data_4PGO # _entry.id 4PGO # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4PGO pdb_00004pgo 10.2210/pdb4pgo/pdb WWPDB D_1000201320 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-12-10 2 'Structure model' 1 1 2015-08-12 3 'Structure model' 1 2 2017-11-22 4 'Structure model' 1 3 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Derived calculations' 3 3 'Structure model' 'Refinement description' 4 4 'Structure model' 'Data collection' 5 4 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' pdbx_struct_oper_list 2 3 'Structure model' software 3 4 'Structure model' chem_comp_atom 4 4 'Structure model' chem_comp_bond 5 4 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 4PGO _pdbx_database_status.recvd_initial_deposition_date 2014-05-02 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.methods_development_category . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB 'Structure determined by Se-MET SAD' 1XE1 unspecified TargetTrack . SECSG-Pfu-880080-001 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Weinert, T.' 1 'Waltersperger, S.' 2 'Olieric, V.' 3 'Panepucci, E.' 4 'Chen, L.' 5 'Rose, J.P.' 6 'Wang, M.' 7 'Wang, B.C.' 8 'Southeast Collaboratory for Structural Genomics (SECSG)' 9 # _citation.abstract . _citation.abstract_id_CAS . _citation.book_id_ISBN . _citation.book_publisher ? _citation.book_publisher_city . _citation.book_title . _citation.coordinate_linkage . _citation.country US _citation.database_id_Medline . _citation.details . _citation.id primary _citation.journal_abbrev Nat.Methods _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1548-7105 _citation.journal_full . _citation.journal_issue . _citation.journal_volume 12 _citation.language . _citation.page_first 131 _citation.page_last 133 _citation.title 'Fast native-SAD phasing for routine macromolecular structure determination.' _citation.year 2015 _citation.database_id_CSD . _citation.pdbx_database_id_DOI 10.1038/nmeth.3211 _citation.pdbx_database_id_PubMed 25506719 _citation.unpublished_flag . # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Weinert, T.' 1 ? primary 'Olieric, V.' 2 ? primary 'Waltersperger, S.' 3 ? primary 'Panepucci, E.' 4 ? primary 'Chen, L.' 5 ? primary 'Zhang, H.' 6 ? primary 'Zhou, D.' 7 ? primary 'Rose, J.' 8 ? primary 'Ebihara, A.' 9 ? primary 'Kuramitsu, S.' 10 ? primary 'Li, D.' 11 ? primary 'Howe, N.' 12 ? primary 'Schnapp, G.' 13 ? primary 'Pautsch, A.' 14 ? primary 'Bargsten, K.' 15 ? primary 'Prota, A.E.' 16 ? primary 'Surana, P.' 17 ? primary 'Kottur, J.' 18 ? primary 'Nair, D.T.' 19 ? primary 'Basilico, F.' 20 ? primary 'Cecatiello, V.' 21 ? primary 'Pasqualato, S.' 22 ? primary 'Boland, A.' 23 ? primary 'Weichenrieder, O.' 24 ? primary 'Wang, B.C.' 25 ? primary 'Steinmetz, M.O.' 26 ? primary 'Caffrey, M.' 27 ? primary 'Wang, M.' 28 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein' 12703.837 1 ? ? ? ? 