data_4OTS # _entry.id 4OTS # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4OTS RCSB RCSB084938 WWPDB D_1000084938 # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 4OTV _pdbx_database_related.details . _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4OTS _pdbx_database_status.recvd_initial_deposition_date 2014-02-14 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Stuart, D.I.' 1 'Sutton, G.C.' 2 'Axford, D.' 3 'Ji, X.' 4 # _citation.id primary _citation.title 'In cellulo structure determination of a novel cypovirus polyhedrin.' _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_volume 70 _citation.page_first 1435 _citation.page_last 1441 _citation.year 2014 _citation.journal_id_ASTM ABCRE6 _citation.country DK _citation.journal_id_ISSN 0907-4449 _citation.journal_id_CSD 0766 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 24816111 _citation.pdbx_database_id_DOI 10.1107/S1399004714004714 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Axford, D.' 1 primary 'Ji, X.' 2 primary 'Stuart, D.I.' 3 primary 'Sutton, G.' 4 # _cell.entry_id 4OTS _cell.length_a 102.794 _cell.length_b 102.794 _cell.length_c 102.794 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 24 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4OTS _symmetry.space_group_name_H-M 'I 2 3' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 197 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man Polyhedrin 28301.373 1 ? ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 1 ? ? ? ? 3 non-polymer syn "GUANOSINE-5'-TRIPHOSPHATE" 523.180 1 ? ? ? ? 4 non-polymer syn "ADENOSINE-5'-TRIPHOSPHATE" 507.181 1 ? ? ? ? 5 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 6 water nat water 18.015 241 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(ACE)ADVAGTSNRDFRGREQRLYNSEQYNYNNSLNGEVSLWVYAYYSDGSVLVRNCNSQYKVGISECFKSLKEVRVGQN NDPYDEQEVNNGVYYPNGGEPTKFHSNAKPRAIQIIFSPSVNVHTIKMAKGNSVSIPKDYLQRSHPWEATGVKYRKIHVD GEIVGYSHYFELPHEYNSISLSVSGVHKNPSSYNVAAPHNIMDVFQSCDLALKFSNRYWCELELINHYISAYAYPYLDIN NHKYGVPLNGRQ ; _entity_poly.pdbx_seq_one_letter_code_can ;XADVAGTSNRDFRGREQRLYNSEQYNYNNSLNGEVSLWVYAYYSDGSVLVRNCNSQYKVGISECFKSLKEVRVGQNNDPY DEQEVNNGVYYPNGGEPTKFHSNAKPRAIQIIFSPSVNVHTIKMAKGNSVSIPKDYLQRSHPWEATGVKYRKIHVDGEIV GYSHYFELPHEYNSISLSVSGVHKNPSSYNVAAPHNIMDVFQSCDLALKFSNRYWCELELINHYISAYAYPYLDINNHKY GVPLNGRQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ACE n 1 2 ALA n 1 3 ASP n 1 4 VAL n 1 5 ALA n 1 6 GLY n 1 7 THR n 1 8 SER n 1 9 ASN n 1 10 ARG n 1 11 ASP n 1 12 PHE n 1 13 ARG n 1 14 GLY n 1 15 ARG n 1 16 GLU n 1 17 GLN n 1 18 ARG n 1 19 LEU n 1 20 TYR n 1 21 ASN n 1 22 SER n 1 23 GLU n 1 24 GLN n 1 25 TYR n 1 26 ASN n 1 27 TYR n 1 28 ASN n 1 29 ASN n 1 30 SER n 1 31 LEU n 1 32 ASN n 1 33 GLY n 1 34 GLU n 1 35 VAL n 1 36 SER n 1 37 LEU n 1 38 TRP n 1 39 VAL n 1 40 TYR n 1 41 ALA n 1 42 TYR n 1 43 TYR n 1 44 SER n 1 45 ASP n 1 46 GLY n 1 47 SER n 1 48 VAL n 1 49 LEU n 1 50 VAL n 1 51 ARG n 1 52 ASN n 1 53 CYS n 1 54 ASN n 1 55 SER n 1 56 GLN n 1 57 TYR n 1 58 LYS n 1 59 VAL n 1 60 GLY n 1 61 ILE n 1 62 SER n 1 63 GLU n 1 64 CYS n 1 65 PHE n 1 66 LYS n 1 67 SER n 1 68 LEU n 1 69 LYS n 1 70 GLU n 1 71 VAL n 1 72 ARG n 1 73 VAL n 1 74 GLY n 1 75 GLN n 1 76 ASN n 1 77 ASN n 1 78 ASP n 1 79 PRO n 1 80 TYR n 1 81 ASP n 1 82 GLU n 1 83 GLN n 1 84 GLU n 1 85 VAL n 1 86 ASN n 1 87 ASN n 1 88 GLY n 1 89 VAL n 1 90 TYR n 1 91 TYR n 1 92 PRO n 1 93 ASN n 1 94 GLY n 1 95 GLY n 1 96 GLU n 1 97 PRO n 1 98 THR n 1 99 LYS n 1 100 PHE n 1 101 HIS n 1 102 SER n 1 103 ASN n 1 104 ALA n 1 105 LYS n 1 106 PRO n 1 107 ARG n 1 108 ALA n 1 109 ILE n 1 110 GLN n 1 111 ILE n 1 112 ILE n 1 113 PHE n 1 114 SER n 1 115 PRO n 1 116 SER n 1 117 VAL n 1 118 ASN n 1 119 VAL n 1 120 HIS n 1 121 THR n 1 122 ILE n 1 123 LYS n 1 124 MET n 1 125 ALA n 1 126 LYS n 1 127 GLY n 1 128 ASN n 1 129 SER n 1 130 VAL n 1 131 SER n 1 132 ILE n 1 133 PRO n 1 134 LYS n 1 135 ASP n 1 136 TYR n 1 137 LEU n 1 138 GLN n 1 139 ARG n 1 140 SER n 1 141 HIS n 1 142 PRO n 1 143 TRP n 1 144 GLU n 1 145 ALA n 1 146 THR n 1 147 GLY n 1 148 VAL n 1 149 LYS n 1 150 TYR n 1 151 ARG n 1 152 LYS n 1 153 ILE n 1 154 HIS n 1 155 VAL n 1 156 ASP n 1 157 GLY n 1 158 GLU n 1 159 ILE n 1 160 VAL n 1 161 GLY n 1 162 TYR n 1 163 SER n 1 164 HIS n 1 165 TYR n 1 166 PHE n 1 167 GLU n 1 168 LEU n 1 169 PRO n 1 170 HIS n 1 171 GLU n 1 172 TYR n 1 173 ASN n 1 174 SER n 1 175 ILE n 1 