data_4OZ6 # _entry.id 4OZ6 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4OZ6 pdb_00004oz6 10.2210/pdb4oz6/pdb WWPDB D_1000200297 ? ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 4OZ6 _pdbx_database_status.recvd_initial_deposition_date 2014-02-14 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.methods_development_category . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Bick, M.J.' 1 'Liu, Z.' 2 'Frutos, S.' 3 'Vila-Perello, M.' 4 'Debelouchina, G.T.' 5 'Darst, S.A.' 6 'Muir, T.W.' 7 # _citation.abstract . _citation.abstract_id_CAS . _citation.book_id_ISBN . _citation.book_publisher ? _citation.book_publisher_city . _citation.book_title . _citation.coordinate_linkage . _citation.country US _citation.database_id_Medline . _citation.details . _citation.id primary _citation.journal_abbrev Proc.Natl.Acad.Sci.USA _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full . _citation.journal_issue . _citation.journal_volume 111 _citation.language . _citation.page_first 8422 _citation.page_last 8427 _citation.title 'Structure of the branched intermediate in protein splicing.' _citation.year 2014 _citation.database_id_CSD . _citation.pdbx_database_id_DOI 10.1073/pnas.1402942111 _citation.pdbx_database_id_PubMed 24778214 _citation.unpublished_flag . # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, Z.' 1 ? primary 'Frutos, S.' 2 ? primary 'Bick, M.J.' 3 ? primary 'Vila-Perello, M.' 4 ? primary 'Debelouchina, G.T.' 5 ? primary 'Darst, S.A.' 6 ? primary 'Muir, T.W.' 7 ? # _cell.length_a 58.746 _cell.length_b 58.746 _cell.length_c 111.762 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 90.000 _cell.entry_id 4OZ6 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4OZ6 _symmetry.cell_setting . _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall . _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M . # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Mxe gyrA intein' 21721.477 1 5.99.1.3 'S1A, T184A, A185C, H187(TIH)' 'UNP residues 66-267' ? 2 polymer syn ALA-MET-ARG-TYR 540.656 1 5.99.1.3 ? 'UNP residues 62-65' ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 29 ? ? ? ? # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no yes ;AITGDALVALPEGESVRIADIVPGARPNSDNAIDLKVLDRHGNPVLADRLFHSGEHPVYTVRTVEGLRVTGTANHPLLCL VDVAGVPTLLWKLIDEIKPGDYAVIQRSAFSVDCAGFARGKPEFAPTTYTVGVPGLVRFLEAHHRDPDAQAIADELTDGR FYYAKVASVTDAGVQPVYSLRVDACD(TIH)AFITNGFVSHNTEAP ; ;AITGDALVALPEGESVRIADIVPGARPNSDNAIDLKVLDRHGNPVLADRLFHSGEHPVYTVRTVEGLRVTGTANHPLLCL VDVAGVPTLLWKLIDEIKPGDYAVIQRSAFSVDCAGFARGKPEFAPTTYTVGVPGLVRFLEAHHRDPDAQAIADELTDGR FYYAKVASVTDAGVQPVYSLRVDACDAAFITNGFVSHNTEAP ; A ? 2 'polypeptide(L)' no no AMRY AMRY B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 ILE n 1 3 THR n 1 4 GLY n 1 5 ASP n 1 6 ALA n 1 7 LEU n 1 8 VAL n 1 9 ALA n 1 10 LEU n 1 11 PRO n 1 12 GLU n 1 13 GLY n 1 14 GLU n 1 15 SER n 1 16 VAL n 1 17 ARG n 1 18 ILE n 1 19 ALA n 1 20 ASP n 1 21 ILE n 1 22 VAL n 1 23 PRO n 1 24 GLY n 1 25 ALA n 1 26 ARG n 1 27 PRO n 1 28 ASN n 1 29 SER n 1 30 ASP n 1 31 ASN n 1 32 ALA n 1 33 ILE n 1 34 ASP n 1 35 LEU n 1 36 LYS n 1 37 VAL n 1 38 LEU n 1 39 ASP n 1 40 ARG n 1 41 HIS n 1 42 GLY n 1 43 ASN n 1 44 PRO n 1 45 VAL n 1 46 LEU n 1 47 ALA n 1 48 ASP n 1 49 ARG n 1 50 LEU n 1 51 PHE n 1 52 HIS n 1 53 SER n 1 54 GLY n 1 55 GLU n 1 56 HIS n 1 57 PRO n 1 58 VAL n 1 59 TYR n 1 60 THR n 1 61 VAL n 1 62 ARG n 1 63 THR n 1 64 VAL n 1 65 GLU n 1 66 GLY n 1 67 LEU n 1 68 ARG n 1 69 VAL n 1 70 THR n 1 71 GLY n 1 72 THR n 1 73 ALA n 1 74 ASN n 1 75 HIS n 1 76 PRO n 1 77 LEU n 1 78 LEU n 1 79 CYS n 1 80 LEU n 1 81 VAL n 1 82 ASP n 1 83 VAL n 1 84 ALA n 1 85 GLY n 1 86 VAL n 1 87 PRO n 1 88 THR n 1 89 LEU n 1 90 LEU n 1 91 TRP n 1 92 LYS n 1 93 LEU n 1 94 ILE n 1 95 ASP n 1 96 GLU n 1 97 ILE n 1 98 LYS n 1 99 PRO n 1 100 GLY n 1 101 ASP n 1 102 TYR n 1 103 ALA n 1 104 VAL n 1 105 ILE n 1 106 GLN n 1 107 ARG n 1 108 SER n 1 109 ALA n 1 110 PHE n 1 111 SER n 1 112 VAL n 1 113 ASP n 1 114 CYS n 1 115 ALA n 1 116 GLY n 1 117 PHE n 1 118 ALA n 1 119 ARG n 1 120 GLY n 1 121 LYS n 1 122 PRO n 1 123 GLU n 1 124 PHE n 1 125 ALA n 1 126 PRO n 1 127 THR n 1 128 THR n 1 129 TYR n 1 130 THR n 1 131 VAL n 1 132 GLY n 1 133 VAL n 1 134 PRO n 1 135 GLY n 1 136 LEU n 1 137 VAL n 1 138 ARG n 1 139 PHE n 1 140 LEU n 1 141 GLU n 1 142 ALA n 1 143 HIS n 1 144 HIS n 1 145 ARG n 1 146 ASP n 1 147 PRO n 1 148 ASP n 1 149 ALA n 1 150 GLN n 1 151 ALA n 1 152 ILE n 1 153 ALA n 1 154 ASP n 1 155 GLU n 1 156 LEU n 1 157 THR n 1 158 ASP n 1 159 GLY n 1 160 ARG n 1 161 PHE n 1 162 TYR n 1 163 TYR n 1 164 ALA n 1 165 LYS n 1 166 VAL n 1 167 ALA n 1 168 SER n 1 169 VAL n 1 170 THR n 1 171 ASP n 1 172 ALA n 1 173 GLY n 1 174 VAL n 1 175 GLN n 1 176 PRO n 1 177 VAL n 1 178 TYR n 1 179 SER n 1 180 LEU n 1 181 ARG n 1 182 VAL n 1 183 ASP n 1 184 ALA n 1 