2 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 3 water nat water 18.015 6 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'HYPOTHETICAL PROTEIN PF0907' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;AHHHHHHGSGLFDFLKRKEVKEEEKIEILSKKPAGKVVVEEVVNIMGKDVIIGTVESGMIGVGFKVKGPSGIGGIVRIER NREKVEFAIAGDRIGISIEGKIGKVKKGDVLEIYQT ; _entity_poly.pdbx_seq_one_letter_code_can ;AHHHHHHGSGLFDFLKRKEVKEEEKIEILSKKPAGKVVVEEVVNIMGKDVIIGTVESGMIGVGFKVKGPSGIGGIVRIER NREKVEFAIAGDRIGISIEGKIGKVKKGDVLEIYQT ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier SECSG-Pfu-880080-001 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CHLORIDE ION' CL 3 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ALA n 1 2 HIS n 1 3 HIS n 1 4 HIS n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 GLY n 1 9 SER n 1 10 GLY n 1 11 LEU n 1 12 PHE n 1 13 ASP n 1 14 PHE n 1 15 LEU n 1 16 LYS n 1 17 ARG n 1 18 LYS n 1 19 GLU n 1 20 VAL n 1 21 LYS n 1 22 GLU n 1 23 GLU n 1 24 GLU n 1 25 LYS n 1 26 ILE n 1 27 GLU n 1 28 ILE n 1 29 LEU n 1 30 SER n 1 31 LYS n 1 32 LYS n 1 33 PRO n 1 34 ALA n 1 35 GLY n 1 36 LYS n 1 37 VAL n 1 38 VAL n 1 39 VAL n 1 40 GLU n 1 41 GLU n 1 42 VAL n 1 43 VAL n 1 44 ASN n 1 45 ILE n 1 46 MET n 1 47 GLY n 1 48 LYS n 1 49 ASP n 1 50 VAL n 1 51 ILE n 1 52 ILE n 1 53 GLY n 1 54 THR n 1 55 VAL n 1 56 GLU n 1 57 SER n 1 58 GLY n 1 59 MET n 1 60 ILE n 1 61 GLY n 1 62 VAL n 1 63 GLY n 1 64 PHE n 1 65 LYS n 1 66 VAL n 1 67 LYS n 1 68 GLY n 1 69 PRO n 1 70 SER n 1 71 GLY n 1 72 ILE n 1 73 GLY n 1 74 GLY n 1 75 ILE n 1 76 VAL n 1 77 ARG n 1 78 ILE n 1 79 GLU n 1 80 ARG n 1 81 ASN n 1 82 ARG n 1 83 GLU n 1 84 LYS n 1 85 VAL n 1 86 GLU n 1 87 PHE n 1 88 ALA n 1 89 ILE n 1 90 ALA n 1 91 GLY n 1 92 ASP n 1 93 ARG n 1 94 ILE n 1 95 GLY n 1 96 ILE n 1 97 SER n 1 98 ILE n 1 99 GLU n 1 100 GLY n 1 101 LYS n 1 102 ILE n 1 103 GLY n 1 104 LYS n 1 105 VAL n 1 106 LYS n 1 107 LYS n 1 108 GLY n 1 109 ASP n 1 110 VAL n 1 111 LEU n 1 112 GLU n 1 113 ILE n 1 114 TYR n 1 115 GLN n 1 116 THR n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 116 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene PF0907 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'ATCC 43587 / DSM 3638 / JCM 8422 / Vc1' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 186497 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ALA 1 -7 ? ? ? A . n A 1 2 HIS 2 -6 ? ? ? A . n A 1 3 HIS 3 -5 ? ? ? A . n A 1 4 HIS 4 -4 ? ? ? A . n A 1 5 HIS 5 -3 ? ? ? A . n A 1 6 HIS 6 -2 ? ? ? A . n A 1 7 HIS 7 -1 ? ? ? A . n A 1 8 GLY 8 0 ? ? ? A . n A 1 9 SER 9 1 ? ? ? A . n A 1 10 GLY 10 2 ? ? ? A . n A 1 11 LEU 11 3 ? ? ? A . n A 1 12 PHE 12 4 ? ? ? A . n A 1 13 ASP 13 5 ? ? ? A . n A 1 14 PHE 14 6 ? ? ? A . n A 1 15 LEU 15 7 ? ? ? A . n A 1 16 LYS 16 8 ? ? ? A . n A 1 17 ARG 17 9 ? ? ? A . n A 1 18 LYS 18 