176 SER n 1 177 LEU n 1 178 SER n 1 179 VAL n 1 180 SER n 1 181 GLY n 1 182 VAL n 1 183 HIS n 1 184 LYS n 1 185 ASN n 1 186 PRO n 1 187 SER n 1 188 SER n 1 189 TYR n 1 190 ASN n 1 191 VAL n 1 192 ALA n 1 193 ALA n 1 194 PRO n 1 195 HIS n 1 196 ASN n 1 197 ILE n 1 198 MET n 1 199 ASP n 1 200 VAL n 1 201 PHE n 1 202 GLN n 1 203 SER n 1 204 CYS n 1 205 ASP n 1 206 LEU n 1 207 ALA n 1 208 LEU n 1 209 LYS n 1 210 PHE n 1 211 SER n 1 212 ASN n 1 213 ARG n 1 214 TYR n 1 215 TRP n 1 216 CYS n 1 217 GLU n 1 218 LEU n 1 219 GLU n 1 220 LEU n 1 221 ILE n 1 222 ASN n 1 223 HIS n 1 224 TYR n 1 225 ILE n 1 226 SER n 1 227 ALA n 1 228 TYR n 1 229 ALA n 1 230 TYR n 1 231 PRO n 1 232 TYR n 1 233 LEU n 1 234 ASP n 1 235 ILE n 1 236 ASN n 1 237 ASN n 1 238 HIS n 1 239 LYS n 1 240 TYR n 1 241 GLY n 1 242 VAL n 1 243 PRO n 1 244 LEU n 1 245 ASN n 1 246 GLY n 1 247 ARG n 1 248 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Operophtera brumata cypovirus 18' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 352244 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name 'fall armyworm' _entity_src_gen.pdbx_host_org_scientific_name 'Spodoptera frugiperda' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 7108 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain SF9 _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type baculovirus _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pOPIN _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q30C70_9REOV _struct_ref.pdbx_db_accession Q30C70 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ADVAGTSNRDFRGREQRLYNSEQYNYNNSLNGEVSLWVYAYYSDGSVLVRNCNSQYKVGISECFKSLKEVRVGQNNDPYD EQEVNNGVYYPNGGEPTKFHSNAKPRAIQIIFSPSVNVHTIKMAKGNSVSIPKDYLQRSHPWEATGVKYRKIHVDGEIVG YSHYFELPHEYNSISLSVSGVHKNPSSYNVAAPHNIMDVFQSCDLALKFSNRYWCELELINHYISAYAYPYLDINNHKYG VPLNGRQ ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4OTS _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 248 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q30C70 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 248 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 248 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4OTS _struct_ref_seq_dif.mon_id ACE _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q30C70 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details ACETYLATION _struct_ref_seq_dif.pdbx_auth_seq_num 1 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ACE non-polymer . 'ACETYL GROUP' ? 'C2 H4 O' 44.053 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 ATP non-polymer . "ADENOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O13 P3' 507.181 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GTP non-polymer n "GUANOSINE-5'-TRIPHOSPHATE" ? 'C10 H16 N5 O14 P3' 523.180 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4OTS _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 20 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.60 _exptl_crystal.density_percent_sol 23.08 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method ? _exptl_crystal_grow.temp 301 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details 'Crystals formed naturally within the cytoplasm and were purified from cells, pH 7.5, temperature 301K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector PIXEL _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.pdbx_collection_date 2011-07-28 _diffrn_detector.details mirrors # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator 'double crystal Si(111)' _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9686 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I24' _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I24 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9686 # _reflns.entry_id 4OTS _reflns.observed_criterion_sigma_I 1.34 _reflns.observed_criterion_sigma_F 1.34 _reflns.d_resolution_low 72.686 _reflns.d_resolution_high 1.7 _reflns.number_obs 19343 _reflns.number_all 19343 _reflns.percent_possible_obs 97.2 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.7 _reflns_shell.d_res_low ? _reflns_shell.percent_possible_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4OTS _refine.ls_number_reflns_obs 19327 _refine.ls_number_reflns_all 19327 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 27.473 _refine.ls_d_res_high 1.704 _refine.ls_percent_reflns_obs 97.13 _refine.ls_R_factor_obs 0.1018 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1002 _refine.ls_R_factor_R_free 0.1315 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.13 _refine.ls_number_reflns_R_free 992 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.12 _refine.pdbx_overall_phase_error 11.18 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2001 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 65 _refine_hist.number_atoms_solvent 241 _refine_hist.number_atoms_total 2307 _refine_hist.d_res_high 1.704 _refine_hist.d_res_low 27.473 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.006 ? ? 