N 319 TRP CZ2 HZ2 sing N N 320 TRP CZ3 CH2 sing Y N 321 TRP CZ3 HZ3 sing N N 322 TRP CH2 HH2 sing N N 323 TRP OXT HXT sing N N 324 TYR N CA sing N N 325 TYR N H sing N N 326 TYR N H2 sing N N 327 TYR CA C sing N N 328 TYR CA CB sing N N 329 TYR CA HA sing N N 330 TYR C O doub N N 331 TYR C OXT sing N N 332 TYR CB CG sing N N 333 TYR CB HB2 sing N N 334 TYR CB HB3 sing N N 335 TYR CG CD1 doub Y N 336 TYR CG CD2 sing Y N 337 TYR CD1 CE1 sing Y N 338 TYR CD1 HD1 sing N N 339 TYR CD2 CE2 doub Y N 340 TYR CD2 HD2 sing N N 341 TYR CE1 CZ doub Y N 342 TYR CE1 HE1 sing N N 343 TYR CE2 CZ sing Y N 344 TYR CE2 HE2 sing N N 345 TYR CZ OH sing N N 346 TYR OH HH sing N N 347 TYR OXT HXT sing N N 348 VAL N CA sing N N 349 VAL N H sing N N 350 VAL N H2 sing N N 351 VAL CA C sing N N 352 VAL CA CB sing N N 353 VAL CA HA sing N N 354 VAL C O doub N N 355 VAL C OXT sing N N 356 VAL CB CG1 sing N N 357 VAL CB CG2 sing N N 358 VAL CB HB sing N N 359 VAL CG1 HG11 sing N N 360 VAL CG1 HG12 sing N N 361 VAL CG1 HG13 sing N N 362 VAL CG2 HG21 sing N N 363 VAL CG2 HG22 sing N N 364 VAL CG2 HG23 sing N N 365 VAL OXT HXT sing N N 366 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3SZ6 _pdbx_initial_refinement_model.details 'PDB ENTRY 3SZ6' #