185 CYS n 1 186 ASP n 1 187 TIH n 1 188 ALA n 1 189 PHE n 1 190 ILE n 1 191 THR n 1 192 ASN n 1 193 GLY n 1 194 PHE n 1 195 VAL n 1 196 SER n 1 197 HIS n 1 198 ASN n 1 199 THR n 1 200 GLU n 1 201 ALA n 1 202 PRO n 2 1 ALA n 2 2 MET n 2 3 ARG n 2 4 TYR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 202 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene gyrA _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mycobacterium xenopi' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 1789 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num ? _pdbx_entity_src_syn.pdbx_end_seq_num ? _pdbx_entity_src_syn.organism_scientific 'Mycobacterium xenopi' _pdbx_entity_src_syn.organism_common_name ? _pdbx_entity_src_syn.ncbi_taxonomy_id 1789 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin _struct_ref.pdbx_db_isoform 1 UNP GYRA_MYCXE P72065 1 ;CITGDALVALPEGESVRIADIVPGARPNSDNAIDLKVLDRHGNPVLADRLFHSGEHPVYTVRTVEGLRVTGTANHPLLCL VDVAGVPTLLWKLIDEIKPGDYAVIQRSAFSVDCAGFARGKPEFAPTTYTVGVPGLVRFLEAHHRDPDAQAIADELTDGR FYYAKVASVTDAGVQPVYSLRVDTADHAFITNGFVSHNTEAP ; 66 ? 2 UNP GYRA_MYCXE P72065 2 AMRY 62 ? # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4OZ6 A 1 ? 202 ? P72065 66 ? 267 ? 1 202 2 2 4OZ6 B 1 ? 4 ? P72065 62 ? 65 ? 62 65 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4OZ6 ALA A 1 ? UNP P72065 CYS 66 'engineered mutation' 1 1 1 4OZ6 ALA A 184 ? UNP P72065 THR 249 'engineered mutation' 184 2 1 4OZ6 CYS A 185 ? UNP P72065 ALA 250 'engineered mutation' 185 3 1 4OZ6 TIH A 187 ? UNP P72065 HIS 252 'engineered mutation' 187 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TIH 'L-peptide linking' n 'BETA(2-THIENYL)ALANINE' ? 'C7 H9 N O2 S' 171.217 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu . _exptl.absorpt_correction_T_max . _exptl.absorpt_correction_T_min . _exptl.absorpt_correction_type . _exptl.absorpt_process_details . _exptl.entry_id 4OZ6 _exptl.crystals_number 1 _exptl.details . _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details . # _exptl_crystal.colour . _exptl_crystal.density_diffrn . _exptl_crystal.density_Matthews 2.17 _exptl_crystal.density_method . _exptl_crystal.density_percent_sol 43.20 _exptl_crystal.description 'Chunk-like, approximately 100 X 100 microns. Numerous cracks present throughout.' _exptl_crystal.F_000 . _exptl_crystal.id 1 _exptl_crystal.preparation . _exptl_crystal.size_max . _exptl_crystal.size_mid . _exptl_crystal.size_min . _exptl_crystal.size_rad . _exptl_crystal.colour_lustre . _exptl_crystal.colour_modifier . _exptl_crystal.colour_primary . _exptl_crystal.density_meas . _exptl_crystal.density_meas_esd . _exptl_crystal.density_meas_gt . _exptl_crystal.density_meas_lt . _exptl_crystal.density_meas_temp . _exptl_crystal.density_meas_temp_esd . _exptl_crystal.density_meas_temp_gt . _exptl_crystal.density_meas_temp_lt . _exptl_crystal.pdbx_crystal_image_url . _exptl_crystal.pdbx_crystal_image_format . _exptl_crystal.pdbx_mosaicity . _exptl_crystal.pdbx_mosaicity_esd . # _exptl_crystal_grow.apparatus . _exptl_crystal_grow.atmosphere . _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details . _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref . _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure . _exptl_crystal_grow.pressure_esd . _exptl_crystal_grow.seeding . _exptl_crystal_grow.seeding_ref . _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details . _exptl_crystal_grow.temp_esd . _exptl_crystal_grow.time . _exptl_crystal_grow.pdbx_details ;Crystals were obtained by mixing 1 ul of protein with 1 ul of crystallization solution (100mM sodium cacodylate, pH 6.5, 200mM magnesium acetate, and 20% (w/v) PEG 8000. ; _exptl_crystal_grow.pdbx_pH_range . # _diffrn.ambient_environment . _diffrn.ambient_temp 100 _diffrn.ambient_temp_details . _diffrn.ambient_temp_esd . _diffrn.crystal_id 1 _diffrn.crystal_support . _diffrn.crystal_treatment . _diffrn.details . _diffrn.id 1 _diffrn.ambient_pressure . _diffrn.ambient_pressure_esd . _diffrn.ambient_pressure_gt . _diffrn.ambient_pressure_lt . _diffrn.ambient_temp_gt . _diffrn.ambient_temp_lt . # _diffrn_detector.details . _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean . _diffrn_detector.dtime . _diffrn_detector.pdbx_frames_total . _diffrn_detector.pdbx_collection_time_total . _diffrn_detector.pdbx_collection_date 2011-03-25 # _diffrn_radiation.collimation . _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge . _diffrn_radiation.inhomogeneity . _diffrn_radiation.monochromator . _diffrn_radiation.polarisn_norm . _diffrn_radiation.polarisn_ratio . _diffrn_radiation.probe . _diffrn_radiation.type . _diffrn_radiation.xray_symbol . _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l . _diffrn_radiation.pdbx_wavelength_list . _diffrn_radiation.pdbx_wavelength . _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer . _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97923 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current . _diffrn_source.details . _diffrn_source.diffrn_id 1 _diffrn_source.power . _diffrn_source.size . _diffrn_source.source SYNCHROTRON _diffrn_source.target . _diffrn_source.type 'APS BEAMLINE 24-ID-E' _diffrn_source.voltage . _diffrn_source.take-off_angle . _diffrn_source.pdbx_wavelength_list 0.97923 _diffrn_source.pdbx_wavelength . _diffrn_source.pdbx_synchrotron_beamline 24-ID-E _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate 37.300 _reflns.entry_id 4OZ6 _reflns.data_reduction_details . _reflns.data_reduction_method . _reflns.d_resolution_high 2.78 _reflns.d_resolution_low 50.00 _reflns.details . _reflns.limit_h_max . _reflns.limit_h_min . _reflns.limit_k_max . _reflns.limit_k_min . _reflns.limit_l_max . _reflns.limit_l_min . _reflns.number_all ? _reflns.number_obs 5310 _reflns.observed_criterion . _reflns.observed_criterion_F_max . _reflns.observed_criterion_F_min . _reflns.observed_criterion_I_max . _reflns.observed_criterion_I_min . _reflns.observed_criterion_sigma_F . _reflns.observed_criterion_sigma_I . _reflns.percent_possible_obs 99.7 _reflns.R_free_details . _reflns.Rmerge_F_all . _reflns.Rmerge_F_obs . _reflns.Friedel_coverage . _reflns.number_gt . _reflns.threshold_expression . _reflns.pdbx_redundancy 8.7 _reflns.pdbx_Rmerge_I_obs . _reflns.pdbx_Rmerge_I_all . _reflns.pdbx_Rsym_value 0.059 _reflns.pdbx_netI_over_av_sigmaI . _reflns.pdbx_netI_over_sigmaI 39.6 _reflns.pdbx_res_netI_over_av_sigmaI_2 . _reflns.pdbx_res_netI_over_sigmaI_2 . _reflns.pdbx_chi_squared . _reflns.pdbx_scaling_rejects . _reflns.pdbx_d_res_high_opt . _reflns.pdbx_d_res_low_opt . _reflns.pdbx_d_res_opt_method . _reflns.phase_calculation_details . _reflns.pdbx_Rrim_I_all . _reflns.pdbx_Rpim_I_all . _reflns.pdbx_d_opt . _reflns.pdbx_number_measured_all . _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _reflns_shell.d_res_high 2.78 _reflns_shell.d_res_low 2.88 _reflns_shell.meanI_over_sigI_all . _reflns_shell.meanI_over_sigI_obs 9.7 _reflns_shell.number_measured_all . _reflns_shell.number_measured_obs . _reflns_shell.number_possible . _reflns_shell.number_unique_all . _reflns_shell.number_unique_obs . _reflns_shell.percent_possible_all 96.4 _reflns_shell.percent_possible_obs . _reflns_shell.Rmerge_F_all . _reflns_shell.Rmerge_F_obs . _reflns_shell.Rmerge_I_all . _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt . _reflns_shell.meanI_over_uI_all . _reflns_shell.meanI_over_uI_gt . _reflns_shell.number_measured_gt . _reflns_shell.number_unique_gt . _reflns_shell.percent_possible_gt . _reflns_shell.Rmerge_F_gt . _reflns_shell.Rmerge_I_gt . _reflns_shell.pdbx_redundancy 7.2 _reflns_shell.pdbx_Rsym_value 0.188 _reflns_shell.pdbx_chi_squared . _reflns_shell.pdbx_netI_over_sigmaI_all . _reflns_shell.pdbx_netI_over_sigmaI_obs . _reflns_shell.pdbx_Rrim_I_all . _reflns_shell.pdbx_Rpim_I_all . _reflns_shell.pdbx_rejects . _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.aniso_B[1][1] 1.1952 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] -0.0000 _refine.aniso_B[2][2] 1.1952 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] -2.3903 _refine.B_iso_max 81.380 _refine.B_iso_mean 35.9400 _refine.B_iso_min 15.470 _refine.correlation_coeff_Fo_to_Fc . _refine.correlation_coeff_Fo_to_Fc_free . _refine.details . _refine.diff_density_max . _refine.diff_density_max_esd . _refine.diff_density_min . _refine.diff_density_min_esd . _refine.diff_density_rms . _refine.diff_density_rms_esd . _refine.entry_id 4OZ6 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details . _refine.ls_abs_structure_Flack . _refine.ls_abs_structure_Flack_esd . _refine.ls_abs_structure_Rogers . _refine.ls_abs_structure_Rogers_esd . _refine.ls_d_res_high 2.7860 _refine.ls_d_res_low 40.4890 _refine.ls_extinction_coef . _refine.ls_extinction_coef_esd . _refine.ls_extinction_expression . _refine.ls_extinction_method . _refine.ls_goodness_of_fit_all . _refine.ls_goodness_of_fit_all_esd . _refine.ls_goodness_of_fit_obs . _refine.ls_goodness_of_fit_obs_esd . _refine.ls_hydrogen_treatment . _refine.ls_matrix_type . _refine.ls_number_constraints . _refine.ls_number_parameters . _refine.ls_number_reflns_all . _refine.ls_number_reflns_obs 5236 _refine.ls_number_reflns_R_free 241 _refine.ls_number_reflns_R_work 4995 _refine.ls_number_restraints . _refine.ls_percent_reflns_obs 98.8900 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_R_factor_all . _refine.ls_R_factor_obs 0.2314 _refine.ls_R_factor_R_free 0.2617 _refine.ls_R_factor_R_free_error . _refine.ls_R_factor_R_free_error_details . _refine.ls_R_factor_R_work 0.2298 _refine.ls_R_Fsqd_factor_obs . _refine.ls_R_I_factor_obs . _refine.ls_redundancy_reflns_all . _refine.ls_redundancy_reflns_obs . _refine.ls_restrained_S_all . _refine.ls_restrained_S_obs . _refine.ls_shift_over_esd_max . _refine.ls_shift_over_esd_mean . _refine.ls_structure_factor_coef . _refine.ls_weighting_details . _refine.ls_weighting_scheme . _refine.ls_wR_factor_all . _refine.ls_wR_factor_obs . _refine.ls_wR_factor_R_free . _refine.ls_wR_factor_R_work . _refine.occupancy_max . _refine.occupancy_min . _refine.overall_SU_B . _refine.overall_SU_ML 0.4000 _refine.overall_SU_R_Cruickshank_DPI . _refine.overall_SU_R_free . _refine.overall_FOM_free_R_set . _refine.overall_FOM_work_R_set 0.8037 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol 23.2830 _refine.solvent_model_param_ksol 0.3470 _refine.ls_R_factor_gt . _refine.ls_goodness_of_fit_gt . _refine.ls_goodness_of_fit_ref . _refine.ls_shift_over_su_max . _refine.ls_shift_over_su_max_lt . _refine.ls_shift_over_su_mean . _refine.ls_shift_over_su_mean_lt . _refine.pdbx_ls_sigma_I . _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd . _refine.pdbx_data_cutoff_high_absF . _refine.pdbx_data_cutoff_high_rms_absF . _refine.pdbx_data_cutoff_low_absF . _refine.pdbx_isotropic_thermal_model . _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1AM2 _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case . _refine.pdbx_overall_ESU_R . _refine.pdbx_overall_ESU_R_Free . _refine.pdbx_solvent_vdw_probe_radii 1.0000 _refine.pdbx_solvent_ion_probe_radii . _refine.pdbx_solvent_shrinkage_radii 0.7200 _refine.pdbx_real_space_R . _refine.pdbx_density_correlation . _refine.pdbx_pd_number_of_powder_patterns . _refine.pdbx_pd_number_of_points . _refine.pdbx_pd_meas_number_of_points . _refine.pdbx_pd_proc_ls_prof_R_factor . _refine.pdbx_pd_proc_ls_prof_wR_factor . _refine.pdbx_pd_Marquardt_correlation_coeff . _refine.pdbx_pd_Fsqrd_R_factor . _refine.pdbx_pd_ls_matrix_band_width . _refine.pdbx_overall_phase_error 24.8000 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI . _refine.pdbx_overall_SU_R_free_Blow_DPI . _refine.pdbx_overall_SU_R_Blow_DPI . _refine.pdbx_TLS_residual_ADP_flag . _refine.pdbx_diffrn_id 1 # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.7860 _refine_hist.d_res_low 40.4890 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 29 _refine_hist.number_atoms_total 1342 _refine_hist.pdbx_B_iso_mean_ligand 24.27 _refine_hist.pdbx_B_iso_mean_solvent 27.85 _refine_hist.pdbx_number_atoms_protein 1312 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' . 0.003 . 1339 . f_bond_d . . 'X-RAY DIFFRACTION' . 0.770 . 1831 . f_angle_d . . 'X-RAY DIFFRACTION' . 0.049 . 220 . f_chiral_restr . . 'X-RAY DIFFRACTION' . 0.003 . 238 . f_plane_restr . . 'X-RAY DIFFRACTION' . 14.204 . 465 . f_dihedral_angle_d . . # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error 'X-RAY DIFFRACTION' 2.786 3.5103 2515 . 119 2396 98.0000 . . . 0.2972 . 0.2454 . . . . . . 2 . 'X-RAY DIFFRACTION' 3.5103 40.4931 2721 . 122 2599 100.0000 . . . 0.2447 . 0.2219 . . . . . . 2 . # _struct.entry_id 4OZ6 _struct.title 'Structure of the Branched Intermediate in Protein Splicing' _struct.pdbx_model_details . _struct.pdbx_formula_weight . _struct.pdbx_formula_weight_method . _struct.pdbx_model_type_details . _struct.pdbx_CASP_flag . # _struct_keywords.entry_id 4OZ6 _struct_keywords.text 'Intein, ISOMERASE' _struct_keywords.pdbx_keywords ISOMERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 95 ? ILE A 97 ? ASP A 95 ILE A 97 5 ? 3 HELX_P HELX_P2 AA2 ALA A 151 ? LEU A 156 ? ALA A 151 LEU A 156 1 ? 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A ASP 186 C ? ? ? 1_555 A TIH 187 N ? ? A ASP 186 A TIH 187 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale2 covale both ? A TIH 187 C ? ? ? 1_555 A ALA 188 N ? ? A TIH 187 A ALA 188 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale3 covale one ? A THR 199 OG1 ? ? ? 1_555 B TYR 4 C ? ? A THR 199 B TYR 65 1_555 ? ? ? ? ? ? ? 1.360 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 6 ? AA2 ? 4 ? AA3 ? 2 ? AA4 ? 2 ? AA5 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel AA5 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 29 ? LEU A 38 ? SER A 29 LEU A 38 AA1 2 PRO A 44 ? THR A 63 ? PRO A 44 THR A 63 AA1 3 ARG A 68 ? GLY A 71 ? ARG A 68 GLY A 71 AA1 4 ILE A 2 ? THR A 3 ? ILE A 2 THR A 3 AA1 5 TYR A 163 ? VAL A 182 ? TYR A 163 VAL A 182 AA1 6 TYR A 102 ? VAL A 104 ? TYR A 102 VAL A 104 AA2 1 SER A 29 ? LEU A 38 ? SER A 29 LEU A 38 AA2 2 PRO A 44 ? THR A 63 ? PRO A 44 THR A 63 AA2 3 TYR A 163 ? VAL A 182 ? TYR A 163 VAL A 182 AA2 4 TYR A 102 ? VAL A 104 ? TYR A 102 VAL A 104 AA3 1 LEU A 7 ? ALA A 9 ? LEU A 7 ALA A 9 AA3 2 SER A 15 ? ARG A 17 ? SER A 15 ARG A 17 AA4 1 PRO A 76 ? ASP A 82 ? PRO A 76 ASP A 82 AA4 2 PRO A 87 ? LEU A 93 ? PRO A 87 LEU A 93 AA5 1 ALA A 188 ? THR A 191 ? ALA A 188 THR A 191 AA5 2 PHE A 194 ? HIS