2124 ? 'X-RAY DIFFRACTION' f_angle_d 1.169 ? ? 2901 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 17.923 ? ? 778 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.045 ? ? 291 ? 'X-RAY DIFFRACTION' f_plane_restr 0.006 ? ? 372 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 1.704 1.7941 2224 0.1563 82.0 0.1896 . . 98 . . . . 'X-RAY DIFFRACTION' . 1.7941 1.9065 2608 0.1313 99.0 0.2001 . . 146 . . . . 'X-RAY DIFFRACTION' . 1.9065 2.0536 2689 0.1065 100.0 0.1445 . . 144 . . . . 'X-RAY DIFFRACTION' . 2.0536 2.2602 2645 0.0899 100.0 0.1454 . . 159 . . . . 'X-RAY DIFFRACTION' . 2.2602 2.5871 2687 0.0889 100.0 0.1029 . . 147 . . . . 'X-RAY DIFFRACTION' . 2.5871 3.2586 2698 0.0866 100.0 0.1153 . . 155 . . . . 'X-RAY DIFFRACTION' . 3.2586 27.4764 2784 0.0906 100.0 0.1066 . . 143 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 4OTS _struct.title 'Crystal Structure of isolated Operophtera brumata CPV18' _struct.pdbx_descriptor Polyhedrin _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4OTS _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' _struct_keywords.text 'microcrystals, polyhedra, occlusion body, VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? E N N 5 ? F N N 6 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 11 ? SER A 30 ? ASP A 11 SER A 30 1 ? 20 HELX_P HELX_P2 2 ASP A 78 ? TYR A 91 ? ASP A 78 TYR A 91 1 ? 14 HELX_P HELX_P3 3 TYR A 136 ? SER A 140 ? TYR A 136 SER A 140 5 ? 5 HELX_P HELX_P4 4 THR A 146 ? TYR A 150 ? THR A 146 TYR A 150 5 ? 5 HELX_P HELX_P5 5 ASN A 196 ? ALA A 207 ? ASN A 196 ALA A 207 1 ? 12 HELX_P HELX_P6 6 CYS A 216 ? TYR A 224 ? CYS A 216 TYR A 224 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale ? ? A ACE 1 C ? ? ? 1_555 A ALA 2 N ? ? A ACE 1 A ALA 2 1_555 ? ? ? ? ? ? ? 1.331 ? metalc1 metalc ? ? C GTP . O2G ? ? ? 1_555 E MG . MG ? ? A GTP 302 A MG 304 1_555 ? ? ? ? ? ? ? 2.032 ? metalc2 metalc ? ? C GTP . O2B ? ? ? 1_555 E MG . MG ? ? A GTP 302 A MG 304 1_555 ? ? ? ? ? ? ? 2.097 ? metalc3 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 304 A HOH 511 1_555 ? ? ? ? ? ? ? 2.154 ? metalc4 metalc ? ? E MG . MG ? ? ? 1_555 F HOH . O ? ? A MG 304 A HOH 527 1_555 ? ? ? ? ? ? ? 2.470 ? metalc5 metalc ? ? C GTP . O2A ? ? ? 1_555 E MG . MG ? ? A GTP 302 A MG 304 1_555 ? ? ? ? ? ? ? 2.634 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference covale ? ? metalc ? ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 6 ? B ? 3 ? C ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel A 4 5 ? anti-parallel A 5 6 ? anti-parallel B 1 2 ? anti-parallel B 2 3 ? anti-parallel C 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 ARG A 151 ? VAL A 155 ? ARG A 151 VAL A 155 A 2 GLU A 158 ? GLU A 167 ? GLU A 158 GLU A 167 A 3 ALA A 108 ? PHE A 113 ? ALA A 108 PHE A 113 A 4 GLU A 34 ? TYR A 42 ? GLU A 34 TYR A 42 A 5 VAL A 48 ? GLN A 56 ? VAL A 48 GLN A 56 A 6 LEU A 208 ? TYR A 214 ? LEU A 208 TYR A 214 B 1 LYS A 58 ? GLU A 63 ? LYS A 58 GLU A 63 B 2 SER A 176 ? HIS A 183 ? SER A 176 HIS A 183 B 3 VAL A 117 ? GLY A 127 ? VAL A 117 GLY A 127 C 1 TYR A 232 ? LEU A 233 ? TYR A 232 LEU A 233 C 2 LYS A 239 ? TYR A 240 ? LYS A 239 TYR A 240 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 151 ? N ARG A 151 O SER A 163 ? O SER A 163 A 2 3 O HIS A 164 ? O HIS A 164 N ILE A 111 ? N ILE A 111 A 3 4 O GLN A 110 ? O GLN A 110 N TYR A 40 ? N TYR A 40 A 4 5 N VAL A 39 ? N VAL A 39 O ARG A 51 ? O ARG A 51 A 5 6 N ASN A 52 ? N ASN A 52 O PHE A 210 ? O PHE A 210 B 1 2 N GLU A 63 ? N GLU A 63 O LEU A 177 ? O LEU A 177 B 2 3 O SER A 180 ? O SER A 180 N LYS A 123 ? N LYS A 123 C 1 2 N TYR A 232 ? N TYR A 232 O TYR A 240 ? O TYR A 240 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE CL A 301' AC2 Software ? ? ? ? 16 'BINDING SITE FOR RESIDUE GTP A 302' AC3 Software ? ? ? ? 