10 ? ? ? A . n A 1 19 GLU 19 11 ? ? ? A . n A 1 20 VAL 20 12 ? ? ? A . n A 1 21 LYS 21 13 ? ? ? A . n A 1 22 GLU 22 14 ? ? ? A . n A 1 23 GLU 23 15 ? ? ? A . n A 1 24 GLU 24 16 ? ? ? A . n A 1 25 LYS 25 17 ? ? ? A . n A 1 26 ILE 26 18 ? ? ? A . n A 1 27 GLU 27 19 19 GLU GLU A . n A 1 28 ILE 28 20 20 ILE ILE A . n A 1 29 LEU 29 21 21 LEU LEU A . n A 1 30 SER 30 22 22 SER SER A . n A 1 31 LYS 31 23 23 LYS LYS A . n A 1 32 LYS 32 24 24 LYS LYS A . n A 1 33 PRO 33 25 25 PRO PRO A . n A 1 34 ALA 34 26 26 ALA ALA A . n A 1 35 GLY 35 27 27 GLY GLY A . n A 1 36 LYS 36 28 28 LYS LYS A . n A 1 37 VAL 37 29 29 VAL VAL A . n A 1 38 VAL 38 30 30 VAL VAL A . n A 1 39 VAL 39 31 31 VAL VAL A . n A 1 40 GLU 40 32 32 GLU GLU A . n A 1 41 GLU 41 33 33 GLU GLU A . n A 1 42 VAL 42 34 34 VAL VAL A . n A 1 43 VAL 43 35 35 VAL VAL A . n A 1 44 ASN 44 36 36 ASN ASN A . n A 1 45 ILE 45 37 37 ILE ILE A . n A 1 46 MET 46 38 38 MET MET A . n A 1 47 GLY 47 39 39 GLY GLY A . n A 1 48 LYS 48 40 40 LYS LYS A . n A 1 49 ASP 49 41 41 ASP ASP A . n A 1 50 VAL 50 42 42 VAL VAL A . n A 1 51 ILE 51 43 43 ILE ILE A . n A 1 52 ILE 52 44 44 ILE ILE A . n A 1 53 GLY 53 45 45 GLY GLY A . n A 1 54 THR 54 46 46 THR THR A . n A 1 55 VAL 55 47 47 VAL VAL A . n A 1 56 GLU 56 48 48 GLU GLU A . n A 1 57 SER 57 49 49 SER SER A . n A 1 58 GLY 58 50 50 GLY GLY A . n A 1 59 MET 59 51 51 MET MET A . n A 1 60 ILE 60 52 52 ILE ILE A . n A 1 61 GLY 61 53 53 GLY GLY A . n A 1 62 VAL 62 54 54 VAL VAL A . n A 1 63 GLY 63 55 55 GLY GLY A . n A 1 64 PHE 64 56 56 PHE PHE A . n A 1 65 LYS 65 57 57 LYS LYS A . n A 1 66 VAL 66 58 58 VAL VAL A . n A 1 67 LYS 67 59 59 LYS LYS A . n A 1 68 GLY 68 60 60 GLY GLY A . n A 1 69 PRO 69 61 61 PRO PRO A . n A 1 70 SER 70 62 62 SER SER A . n A 1 71 GLY 71 63 63 GLY GLY A . n A 1 72 ILE 72 64 64 ILE ILE A . n A 1 73 GLY 73 65 65 GLY GLY A . n A 1 74 GLY 74 66 66 GLY GLY A . n A 1 75 ILE 75 67 67 ILE ILE A . n A 1 76 VAL 76 68 68 VAL VAL A . n A 1 77 ARG 77 69 69 ARG ARG A . n A 1 78 ILE 78 70 70 ILE ILE A . n A 1 79 GLU 79 71 71 GLU GLU A . n A 1 80 ARG 80 72 72 ARG ARG A . n A 1 81 ASN 81 73 73 ASN ASN A . n A 1 82 ARG 82 74 74 ARG ARG A . n A 1 83 GLU 83 75 75 GLU GLU A . n A 1 84 LYS 84 76 76 LYS LYS A . n A 1 85 VAL 85 77 77 VAL VAL A . n A 1 86 GLU 86 78 78 GLU GLU A . n A 1 87 PHE 87 79 79 PHE PHE A . n A 1 88 ALA 88 80 80 ALA ALA A . n A 1 89 ILE 89 81 81 ILE ILE A . n A 1 90 ALA 90 82 82 ALA ALA A . n A 1 91 GLY 91 83 83 GLY GLY A . n A 1 92 ASP 92 84 84 ASP ASP A . n A 1 93 ARG 93 85 85 ARG ARG A . n A 1 94 ILE 94 86 86 ILE ILE A . n A 1 95 GLY 95 87 87 GLY GLY A . n A 1 96 ILE 96 88 88 ILE ILE A . n A 1 97 SER 97 89 89 SER SER A . n A 1 98 ILE 98 90 90 ILE ILE A . n A 1 99 GLU 99 91 91 GLU GLU A . n A 1 100 GLY 100 92 92 GLY GLY A . n A 1 101 LYS 101 93 93 LYS LYS A . n A 1 102 ILE 102 94 94 ILE ILE A . n A 1 103 GLY 