A 197 ? PHE A 194 HIS A 197 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N VAL A 37 ? N VAL A 37 O VAL A 45 ? O VAL A 45 AA1 2 3 N VAL A 61 ? N VAL A 61 O VAL A 69 ? O VAL A 69 AA1 3 4 O THR A 70 ? O THR A 70 N THR A 3 ? N THR A 3 AA1 4 5 N ILE A 2 ? N ILE A 2 O TYR A 178 ? O TYR A 178 AA1 5 6 O ALA A 164 ? O ALA A 164 N ALA A 103 ? N ALA A 103 AA2 1 2 N VAL A 37 ? N VAL A 37 O VAL A 45 ? O VAL A 45 AA2 2 3 N PHE A 51 ? N PHE A 51 O SER A 179 ? O SER A 179 AA2 3 4 O ALA A 164 ? O ALA A 164 N ALA A 103 ? N ALA A 103 AA3 1 2 N VAL A 8 ? N VAL A 8 O VAL A 16 ? O VAL A 16 AA4 1 2 N CYS A 79 ? N CYS A 79 O LEU A 90 ? O LEU A 90 AA5 1 2 N PHE A 189 ? N PHE A 189 O SER A 196 ? O SER A 196 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MG 301 ? 4 'binding site for residue MG A 301' AC2 Software B ALA 62 ? 6 'binding site for chain B of ALA-MET-ARG-TYR' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ILE A 94 ? ILE A 94 . ? 1_555 ? 2 AC1 4 ASP A 95 ? ASP A 95 . ? 1_555 ? 3 AC1 4 ILE A 97 ? ILE A 97 . ? 1_555 ? 4 AC1 4 VAL A 169 ? VAL A 169 . ? 1_555 ? 5 AC2 6 VAL A 64 ? VAL A 64 . ? 4_554 ? 6 AC2 6 ASN A 74 ? ASN A 74 . ? 1_555 ? 7 AC2 6 THR A 199 ? THR A 199 . ? 1_555 ? 8 AC2 6 GLU A 200 ? GLU A 200 . ? 1_555 ? 9 AC2 6 ALA A 201 ? ALA A 201 . ? 1_555 ? 10 AC2 6 HOH D . ? HOH A 401 . ? 4_554 ? # _atom_sites.entry_id 4OZ6 _atom_sites.fract_transf_matrix[1][1] 0.017022 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017022 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.008948 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C MG N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 1 1 ALA ALA A . n A 1 2 ILE 2 2 2 ILE ILE A . n A 1 3 THR 3 3 3 THR THR A . n A 1 4 GLY 4 4 4 GLY GLY A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 ALA 6 6 6 ALA ALA A . n A 1 7 LEU 7 7 7 LEU LEU A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 LEU 10 10 10 LEU LEU A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLU 14 14 14 GLU GLU A . n A 1 15 SER 15 15 15 SER SER A . n A 1 16 VAL 16 16 16 VAL VAL A . n A 1 17 ARG 17 17 17 ARG ARG A . n A 1 18 ILE 18 18 18 ILE ILE A . n A 1 19 ALA 19 19 19 ALA ALA A . n A 1 20 ASP 20 20 20 ASP ASP A . n A 1 21 ILE 21 21 21 ILE ILE A . n A 1 22 VAL 22 22 22 VAL VAL A . n A 1 23 PRO 23 23 23 PRO PRO A . n A 1 24 GLY 24 24 24 GLY GLY A . n A 1 25 ALA 25 25 25 ALA ALA A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 PRO 27 27 27 PRO PRO A . n A 1 28 ASN 28 28 28 ASN ASN A . n A 1 29 SER 29 29 29 SER SER A . n A 1 30 ASP 30 30 30 ASP ASP A . n A 1 31 ASN 31 31 31 ASN ASN A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 LYS 36 36 36 LYS LYS A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 LEU 38 38 38 LEU LEU A . n A 1 39 ASP 39 39 39 ASP ASP A . n A 1 40 ARG 40 40 40 ARG ARG A . n A 1 41 HIS 41 41 41 HIS HIS A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 ASN 43 43 43 ASN ASN A . n A 1 44 PRO 44 44 44 PRO PRO A . n A 1 45 VAL 45 45 45 VAL VAL A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 ARG 49 49 49 ARG ARG A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 PHE 51 51 51 PHE PHE A . n A 1 52 HIS 52 52 52 HIS HIS A . n A 1 53 SER 53 53 53 SER SER A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLU 55 55 55 GLU GLU A . n A 1 56 HIS 56 56 56 HIS HIS A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 VAL 58 58 58 VAL VAL A . n A 1 59 TYR 59 59 59 TYR TYR A . n A 1 60 THR 60 60 60 THR THR A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 ARG 62 62 62 ARG ARG A . n A 1 63 THR 63 63 63 THR THR A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ARG 68 68 68 ARG ARG A . n A 1 69 VAL 69 69 69 VAL VAL A . n A 1 70 THR 70 70 70 THR THR A . n A 1 71 GLY 71 71 71 GLY GLY A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ASN 74 74 74 ASN ASN A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 PRO 76 76 76 PRO PRO A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 LEU 78 78 78 LEU LEU A . n A 1 79 CYS 79 79 79 CYS CYS A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 VAL 81 81 81 VAL VAL A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 VAL 83 83 83 VAL VAL A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 GLY 85 85 85 GLY GLY A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 PRO 87 87 87 PRO PRO A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 LEU 90 90 90 LEU LEU A . n A 1 91 TRP 91 91 91 TRP TRP A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 ILE 94 94 94 ILE ILE A . n A 1 95 ASP 95 95 95 ASP ASP A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ILE 97 97 97 ILE ILE A . n A 1 98 LYS 98 98 98 LYS LYS A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 ASP 101 101 101 ASP ASP A . n A 1 102 TYR 102 102 102 TYR TYR A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 VAL 104 104 104 VAL