17 'BINDING SITE FOR RESIDUE ATP A 303' AC4 Software ? ? ? ? 3 'BINDING SITE FOR RESIDUE MG A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 3 ALA A 2 ? ALA A 2 . ? 2_455 ? 2 AC1 3 LEU A 31 ? LEU A 31 . ? 1_555 ? 3 AC1 3 HOH F . ? HOH A 409 . ? 22_454 ? 4 AC2 16 ASN A 9 ? ASN A 9 . ? 3_454 ? 5 AC2 16 ARG A 10 ? ARG A 10 . ? 3_454 ? 6 AC2 16 ARG A 18 ? ARG A 18 . ? 1_555 ? 7 AC2 16 HIS A 170 ? HIS A 170 . ? 23_444 ? 8 AC2 16 TYR A 172 ? TYR A 172 . ? 23_444 ? 9 AC2 16 ASN A 173 ? ASN A 173 . ? 23_444 ? 10 AC2 16 LYS A 184 ? LYS A 184 . ? 4_554 ? 11 AC2 16 ATP D . ? ATP A 303 . ? 1_555 ? 12 AC2 16 MG E . ? MG A 304 . ? 1_555 ? 13 AC2 16 HOH F . ? HOH A 442 . ? 23_444 ? 14 AC2 16 HOH F . ? HOH A 511 . ? 1_555 ? 15 AC2 16 HOH F . ? HOH A 534 . ? 1_555 ? 16 AC2 16 HOH F . ? HOH A 542 . ? 1_555 ? 17 AC2 16 HOH F . ? HOH A 544 . ? 1_555 ? 18 AC2 16 HOH F . ? HOH A 567 . ? 4_554 ? 19 AC2 16 HOH F . ? HOH A 599 . ? 1_555 ? 20 AC3 17 TYR A 25 ? TYR A 25 . ? 4_554 ? 21 AC3 17 LYS A 152 ? LYS A 152 . ? 4_554 ? 22 AC3 17 HIS A 154 ? HIS A 154 . ? 4_554 ? 23 AC3 17 ASP A 156 ? ASP A 156 . ? 1_555 ? 24 AC3 17 GLY A 157 ? GLY A 157 . ? 1_555 ? 25 AC3 17 GLY A 157 ? GLY A 157 . ? 4_554 ? 26 AC3 17 ILE A 159 ? ILE A 159 . ? 4_554 ? 27 AC3 17 LYS A 184 ? LYS A 184 . ? 4_554 ? 28 AC3 17 GTP C . ? GTP A 302 . ? 1_555 ? 29 AC3 17 HOH F . ? HOH A 498 . ? 4_554 ? 30 AC3 17 HOH F . ? HOH A 520 . ? 1_555 ? 31 AC3 17 HOH F . ? HOH A 554 . ? 23_444 ? 32 AC3 17 HOH F . ? HOH A 576 . ? 4_554 ? 33 AC3 17 HOH F . ? HOH A 582 . ? 4_554 ? 34 AC3 17 HOH F . ? HOH A 586 . ? 1_555 ? 35 AC3 17 HOH F . ? HOH A 599 . ? 1_555 ? 36 AC3 17 HOH F . ? HOH A 634 . ? 1_555 ? 37 AC4 3 GTP C . ? GTP A 302 . ? 1_555 ? 38 AC4 3 HOH F . ? HOH A 511 . ? 1_555 ? 39 AC4 3 HOH F . ? HOH A 527 . ? 1_555 ? # _database_PDB_matrix.entry_id 4OTS _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4OTS _atom_sites.fract_transf_matrix[1][1] 0.009728 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009728 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009728 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL H MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ACE 1 1 1 ACE ACE A . n A 1 2 ALA 2 2 2 ALA ALA A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 VAL 4 4 4 VAL VAL A . n A 1 5 ALA 5 5 5 ALA ALA A . n A 1 6 GLY 6 6 6 GLY GLY A . n A 1 7 THR 7 7 7 THR THR A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ASP 11 11 11 ASP ASP A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 ARG 13 13 13 ARG ARG A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ARG 15 15 15 ARG ARG A . n A 1 16 GLU 16 16 16 GLU GLU A . n A 1 17 GLN 17 17 17 GLN GLN A . n A 1 18 ARG 18 18 18 ARG ARG A . n A 1 19 LEU 19 19 19 LEU LEU A . n A 1 20 TYR 20 20 20 TYR TYR A . n A 1 21 ASN 21 21 21 ASN ASN A . n A 1 22 SER 22 22 22 SER SER A . n A 1 23 GLU 23 23 23 GLU GLU A . n A 1 24 GLN 24 24 24 GLN GLN A . n A 1 25 TYR 25 25 25 TYR TYR A . n A 1 26 ASN 26 26 26 ASN ASN A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 SER 30 30 30 SER SER A . n A 1 31 LEU 31 31 31 LEU LEU A . n A 1 32 ASN 32 32 32 ASN ASN A . n A 1 33 GLY 33 33 33 GLY GLY A . n A 1 34 GLU 34 34 34 GLU GLU A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 SER 36 36 36 SER SER A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 TRP 38 38 38 TRP TRP A . n A 1 39 VAL 39 39 39 VAL VAL A . n A 1 40 TYR 40 40 40 TYR TYR A . n A 1 41 ALA 41 41 41 ALA ALA A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 TYR 43 43 43 TYR TYR A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ASP 45 45 45 ASP ASP A . n A 1 46 GLY 46 46 46 GLY GLY A . n A 1 47 SER 47 47 47 SER SER A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 ARG 51 51 51 ARG ARG A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 CYS 53 53 53 CYS CYS A . n A 1 54 ASN 54 54 54 ASN ASN A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 GLN 56 56 56 GLN GLN A . n A 1 57 TYR 57 57 57 TYR TYR A . n A 1 58 LYS 58 58 58 LYS LYS A . n A 1 59 VAL 59 59 59 VAL VAL A . n A 1 60 GLY 60 60 60 GLY GLY A . n A 1 61 ILE 61 61 61 ILE ILE A . n A 1 62 SER 62 62 62 SER SER A . n A 1 63 GLU 63 63 63 GLU GLU A . n A 1 64 CYS 64 64 64 CYS CYS A . n A 1 65 PHE 65 65 65 PHE PHE A . n A 1 66 LYS 66 66 66 LYS LYS A . n A 1 67 SER 67 67 67 SER SER A . n A 1 68 LEU 68 68 68 LEU LEU A . n A 1 69 LYS 69 69 69 LYS LYS A . n A 1 