103 95 95 GLY GLY A . n A 1 104 LYS 104 96 96 LYS LYS A . n A 1 105 VAL 105 97 97 VAL VAL A . n A 1 106 LYS 106 98 98 LYS LYS A . n A 1 107 LYS 107 99 99 LYS LYS A . n A 1 108 GLY 108 100 100 GLY GLY A . n A 1 109 ASP 109 101 101 ASP ASP A . n A 1 110 VAL 110 102 102 VAL VAL A . n A 1 111 LEU 111 103 103 LEU LEU A . n A 1 112 GLU 112 104 104 GLU GLU A . n A 1 113 ILE 113 105 105 ILE ILE A . n A 1 114 TYR 114 106 106 TYR TYR A . n A 1 115 GLN 115 107 107 GLN GLN A . n A 1 116 THR 116 108 108 THR THR A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CL 1 201 1 CL CL A . C 2 CL 1 202 2 CL CL A . D 3 HOH 1 301 1 HOH HOH A . D 3 HOH 2 302 5 HOH HOH A . D 3 HOH 3 303 2 HOH HOH A . D 3 HOH 4 304 3 HOH HOH A . D 3 HOH 5 305 6 HOH HOH A . D 3 HOH 6 306 7 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A GLU 19 ? CG ? A GLU 27 CG 2 1 Y 1 A GLU 19 ? CD ? A GLU 27 CD 3 1 Y 1 A GLU 19 ? OE1 ? A GLU 27 OE1 4 1 Y 1 A GLU 19 ? OE2 ? A GLU 27 OE2 5 1 Y 1 A LYS 23 ? CB ? A LYS 31 CB 6 1 Y 1 A LYS 23 ? CG ? A LYS 31 CG 7 1 Y 1 A LYS 23 ? CD ? A LYS 31 CD 8 1 Y 1 A LYS 23 ? CE ? A LYS 31 CE 9 1 Y 1 A LYS 23 ? NZ ? A LYS 31 NZ 10 1 Y 1 A LYS 24 ? CD ? A LYS 32 CD 11 1 Y 1 A LYS 24 ? CE ? A LYS 32 CE 12 1 Y 1 A LYS 24 ? NZ ? A LYS 32 NZ 13 1 Y 1 A LYS 40 ? NZ ? A LYS 48 NZ 14 1 Y 1 A ARG 74 ? CG ? A ARG 82 CG 15 1 Y 1 A ARG 74 ? CD ? A ARG 82 CD 16 1 Y 1 A ARG 74 ? NE ? A ARG 82 NE 17 1 Y 1 A ARG 74 ? CZ ? A ARG 82 CZ 18 1 Y 1 A ARG 74 ? NH1 ? A ARG 82 NH1 19 1 Y 1 A ARG 74 ? NH2 ? A ARG 82 NH2 20 1 Y 1 A GLU 75 ? CD ? A GLU 83 CD 21 1 Y 1 A GLU 75 ? OE1 ? A GLU 83 OE1 22 1 Y 1 A GLU 75 ? OE2 ? A GLU 83 OE2 23 1 Y 1 A GLU 91 ? CB ? A GLU 99 CB 24 1 Y 1 A GLU 91 ? CG ? A GLU 99 CG 25 1 Y 1 A GLU 91 ? CD ? A GLU 99 CD 26 1 Y 1 A GLU 91 ? OE1 ? A GLU 99 OE1 27 1 Y 1 A GLU 91 ? OE2 ? A GLU 99 OE2 28 1 Y 1 A LYS 93 ? CG ? A LYS 101 CG 29 1 Y 1 A LYS 93 ? CD ? A LYS 101 CD 30 1 Y 1 A LYS 93 ? CE ? A LYS 101 CE 31 1 Y 1 A LYS 93 ? NZ ? A LYS 101 NZ 32 1 Y 1 A LYS 96 ? CG ? A LYS 104 CG 33 1 Y 1 A LYS 96 ? CD ? A LYS 104 CD 34 1 Y 1 A LYS 96 ? CE ? A LYS 104 CE 35 1 Y 1 A LYS 96 ? NZ ? A LYS 104 NZ # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data reduction' . . . . . . . . . . . XDS . . . . 1 ? phasing . . . . . . . . . . . SHELXDE . . . . 2 ? 'model building' . . . . . . . . . . . Coot . . . . 3 ? refinement . . . . . . . . . . . PHENIX . . . '(phenix.refine: 1.8.4_1496)' 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? SHELX ? ? ? . 5 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 6 ? phasing ? ? ? ? ? ? ? ? ? ? ? SHELX ? ? ? . 