VAL A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 GLN 106 106 106 GLN GLN A . n A 1 107 ARG 107 107 107 ARG ARG A . n A 1 108 SER 108 108 108 SER SER A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 PHE 110 110 110 PHE PHE A . n A 1 111 SER 111 111 ? ? ? A . n A 1 112 VAL 112 112 ? ? ? A . n A 1 113 ASP 113 113 ? ? ? A . n A 1 114 CYS 114 114 ? ? ? A . n A 1 115 ALA 115 115 ? ? ? A . n A 1 116 GLY 116 116 ? ? ? A . n A 1 117 PHE 117 117 ? ? ? A . n A 1 118 ALA 118 118 ? ? ? A . n A 1 119 ARG 119 119 ? ? ? A . n A 1 120 GLY 120 120 ? ? ? A . n A 1 121 LYS 121 121 ? ? ? A . n A 1 122 PRO 122 122 ? ? ? A . n A 1 123 GLU 123 123 ? ? ? A . n A 1 124 PHE 124 124 ? ? ? A . n A 1 125 ALA 125 125 ? ? ? A . n A 1 126 PRO 126 126 ? ? ? A . n A 1 127 THR 127 127 ? ? ? A . n A 1 128 THR 128 128 ? ? ? A . n A 1 129 TYR 129 129 ? ? ? A . n A 1 130 THR 130 130 ? ? ? A . n A 1 131 VAL 131 131 ? ? ? A . n A 1 132 GLY 132 132 ? ? ? A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 PRO 134 134 134 PRO PRO A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 VAL 137 137 137 VAL VAL A . n A 1 138 ARG 138 138 138 ARG ARG A . n A 1 139 PHE 139 139 139 PHE PHE A . n A 1 140 LEU 140 140 140 LEU LEU A . n A 1 141 GLU 141 141 ? ? ? A . n A 1 142 ALA 142 142 ? ? ? A . n A 1 143 HIS 143 143 ? ? ? A . n A 1 144 HIS 144 144 ? ? ? A . n A 1 145 ARG 145 145 ? ? ? A . n A 1 146 ASP 146 146 ? ? ? A . n A 1 147 PRO 147 147 ? ? ? A . n A 1 148 ASP 148 148 ? ? ? A . n A 1 149 ALA 149 149 149 ALA ALA A . n A 1 150 GLN 150 150 150 GLN GLN A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 ILE 152 152 152 ILE ILE A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 ASP 154 154 154 ASP ASP A . n A 1 155 GLU 155 155 155 GLU GLU A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 THR 157 157 157 THR THR A . n A 1 158 ASP 158 158 158 ASP ASP A . n A 1 159 GLY 159 159 159 GLY GLY A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 PHE 161 161 161 PHE PHE A . n A 1 162 TYR 162 162 162 TYR TYR A . n A 1 163 TYR 163 163 163 TYR TYR A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LYS 165 165 165 LYS LYS A . n A 1 166 VAL 166 166 166 VAL VAL A . n A 1 167 ALA 167 167 167 ALA ALA A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 VAL 169 169 169 VAL VAL A . n A 1 170 THR 170 170 170 THR THR A . n A 1 171 ASP 171 171 171 ASP ASP A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 GLY 173 173 173 GLY GLY A . n A 1 174 VAL 174 174 174 VAL VAL A . n A 1 175 GLN 175 175 175 GLN GLN A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 VAL 177 177 177 VAL VAL A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 SER 179 179 179 SER SER A . n A 1 180 LEU 180 180 180 LEU LEU A . n A 1 181 ARG 181 181 181 ARG ARG A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 ALA 184 184 184 ALA ALA A . n A 1 185 CYS 185 185 185 CYS CYS A . n A 1 186 ASP 186 186 186 ASP ASP A . n A 1 187 TIH 187 187 187 TIH TIH A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 PHE 189 189 189 PHE PHE A . n A 1 190 ILE 190 190 190 ILE ILE A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 ASN 192 192 192 ASN ASN A . n A 1 193 GLY 193 193 193 GLY GLY A . n A 1 194 PHE 194 194 194 PHE PHE A . n A 1 195 VAL 195 195 195 VAL VAL A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 HIS 197 197 197 HIS HIS A . n A 1 198 ASN 198 198 198 ASN ASN A . n A 1 199 THR 199 199 199 THR THR A . n A 1 200 GLU 200 200 200 GLU GLU A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 PRO 202 202 202 PRO PRO A . n B 2 1 ALA 1 62 62 ALA ALA B . n B 2 2 MET 2 63 63 MET MET B . n B 2 3 ARG 3 64 64 ARG ARG B . n B 2 4 TYR 4 65 65 TYR TYR B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 MG 1 301 1 MG MG A . D 4 HOH 1 401 28 HOH HOH A . D 4 HOH 2 402 3 HOH HOH A . D 4 HOH 3 403 2 HOH HOH A . D 4 HOH 4 404 16 HOH HOH A . D 4 HOH 5 405 15 HOH HOH A . D 4 HOH 6 406 26 HOH HOH A . D 4 HOH 7 407 27 HOH HOH A . D 4 HOH 8 408 5 HOH HOH A . D 4 HOH 9 409 18 HOH HOH A . D 4 HOH 10 410 12 HOH HOH A . D 4 HOH 11 411 14 HOH HOH A . D 4 HOH 12 412 29 HOH HOH A . D 4 HOH 13 413 1 HOH HOH A . D 4 HOH 14 414 4 HOH HOH A . D 4 HOH 15 415 6 HOH HOH A . D 4 HOH 16 416 7 HOH HOH A . D 4 HOH 17 417 8 HOH HOH A . D 4 HOH 18 418 9 HOH HOH A . D 4 HOH 19 419 10 HOH HOH A . D 4 HOH 20 420 11 HOH HOH A . D 4 HOH 21 421 13 HOH HOH A . D 4 HOH 22 422 17 HOH HOH A . D 4 HOH 23 423 19 HOH HOH A . D 4 HOH 24 424 20 HOH HOH A . D 4 HOH 25 425 21 HOH HOH A . D 4 HOH 26 426 22 HOH HOH A . D 4 HOH 27 427 23 HOH HOH A . D 4 HOH 28 428 24 HOH HOH A . D 4 HOH 29 429 25 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 570 ? 1 MORE -10 ? 