70 GLU 70 70 70 GLU GLU A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 GLY 74 74 74 GLY GLY A . n A 1 75 GLN 75 75 75 GLN GLN A . n A 1 76 ASN 76 76 76 ASN ASN A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 ASP 78 78 78 ASP ASP A . n A 1 79 PRO 79 79 79 PRO PRO A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 ASP 81 81 81 ASP ASP A . n A 1 82 GLU 82 82 82 GLU GLU A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 GLU 84 84 84 GLU GLU A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 ASN 86 86 86 ASN ASN A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 GLY 88 88 88 GLY GLY A . n A 1 89 VAL 89 89 89 VAL VAL A . n A 1 90 TYR 90 90 90 TYR TYR A . n A 1 91 TYR 91 91 91 TYR TYR A . n A 1 92 PRO 92 92 92 PRO PRO A . n A 1 93 ASN 93 93 93 ASN ASN A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLY 95 95 95 GLY GLY A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 PRO 97 97 97 PRO PRO A . n A 1 98 THR 98 98 98 THR THR A . n A 1 99 LYS 99 99 99 LYS LYS A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 HIS 101 101 101 HIS HIS A . n A 1 102 SER 102 102 102 SER SER A . n A 1 103 ASN 103 103 103 ASN ASN A . n A 1 104 ALA 104 104 104 ALA ALA A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 PRO 106 106 106 PRO PRO A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 ALA 108 108 108 ALA ALA A . n A 1 109 ILE 109 109 109 ILE ILE A . n A 1 110 GLN 110 110 110 GLN GLN A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 PHE 113 113 113 PHE PHE A . n A 1 114 SER 114 114 114 SER SER A . n A 1 115 PRO 115 115 115 PRO PRO A . n A 1 116 SER 116 116 116 SER SER A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 ASN 118 118 118 ASN ASN A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 HIS 120 120 120 HIS HIS A . n A 1 121 THR 121 121 121 THR THR A . n A 1 122 ILE 122 122 122 ILE ILE A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 MET 124 124 124 MET MET A . n A 1 125 ALA 125 125 125 ALA ALA A . n A 1 126 LYS 126 126 126 LYS LYS A . n A 1 127 GLY 127 127 127 GLY GLY A . n A 1 128 ASN 128 128 128 ASN ASN A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 VAL 130 130 130 VAL VAL A . n A 1 131 SER 131 131 131 SER SER A . n A 1 132 ILE 132 132 132 ILE ILE A . n A 1 133 PRO 133 133 133 PRO PRO A . n A 1 134 LYS 134 134 134 LYS LYS A . n A 1 135 ASP 135 135 135 ASP ASP A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLN 138 138 138 GLN GLN A . n A 1 139 ARG 139 139 139 ARG ARG A . n A 1 140 SER 140 140 140 SER SER A . n A 1 141 HIS 141 141 141 HIS HIS A . n A 1 142 PRO 142 142 142 PRO PRO A . n A 1 143 TRP 143 143 143 TRP TRP A . n A 1 144 GLU 144 144 144 GLU GLU A . n A 1 145 ALA 145 145 145 ALA ALA A . n A 1 146 THR 146 146 146 THR THR A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 VAL 148 148 148 VAL VAL A . n A 1 149 LYS 149 149 149 LYS LYS A . n A 1 150 TYR 150 150 150 TYR TYR A . n A 1 151 ARG 151 151 151 ARG ARG A . n A 1 152 LYS 152 152 152 LYS LYS A . n A 1 153 ILE 153 153 153 ILE ILE A . n A 1 154 HIS 154 154 154 HIS HIS A . n A 1 155 VAL 155 155 155 VAL VAL A . n A 1 156 ASP 156 156 156 ASP ASP A . n A 1 157 GLY 157 157 157 GLY GLY A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 ILE 159 159 159 ILE ILE A . n A 1 160 VAL 160 160 160 VAL VAL A . n A 1 161 GLY 161 161 161 GLY GLY A . n A 1 162 TYR 162 162 162 TYR TYR A . n A 1 163 SER 163 163 163 SER SER A . n A 1 164 HIS 164 164 164 HIS HIS A . n A 1 165 TYR 165 165 165 TYR TYR A . n A 1 166 PHE 166 166 166 PHE PHE A . n A 1 167 GLU 167 167 167 GLU GLU A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 PRO 169 169 169 PRO PRO A . n A 1 170 HIS 170 170 170 HIS HIS A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 ASN 173 173 173 ASN ASN A . n A 1 174 SER 174 174 174 SER SER A . n A 1 175 ILE 175 175 175 ILE ILE A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 LEU 177 177 177 LEU LEU A . n A 1 178 SER 178 178 178 SER SER A . n A 1 179 VAL 179 179 179 VAL VAL A . n A 1 180 SER 180 180 180 SER SER A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 HIS 183 183 183 HIS HIS A . n A 1 184 LYS 184 184 184 LYS LYS A . n A 1 185 ASN 185 185 185 ASN ASN A . n A 1 186 PRO 186 186 186 PRO PRO A . n A 1 187 SER 187 187 187 SER SER A . n A 1 188 SER 188 188 188 SER SER A . n A 1 189 TYR 189 189 189 TYR TYR A . n A 1 190 ASN 190 190 190 ASN ASN A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 ALA 193 193 193 ALA ALA A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 HIS 195 195 195 HIS HIS A . n A 1 196 ASN 196 196 196 ASN ASN A . n A 1 197 ILE 197 197 197 ILE ILE A . n A 1 198 MET 198 198 198 MET MET A . n A 1 199 ASP 199 199 199 ASP ASP A . n A 1 200 VAL 200 200 200 VAL VAL A . n A 1 201 PHE 201 201 201 PHE PHE A . n A 1 202 GLN 202 202 202 GLN GLN A . n A 1 203 SER 203 203 203 SER SER A . n A 1 204 CYS 204 204 204 CYS CYS A . n A 1 205 ASP 205 205 205 ASP ASP A . n A 1 206 LEU 206 206 206 LEU LEU A . n A 1 207 ALA 207 207 207 ALA ALA A . n A 1 208 LEU 208 208 208 LEU LEU A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 PHE 210 210 210 PHE PHE A . n A 1 211 SER 211 211 211 SER SER A . n A 1 212 ASN 212 212 212 ASN ASN A . n A 1 213 ARG 213 213 213 ARG ARG A . n A 1 214 TYR 214 214 214 TYR TYR A . n A 1 215 TRP 215 215 215 TRP TRP A . n A 1 216 CYS 216 216 216 CYS CYS A . n A 1 217 GLU 217 217 217 GLU GLU A . n A 1 218 LEU 218 218 218 LEU LEU A . n A 1 219 GLU 219 219 219 GLU GLU A . n A 1 220 LEU 220 220 220 LEU LEU A . n A 1 221 ILE 221 221 221 ILE ILE A . n A 1 222 ASN 222 222 222 ASN ASN A . n A 1 223 HIS 223 223 223 HIS HIS A . n A 1 224 TYR 224 224 224 TYR TYR A . n A 1 225 ILE 225 225 225 ILE ILE A . n A 1 226 SER 226 226 226 SER SER A . n A 1 227 ALA 227 227 227 ALA ALA A . n A 1 228 TYR 228 228 228 TYR TYR A . n A 1 229 ALA 229 229 229 ALA ALA A . n A 1 230 TYR 230 230 230 TYR TYR A . n A 1 231 PRO 231 231 231 PRO PRO A . n A 1 232 TYR 232 232 232 TYR TYR A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 ASP 234 234 234 ASP ASP A . n A 1 235 ILE 235 235 235 ILE ILE A . n A 1 236 ASN 236 236 236 ASN ASN A . n A 1 237 ASN 237 237 237 ASN ASN A . n A 1 238 HIS 238 238 238 HIS HIS A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 TYR 240 240 240 TYR TYR A . n A 1 241 GLY 241 241 241 GLY GLY A . n A 1 242 VAL 242 242 242 VAL VAL A . n A 1 243 PRO 243 243 243 PRO PRO A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 ASN 245 245 245 ASN ASN A . n A 1 246 GLY 246 246 246 GLY GLY A . n A 1 247 ARG 247 247 247 ARG ARG A . n A 1 248 GLN 248 248 248 GLN GLN A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 13470 ? 1 MORE -104 ? 1 'SSA (A^2)' 34790 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 z,-x,-y 0.0000000000 0.0000000000 1.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 3 'crystal symmetry operation' 12_555 -y,-z,x 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A HOH 597 ? F HOH . 2 1 A HOH 623 ? F HOH . 3 1 A HOH 638 ? F HOH . 4 1 A HOH 640 ? F HOH . # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 O2G ? C GTP . ? A GTP 302 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O2B ? C GTP . ? A GTP 302 ? 1_555 85.9 ? 2 O2G ? C GTP . ? A GTP 302 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 511 ? 1_555 153.2 ? 3 O2B ? C GTP . ? A GTP 302 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 511 ? 1_555 71.9 ? 4 O2G ? C GTP . ? A GTP 302 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 527 ? 1_555 96.0 ? 5 O2B ? C GTP . ? A GTP 302 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 527 ? 1_555 154.5 ? 6 O ? F HOH . ? A HOH 511 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O ? F HOH . ? A HOH 527 ? 1_555 97.9 ? 7 O2G ? C GTP . ? A GTP 302 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O2A ? C GTP . ? A GTP 302 ? 1_555 95.5 ? 8 O2B ? C GTP . ? A GTP 302 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O2A ? C GTP . ? A GTP 302 ? 1_555 67.7 ? 9 O ? F HOH . ? A HOH 511 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O2A ? C GTP . ? A GTP 302 ? 1_555 62.7 ? 10 O ? F HOH . ? A HOH 527 ? 1_555 MG ? E MG . ? A MG 304 ? 1_555 O2A ? C GTP . ? A GTP 302 ? 1_555 86.8 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-05-14 2 'Structure model' 1 1 2014-09-24 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -20.9564 _pdbx_refine_tls.origin_y 8.6787 _pdbx_refine_tls.origin_z -34.0137 _pdbx_refine_tls.T[1][1] 0.0040 _pdbx_refine_tls.T[2][2] 0.0075 _pdbx_refine_tls.T[3][3] 0.0096 _pdbx_refine_tls.T[1][2] 0.0022 _pdbx_refine_tls.T[1][3] -0.0001 _pdbx_refine_tls.T[2][3] -0.0021 _pdbx_refine_tls.L[1][1] 0.0028 _pdbx_refine_tls.L[2][2] 0.0062 _pdbx_refine_tls.L[3][3] 0.0008 _pdbx_refine_tls.L[1][2] -0.0004 _pdbx_refine_tls.L[1][3] 0.0002 _pdbx_refine_tls.L[2][3] -0.0023 _pdbx_refine_tls.S[1][1] 0.0009 _pdbx_refine_tls.S[1][2] 0.0039 _pdbx_refine_tls.S[1][3] -0.0025 _pdbx_refine_tls.S[2][1] 0.0004 _pdbx_refine_tls.S[2][2] 0.0007 _pdbx_refine_tls.S[2][3] 0.0015 _pdbx_refine_tls.S[3][1] 0.0015 _pdbx_refine_tls.S[3][2] -0.0000 _pdbx_refine_tls.S[3][3] 0.0017 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal GDA 'data collection' . ? 