1 'SSA (A^2)' 8230 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-05-14 2 'Structure model' 1 1 2014-07-16 3 'Structure model' 1 2 2017-09-27 4 'Structure model' 1 3 2019-12-04 5 'Structure model' 1 4 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 3 'Structure model' 'Refinement description' 7 3 'Structure model' 'Source and taxonomy' 8 3 'Structure model' 'Structure summary' 9 4 'Structure model' 'Author supporting evidence' 10 5 'Structure model' 'Data collection' 11 5 'Structure model' 'Database references' 12 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' entity 3 3 'Structure model' entity_src_gen 4 3 'Structure model' pdbx_audit_support 5 3 'Structure model' pdbx_database_status 6 3 'Structure model' pdbx_entity_src_syn 7 3 'Structure model' pdbx_struct_assembly 8 3 'Structure model' pdbx_struct_oper_list 9 3 'Structure model' software 10 3 'Structure model' struct_keywords 11 3 'Structure model' symmetry 12 4 'Structure model' pdbx_audit_support 13 5 'Structure model' chem_comp_atom 14 5 'Structure model' chem_comp_bond 15 5 'Structure model' database_2 16 5 'Structure model' pdbx_initial_refinement_model 17 5 'Structure model' refine_hist # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_entity.src_method' 3 3 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 4 3 'Structure model' '_pdbx_audit_support.funding_organization' 5 3 'Structure model' '_pdbx_database_status.pdb_format_compatible' 6 3 'Structure model' '_pdbx_entity_src_syn.pdbx_alt_source_flag' 7 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 8 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 9 3 'Structure model' '_software.classification' 10 3 'Structure model' '_struct_keywords.text' 11 3 'Structure model' '_symmetry.Int_Tables_number' 12 4 'Structure model' '_pdbx_audit_support.funding_organization' 13 5 'Structure model' '_database_2.pdbx_DOI' 14 5 'Structure model' '_database_2.pdbx_database_accession' 15 5 'Structure model' '_refine_hist.pdbx_number_atoms_nucleic_acid' 16 5 'Structure model' '_refine_hist.pdbx_number_atoms_protein' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' . . . . . . . . . . . HKL-2000 . . . . 1 ? 'data extraction' . . . . . . . . . . . PDB_EXTRACT . . . 3.14 2 ? refinement . . . . . . . . . . . PHENIX . . . '(phenix.refine: 1.7_650)' 3 ? phasing . . . . . . . . . . . PHASER . . . . 4 # _pdbx_entry_details.compound_details ? _pdbx_entry_details.entry_id 4OZ6 _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ;Author stated that residues 185-202 of chain A were synthesized as a single peptide first and then ligated to residues 1-184 of Chain A to form the full-length protein. ; _pdbx_entry_details.source_details ? _pdbx_entry_details.has_ligand_of_interest ? # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 99 ? ? -47.36 151.39 2 1 ALA A 153 ? ? -79.43 32.32 3 1 ASP A 158 ? ? -38.00 -37.89 4 1 ASN A 198 ? ? -49.83 150.84 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 14 ? CD ? A GLU 14 CD 2 1 Y 1 A GLU 14 ? OE1 ? A GLU 14 OE1 3 1 Y 1 A GLU 14 ? OE2 ? A GLU 14 OE2 4 1 Y 1 A ARG 26 ? NE ? A ARG 26 NE 5 1 Y 1 A ARG 26 ? CZ ? A ARG 26 CZ 6 1 Y 1 A ARG 26 ? NH1 ? A ARG 26 NH1 7 1 Y 1 A ARG 26 ? NH2 ? A ARG 26 NH2 8 1 Y 1 A PHE 110 ? CG ? A PHE 110 CG 9 1 Y 1 A PHE 110 ? CD1 ? A PHE 110 CD1 10 1 Y 1 A PHE 110 ? CD2 ? A PHE 110 CD2 11 1 Y 1 A PHE 110 ? CE1 ? A PHE 110 CE1 12 1 Y 1 A PHE 110 ? CE2 ? A PHE 110 CE2 13 1 Y 1 A PHE 110 ? CZ ? A PHE 110 CZ 14 1 Y 1 A ARG 138 ? CG ? A ARG 138 CG 15 1 Y 1 A ARG 138 ? CD ? A ARG 138 CD 16 1 Y 1 A ARG 138 ? NE ? A ARG 138 NE 17 1 Y 1 A ARG 138 ? CZ ? A ARG 138 CZ 18 1 Y 1 A ARG 138 ? NH1 ? A ARG 138 NH1 19 1 Y 1 A ARG 138 ? NH2 ? A ARG 138 NH2 20 1 Y 1 B MET 63 ? CG ? B MET 2 CG 21 1 Y 1 B MET 63 ? SD ? B MET 2 SD 22 1 Y 1 B MET 63 ? CE ? B MET 2 CE 23 1 Y 1 B ARG 64 ? CG ? B ARG 3 CG 24 1 Y 1 B ARG 64 ? CD ? B ARG 3 CD 25 1 Y 1 B ARG 64 ? NE ? B ARG 3 NE 26 1 Y 1 B ARG 64 ? CZ ? B ARG 3 CZ 27 1 Y 1 B ARG 64 ? NH1 ? B ARG 3 NH1 28 1 Y 1 B ARG 64 ? NH2 ? B ARG 3 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 111 ? A SER 111 2 1 Y 1 A VAL 112 ? A VAL 112 3 1 Y 1 A ASP 113 ? A ASP 113 4 1 Y 1 A CYS 114 ? A CYS 114 5 1 Y 1 A ALA 115 ? A ALA 115 6 1 Y 1 A GLY 116 ? A GLY 116 7 1 Y 1 A PHE 117 ? A PHE 117 8 1 Y 1 A ALA 118 ? A ALA 118 9 1 Y 1 A ARG 119 ? A ARG 119 10 1 Y 1 A GLY 120 ? A GLY 120 11 1 Y 1 A LYS 121 ? A LYS 121 12 1 Y 1 A PRO 122 ? A PRO 122 13 1 Y 1 A GLU 123 ? A GLU 123 14 1 Y 1 A PHE 124 ? A PHE 124 15 1 Y 1 A ALA 125 ? A ALA 125 16 1 Y 1 A PRO 126 ? A PRO 126 17 1 Y 1 A THR 127 ? A THR 127 18 1 Y 1 A THR 128 ? A THR 128 19 1 Y 1 A TYR 129 ? A TYR 129 20 1 Y 1 A THR 130 ? A THR 130 21 1 Y 1 A VAL 131 ? A VAL 131 22 1 Y 1 A GLY 132 ? A GLY 132 23 1 Y 1 A GLU 141 ? A GLU 141 24 1 Y 1 A ALA 142 ? A ALA 142 25 1 Y 1 A HIS 143 ? A HIS 143 26 1 Y 1 A HIS 144 ? A HIS 144 27 1 Y 1 A ARG 145 ? A ARG 145 28 1 Y 1 A ASP 146 ? A ASP 146 29 1 Y 1 A PRO 147 ? A PRO 147 30 1 Y 1 A ASP 148 ? A ASP 