1 PHASER phasing . ? 2 PHENIX refinement '(phenix.refine: 1.8.4_1496)' ? 3 FastDP 'data reduction' . ? 4 Blend 'data scaling' . ? 5 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 NZ A LYS 149 ? ? O A HOH 565 ? ? 2.13 2 1 O A HOH 573 ? ? O A HOH 629 ? ? 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 O A HOH 508 ? ? 1_555 O A HOH 562 ? ? 23_444 2.12 2 1 O A HOH 555 ? ? 1_555 O A HOH 555 ? ? 2_455 2.15 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 TYR A 57 ? ? 72.22 -50.03 2 1 SER A 131 ? ? 70.95 37.71 3 1 ASP A 135 ? ? 70.26 -53.60 4 1 TYR A 224 ? ? -124.42 -71.20 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 "GUANOSINE-5'-TRIPHOSPHATE" GTP 4 "ADENOSINE-5'-TRIPHOSPHATE" ATP 5 'MAGNESIUM ION' MG 6 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 301 249 CL CL A . C 3 GTP 1 302 252 GTP GTP A . D 4 ATP 1 303 253 ATP ATP A . E 5 MG 1 304 1 MG MG A . F 6 HOH 1 401 1 HOH HOH A . F 6 HOH 2 402 2 HOH HOH A . F 6 HOH 3 403 3 HOH HOH A . F 6 HOH 4 404 4 HOH HOH A . F 6 HOH 5 405 5 HOH HOH A . F 6 HOH 6 406 6 HOH HOH A . F 6 HOH 7 407 7 HOH HOH A . F 6 HOH 8 408 8 HOH HOH A . F 6 HOH 9 409 9 HOH HOH A . F 6 HOH 10 410 10 HOH HOH A . F 6 HOH 11 411 11 HOH HOH A . F 6 HOH 12 412 12 HOH HOH A . F 6 HOH 13 413 13 HOH HOH A . F 6 HOH 14 414 14 HOH HOH A . F 6 HOH 15 415 15 HOH HOH A . F 6 HOH 16 416 16 HOH HOH A . F 6 HOH 17 417 17 HOH HOH A . F 6 HOH 18 418 18 HOH HOH A . F 6 HOH 19 419 19 HOH HOH A . F 6 HOH 20 420 20 HOH HOH A . F 6 HOH 21 421 21 HOH HOH A . F 6 HOH 22 422 22 HOH HOH A . F 6 HOH 23 423 23 HOH HOH A . F 6 HOH 24 424 24 HOH HOH A . F 6 HOH 25 425 25 HOH HOH A . F 6 HOH 26 426 26 HOH HOH A . F 6 HOH 27 427 27 HOH HOH A . F 6 HOH 28 428 28 HOH HOH A . F 6 HOH 29 429 29 HOH HOH A . F 6 HOH 30 430 30 HOH HOH A . F 6 HOH 31 431 31 HOH HOH A . F 6 HOH 32 432 32 HOH HOH A . F 6 HOH 33 433 33 HOH HOH A . F 6 HOH 34 434 34 HOH HOH A . F 6 HOH 35 435 35 HOH HOH A . F 6 HOH 36 436 36 HOH HOH A . F 6 HOH 37 437 37 HOH HOH A . F 6 HOH 38 438 38 HOH HOH A . F 6 HOH 39 439 39 HOH HOH A . F 6 HOH 40 440 40 HOH HOH A . F 6 HOH 41 441 41 HOH HOH A . F 6 HOH 42 442 42 HOH HOH A . F 6 HOH 43 443 43 HOH HOH A . F 6 HOH 44 444 44 HOH HOH A . F 6 HOH 45 445 45 HOH HOH A . F 6 HOH 46 446 46 HOH HOH A . F 6 HOH 47 447 47 HOH HOH A . F 6 HOH 48 448 48 HOH HOH A . F 6 HOH 49 449 49 HOH HOH A . F 6 HOH 50 450 50 HOH HOH A . F 6 HOH 51 451 51 HOH HOH A . F 6 HOH 52 452 52 HOH HOH A . F 6 HOH 53 453 53 HOH HOH A . F 6 HOH 54 454 54 HOH HOH A . F 6 HOH 55 455 55 HOH HOH A . F 6 HOH 56 456 56 HOH HOH A . F 6 HOH 57 457 57 HOH HOH A . F 6 HOH 58 458 58 HOH HOH A . F 6 HOH 59 459 59 HOH HOH A . F 6 HOH 60 460 60 HOH HOH A . F 6 HOH 61 461 61 HOH HOH A . F 6 HOH 62 462 62 HOH HOH A . F 6 HOH 63 463 63 HOH HOH A . F 6 HOH 64 464 64 HOH HOH A . F 6 HOH 65 465 65 HOH HOH A . F 6 HOH 66 466 66 HOH HOH A . F 6 HOH 67 467 67 HOH HOH A . F 6 HOH 68 468 68 HOH HOH A . F 6 HOH 69 469 69 HOH HOH A . F 6 HOH 70 470 70 HOH HOH A . F 6 HOH 71 471 71 HOH HOH A . F 6 HOH 72 472 72 HOH HOH A . F 6 HOH 73 473 73 HOH HOH A . F 6 HOH 74 474 74 HOH HOH A . F 6 HOH 75 475 75 HOH HOH A . F 6 HOH 76 476 76 HOH HOH A . F 6 HOH 77 477 77 HOH HOH A . F 6 HOH 78 478 78 HOH HOH A . F 6 HOH 79 479 79 HOH HOH A . F 6 HOH 80 480 80 HOH HOH A . F 6 HOH 81 481 81 HOH HOH A . F 6 HOH 82 482 82 HOH HOH A . F 6 HOH 83 483 83 HOH HOH A . F 6 HOH 84 484 84 HOH HOH A . F 6 HOH 85 485 85 HOH HOH A . F 6 HOH 86 486 86 HOH HOH A . F 6 HOH 87 487 87 HOH HOH A . F 6 HOH 88 488 88 HOH HOH A . F 6 HOH 89 489 89 HOH HOH A . F 6 HOH 90 490 90 HOH HOH A . F 6 HOH 91 491 91 HOH HOH A . F 6 HOH 92 492 92 HOH HOH A . F 6 HOH 93 493 93 HOH HOH A . F 6 HOH 94 494 94 HOH HOH A . F 6 HOH 95 495 95 HOH HOH A . F 6 HOH 96 496 96 HOH HOH A . F 6 HOH 97 497 97 HOH HOH A . F 6 HOH 98 498 98 HOH HOH A . F 6 HOH 99 499 99 HOH HOH A . F 6 HOH 100 500 100 HOH HOH A . F 6 HOH 101 501 101 HOH HOH A . F 6 HOH 102 502 102 HOH HOH A . F 6 HOH 103 503 103 HOH HOH A . F 6 HOH 104 504 104 HOH HOH A . F 6 HOH 105 505 105 HOH HOH A . F 6 HOH 106 506 106 HOH HOH A . F 6 HOH 107 507 107 HOH HOH A . F 6 HOH 108 508 108 HOH HOH A . F 6 HOH 109 509 109 HOH HOH A . F 6 HOH 110 510 110 HOH HOH A . F 6 HOH 111 511 111 HOH HOH A . F 6 HOH 112 512 112 HOH HOH A . F 6 HOH 113 513 113 HOH HOH A . F 6 HOH 114 514 114 HOH HOH A . F 6 HOH 115 515 115 HOH HOH A . F 6 HOH 116 516 116 HOH HOH A . F 6 HOH 117 517 117 HOH HOH A . F 6 HOH 118 518 118 HOH HOH A . F 6 HOH 119 519 119 HOH HOH A . F 6 HOH 120 520 120 HOH HOH A . F 6 HOH 121 521 121 HOH HOH A . F 6 HOH 122 522 122 HOH HOH A . F 6 HOH 123 523 123 HOH HOH A . F 6 HOH 124 524 124 HOH HOH A . F 6 HOH 125 525 125 HOH HOH A . F 6 HOH 126 526 126 HOH HOH A . F 6 HOH 127 527 127 HOH HOH A . F 6 HOH 128 528 128 HOH HOH A . F 6 HOH 129 529 129 HOH HOH A . F 6 HOH 130 530 130 HOH HOH A . F 6 HOH 131 531 131 HOH HOH A . F 6 HOH 132 532 132 HOH HOH A . F 6 HOH 133 533 133 HOH HOH A . F 6 HOH 134 534 134 HOH HOH A . F 6 HOH 135 535 135 HOH HOH A . F 6 HOH 136 536 136 HOH HOH A . F 6 HOH 137 537 137 HOH HOH A . F 6 HOH 138 538 138 HOH HOH A . F 6 HOH 139 539 139 HOH HOH A . F 6 HOH 140 540 140 HOH HOH A . F 6 HOH 141 541 141 HOH HOH A . F 6 HOH 142 542 142 HOH HOH A . F 6 HOH 143 543 143 HOH HOH A . F 6 HOH 144 544 144 HOH HOH A . F 6 HOH 145 545 145 HOH HOH A . F 6 HOH 146 546 146 HOH HOH A . F 6 HOH 147 547 147 HOH HOH A . F 6 HOH 148 548 148 HOH HOH A . F 6 HOH 149 549 149 HOH HOH A . F 6 HOH 150 550 150 HOH HOH A . F 6 HOH 151 551 151 HOH HOH A . F 6 HOH 152 552 152 HOH HOH A . F 6 HOH 153 553 153 HOH HOH A . F 6 HOH 154 554 154 HOH HOH A . F 6 HOH 155 555 155 HOH HOH A . F 6 HOH 156 556 156 HOH HOH A . F 6 HOH 157 557 157 HOH HOH A . F 6 HOH 158 558 158 HOH HOH A . F 6 HOH 159 559 159 HOH HOH A . F 6 HOH 160 560 160 HOH HOH A . F 6 HOH 161 561 161 HOH HOH A . F 6 HOH 162 562 162 HOH HOH A . F 6 HOH 163 563 163 HOH HOH A . F 6 HOH 164 564 164 HOH HOH A . F 6 HOH 165 565 165 HOH HOH A . F 6 HOH 166 566 166 HOH HOH A . F 6 HOH 167 567 167 HOH HOH A . F 6 HOH 168 568 168 HOH HOH A . F 6 HOH 169 569 169 HOH HOH A . F 6 HOH 170 570 170 HOH HOH A . F 6 HOH 171 571 171 HOH HOH A . F 6 HOH 172 572 172 HOH HOH A . F 6 HOH 173 573 173 HOH HOH A . F 6 HOH 174 574 174 HOH HOH A . F 6 HOH 175 575 175 HOH HOH A . F 6 HOH 176 576 176 HOH HOH A . F 6 HOH 177 577 177 HOH HOH A . F 6 HOH 178 578 178 HOH HOH A . F 6 HOH 179 579 179 HOH HOH A . F 6 HOH 180 580 180 HOH HOH A . F 6 HOH 181 581 181 HOH HOH A . F 6 HOH 182 582 182 HOH HOH A . F 6 HOH 183 583 183 HOH HOH A . F 6 HOH 184 584 184 HOH HOH A . F 6 HOH 185 585 185 HOH HOH A . F 6 HOH 186 586 186 HOH HOH A . F 6 HOH 187 587 187 HOH HOH A . F 6 HOH 188 588 188 HOH HOH A . F 6 HOH 189 589 189 HOH HOH A . F 6 HOH 190 590 190 HOH HOH A . F 6 HOH 191 591 191 HOH HOH A . F 6 HOH 192 592 192 HOH HOH A . F 6 HOH 193 593 193 HOH HOH A . F 6 HOH 194 594 194 HOH HOH A . F 6 HOH 195 595 195 HOH HOH A . F 6 HOH 196 596 196 HOH HOH A . F 6 HOH 197 597 197 HOH HOH A . F 6 HOH 198 598 198 HOH HOH A . F 6 HOH 199 599 199 HOH HOH A . F 6 HOH 200 600 200 HOH HOH A . F 6 HOH 201 601 201 HOH HOH A . F 6 HOH 202 602 202 HOH HOH A . F 6 HOH 203 603 203 HOH HOH A . F 6 HOH 204 604 204 HOH HOH A . F 6 HOH 205 605 205 HOH HOH A . F 6 HOH 206 606 206 HOH HOH A . F 6 HOH 207 607 207 HOH HOH A . F 6 HOH 208 608 208 HOH HOH A . F 6 HOH 209 609 209 HOH HOH A . F 6 HOH 210 610 210 HOH HOH A . F 6 HOH 211 611 211 HOH HOH A . F 6 HOH 212 612 212 HOH HOH A . F 6 HOH 213 613 213 HOH HOH A . F 6 HOH 214 614 214 HOH HOH A . F 6 HOH 215 615 215 HOH HOH A . F 6 HOH 216 616 216 HOH HOH A . F 6 HOH 217 617 217 HOH HOH A . F 6 HOH 218 618 218 HOH HOH A . F 6 HOH 219 619 219 HOH HOH A . F 6 HOH 220 620 220 HOH HOH A . F 6 HOH 221 621 221 HOH HOH A . F 6 HOH 222 622 222 HOH HOH A . F 6 HOH 223 623 223 HOH HOH A . F 6 HOH 224 624 224 HOH HOH A . F 6 HOH 225 625 225 HOH HOH A . F 6 HOH 226 626 226 HOH HOH A . F 6 HOH 227 627 227 HOH HOH A . F 6 HOH 228 628 228 HOH HOH A . F 6 HOH 229 629 229 HOH HOH A . F 6 HOH 230 630 230 HOH HOH A . F 6 HOH 231 631 231 HOH HOH A . F 6 HOH 232 632 232 HOH HOH A . F 6 HOH 233 633 233 HOH HOH A . F 6 HOH 234 634 234 HOH HOH A . F 6 HOH 235 635 235 HOH HOH A . F 6 HOH 236 636 236 HOH HOH A . F 6 HOH 237 637 237 HOH HOH A . F 6 HOH 238 638 238 HOH HOH A . F 6 HOH 239 639 239 HOH HOH A . F 6 HOH 240 640 240 HOH HOH A . F 6 HOH 241 641 241 HOH HOH A . #