148 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MG MG MG N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 SER N N N N 291 SER CA C N S 292 SER C C N N 293 SER O O N N 294 SER CB C N N 295 SER OG O N N 296 SER OXT O N N 297 SER H H N N 298 SER H2 H N N 299 SER HA H N N 300 SER HB2 H N N 301 SER HB3 H N N 302 SER HG H N N 303 SER HXT H N N 304 THR N N N N 305 THR CA C N S 306 THR C C N N 307 THR O O N N 308 THR CB C N R 309 THR OG1 O N N 310 THR CG2 C N N 311 THR OXT O N N 312 THR H H N N 313 THR H2 H N N 314 THR HA H N N 315 THR HB H N N 316 THR HG1 H N N 317 THR HG21 H N N 318 THR HG22 H N N 319 THR HG23 H N N 320 THR HXT H N N 321 TIH N N N N 322 TIH CA C N S 323 TIH C C N N 324 TIH O O N N 325 TIH OXT O N N 326 TIH CB C N N 327 TIH CG C Y N 328 TIH CD C Y N 329 TIH CE1 C Y N 330 TIH CE2 C Y N 331 TIH SD S Y N 332 TIH H H N N 333 TIH H2 H N N 334 TIH HA H N N 335 TIH HXT H N N 336 TIH HB2 H N N 337 TIH HB3 H N N 338 TIH HD H N N 339 TIH HE1 H N N 340 TIH HE2 H N N 341 TRP N N N N 342 TRP CA C N S 343 TRP C C N N 344 TRP O O N N 345 TRP CB C N N 346 TRP CG C Y N 347 TRP CD1 C Y N 348 TRP CD2 C Y N 349 TRP NE1 N Y N 350 TRP CE2 C Y N 351 TRP CE3 C Y N 352 TRP CZ2 C Y N 353 TRP CZ3 C Y N 354 TRP CH2 C Y N 355 TRP OXT O N N 356 TRP H H N N 357 TRP H2 H N N 358 TRP HA H N N 359 TRP HB2 H N N 360 TRP HB3 H N N 361 TRP HD1 H N N 362 TRP HE1 H N N 363 TRP HE3 H N N 364 TRP HZ2 H N N 365 TRP HZ3 H N N 366 TRP HH2 H N N 367 TRP HXT H N N 368 TYR N N N N 369 TYR CA C N S 370 TYR C C N N 371 TYR O O N N 372 TYR CB C N N 373 TYR CG C Y N 374 TYR CD1 C Y N 375 TYR CD2 C Y N 376 TYR CE1 C Y N 377 TYR CE2 C Y N 378 TYR CZ C Y N 379 TYR OH O N N 380 TYR OXT O N N 381 TYR H H N N 382 TYR H2 H N N 383 TYR HA H N N 384 TYR HB2 H N N 385 TYR HB3 H N N 386 TYR HD1 H N N 387 TYR HD2 H N N 388 TYR HE1 H N N 389 TYR HE2 H N N 390 TYR HH H N N 391 TYR HXT H N N 392 VAL N N N N 393 VAL CA C N S 394 VAL C C N N 395 VAL O O N N 396 VAL CB C N N 397 VAL CG1 C N N 398 VAL CG2 C N N 399 VAL OXT O N N 400 VAL H H N N 401 VAL H2 H N N 402 VAL HA H N N 403 VAL HB H N N 404 VAL HG11 H N N 405 VAL HG12 H N N 406 VAL HG13 H N N 407 VAL HG21 H N N 408 VAL HG22 H N N 409 VAL HG23 H N N 410 VAL HXT H N N 411 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TIH N CA sing N N 306 TIH N H sing N N 307 TIH N H2 sing N N 308 TIH CA C sing N N 309 TIH CA CB sing N N 310 TIH CA HA sing N N 311 TIH C O doub N N 312 TIH C OXT sing N N 313 TIH OXT HXT sing N N 314 TIH CB CG sing N N 315 TIH CB HB2 sing N N 316 TIH CB HB3 sing N N 317 TIH CG CD doub Y N 318 TIH CG SD sing Y N 319 TIH CD CE1 sing Y N 320 TIH CD HD sing N N 321 TIH CE1 CE2 doub Y N 322 TIH CE1 HE1 sing N N 323 TIH CE2 SD sing Y N 324 TIH CE2 HE2 sing N N 325 TRP N CA sing N N 326 TRP N H sing N N 327 TRP N H2 sing N N 328 TRP CA C sing N N 329 TRP CA CB sing N N 330 TRP CA HA sing N N 331 TRP C O doub N N 332 TRP C OXT sing N N 333 TRP CB CG sing N N 334 TRP CB HB2 sing N N 335 TRP CB HB3 sing N N 336 TRP CG CD1 doub Y N 337 TRP CG CD2 sing Y N 338 TRP CD1 NE1 sing Y N 339 TRP CD1 HD1 sing N N 340 TRP CD2 CE2 doub Y N 341 TRP CD2 CE3 sing Y N 342 TRP NE1 CE2 sing Y N 343 TRP NE1 HE1 sing N N 344 TRP CE2 CZ2 sing Y N 345 TRP CE3 CZ3 doub Y N 346 TRP CE3 HE3 sing N N 347 TRP CZ2 CH2 doub Y N 348 TRP CZ2 HZ2 sing N N 349 TRP CZ3 CH2 sing Y N 350 TRP CZ3 HZ3 sing N N 351 TRP CH2 HH2 sing N N 352 TRP OXT HXT sing N N 353 TYR N CA sing N N 354 TYR N H sing N N 355 TYR N H2 sing N N 356 TYR CA C sing N N 357 TYR CA CB sing N N 358 TYR CA HA sing N N 359 TYR C O doub N N 360 TYR C OXT sing N N 361 TYR CB CG sing N N 362 TYR CB HB2 sing N N 363 TYR CB HB3 sing N N 364 TYR CG CD1 doub Y N 365 TYR CG CD2 sing Y N 366 TYR CD1 CE1 sing Y N 367 TYR CD1 HD1 sing N N 368 TYR CD2 CE2 doub Y N 369 TYR CD2 HD2 sing N N 370 TYR CE1 CZ doub Y N 371 TYR CE1 HE1 sing N N 372 TYR CE2 CZ sing Y N 373 TYR CE2 HE2 sing N N 374 TYR CZ OH sing N N 375 TYR OH HH sing N N 376 TYR OXT HXT sing N N 377 VAL N CA sing N N 378 VAL N H sing N N 379 VAL N H2 sing N N 380 VAL CA C sing N N 381 VAL CA CB sing N N 382 VAL CA HA sing N N 383 VAL C O doub N N 384 VAL C OXT sing N N 385 VAL CB CG1 sing N N 386 VAL CB CG2 sing N N 387 VAL CB HB sing N N 388 VAL CG1 HG11 sing N N 389 VAL CG1 HG12 sing N N 390 VAL CG1 HG13 sing N N 391 VAL CG2 HG21 sing N N 392 VAL CG2 HG22 sing N N 393 VAL CG2 HG23 sing N N 394 VAL OXT HXT sing N N 395 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' GM086868 1 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' 'United States' 'P41 GM103403' 2 'Department of Energy (DOE, United States)' 'United States' DE-AC02-06CH11357 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 3 'MAGNESIUM ION' MG 4 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1AM2 _pdbx_initial_refinement_model.details ? #