7 # _cell.entry_id 4PGO _cell.length_a 88.500 _cell.length_b 88.500 _cell.length_c 73.120 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4PGO _symmetry.cell_setting . _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall . _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M . # _exptl.absorpt_coefficient_mu . _exptl.absorpt_correction_T_max . _exptl.absorpt_correction_T_min . _exptl.absorpt_correction_type . _exptl.absorpt_process_details . _exptl.entry_id 4PGO _exptl.crystals_number 1 _exptl.details . _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details . # _exptl_crystal.colour . _exptl_crystal.density_diffrn . _exptl_crystal.density_Matthews 3.25 _exptl_crystal.density_method . _exptl_crystal.density_percent_sol 62.10 _exptl_crystal.description . _exptl_crystal.F_000 . _exptl_crystal.id 1 _exptl_crystal.preparation . _exptl_crystal.size_max . _exptl_crystal.size_mid . _exptl_crystal.size_min . _exptl_crystal.size_rad . _exptl_crystal.colour_lustre . _exptl_crystal.colour_modifier . _exptl_crystal.colour_primary . _exptl_crystal.density_meas . _exptl_crystal.density_meas_esd . _exptl_crystal.density_meas_gt . _exptl_crystal.density_meas_lt . _exptl_crystal.density_meas_temp . _exptl_crystal.density_meas_temp_esd . _exptl_crystal.density_meas_temp_gt . _exptl_crystal.density_meas_temp_lt . _exptl_crystal.pdbx_crystal_image_url . _exptl_crystal.pdbx_crystal_image_format . _exptl_crystal.pdbx_mosaicity . _exptl_crystal.pdbx_mosaicity_esd . # _exptl_crystal_grow.apparatus . _exptl_crystal_grow.atmosphere . _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details . _exptl_crystal_grow.method EVAPORATION _exptl_crystal_grow.method_ref . _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure . _exptl_crystal_grow.pressure_esd . _exptl_crystal_grow.seeding . _exptl_crystal_grow.seeding_ref . _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details . _exptl_crystal_grow.temp_esd . _exptl_crystal_grow.time . _exptl_crystal_grow.pdbx_details 'MODIFIED MICROBATCH UNDER OIL USING 1.6M MAGNESIUM SULFATE IN 0.1M MES BUFFER, PH 6.5, TEMPERATURE 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment . _diffrn.ambient_temp 100 _diffrn.ambient_temp_details . _diffrn.ambient_temp_esd . _diffrn.crystal_id 1 _diffrn.crystal_support . _diffrn.crystal_treatment . _diffrn.details . _diffrn.id 1 _diffrn.ambient_pressure . _diffrn.ambient_pressure_esd . _diffrn.ambient_pressure_gt . _diffrn.ambient_pressure_lt . _diffrn.ambient_temp_gt . _diffrn.ambient_temp_lt . # _diffrn_detector.details . _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 2M-F' _diffrn_detector.area_resol_mean . _diffrn_detector.dtime . _diffrn_detector.pdbx_frames_total . _diffrn_detector.pdbx_collection_time_total . _diffrn_detector.pdbx_collection_date 2013-08-30 # _diffrn_radiation.collimation . _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge . _diffrn_radiation.inhomogeneity . _diffrn_radiation.monochromator . _diffrn_radiation.polarisn_norm . _diffrn_radiation.polarisn_ratio . _diffrn_radiation.probe . _diffrn_radiation.type . _diffrn_radiation.xray_symbol . _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list . _diffrn_radiation.pdbx_wavelength . _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer . _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 2.066 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current . _diffrn_source.details . _diffrn_source.diffrn_id 1 _diffrn_source.power . _diffrn_source.size . _diffrn_source.source SYNCHROTRON _diffrn_source.target . _diffrn_source.type 'SLS BEAMLINE X06DA' _diffrn_source.voltage . _diffrn_source.take-off_angle . _diffrn_source.pdbx_wavelength_list 2.066 _diffrn_source.pdbx_wavelength . _diffrn_source.pdbx_synchrotron_beamline X06DA _diffrn_source.pdbx_synchrotron_site SLS # _reflns.B_iso_Wilson_estimate . _reflns.entry_id 4PGO _reflns.data_reduction_details . _reflns.data_reduction_method . _reflns.d_resolution_high 2.3 _reflns.d_resolution_low 50.000 _reflns.details . _reflns.limit_h_max . _reflns.limit_h_min . _reflns.limit_k_max . _reflns.limit_k_min . _reflns.limit_l_max . _reflns.limit_l_min . _reflns.number_all 13544 _reflns.number_obs 7558 _reflns.observed_criterion . _reflns.observed_criterion_F_max . _reflns.observed_criterion_F_min . _reflns.observed_criterion_I_max . _reflns.observed_criterion_I_min . _reflns.observed_criterion_sigma_F 0 _reflns.observed_criterion_sigma_I 0 _reflns.percent_possible_obs 94.95 _reflns.R_free_details . _reflns.Rmerge_F_all . _reflns.Rmerge_F_obs . _reflns.Friedel_coverage . _reflns.number_gt . _reflns.threshold_expression . _reflns.pdbx_redundancy 51.16 _reflns.pdbx_Rmerge_I_obs 0.046 _reflns.pdbx_Rmerge_I_all . _reflns.pdbx_Rsym_value . _reflns.pdbx_netI_over_av_sigmaI . _reflns.pdbx_netI_over_sigmaI 69.96 _reflns.pdbx_res_netI_over_av_sigmaI_2 . _reflns.pdbx_res_netI_over_sigmaI_2 . _reflns.pdbx_chi_squared . _reflns.pdbx_scaling_rejects . _reflns.pdbx_d_res_high_opt . _reflns.pdbx_d_res_low_opt . _reflns.pdbx_d_res_opt_method . _reflns.phase_calculation_details . _reflns.pdbx_Rrim_I_all . _reflns.pdbx_Rpim_I_all . _reflns.pdbx_d_opt . _reflns.pdbx_number_measured_all . _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.aniso_B[1][1] . _refine.aniso_B[1][2] . _refine.aniso_B[1][3] . _refine.aniso_B[2][2] . _refine.aniso_B[2][3] . _refine.aniso_B[3][3] . _refine.B_iso_max . _refine.B_iso_mean . _refine.B_iso_min . _refine.correlation_coeff_Fo_to_Fc . _refine.correlation_coeff_Fo_to_Fc_free . _refine.details . _refine.diff_density_max . _refine.diff_density_max_esd . _refine.diff_density_min . _refine.diff_density_min_esd . _refine.diff_density_rms . _refine.diff_density_rms_esd . _refine.entry_id 4PGO _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details . _refine.ls_abs_structure_Flack . _refine.ls_abs_structure_Flack_esd . _refine.ls_abs_structure_Rogers . _refine.ls_abs_structure_Rogers_esd . _refine.ls_d_res_high 2.300 _refine.ls_d_res_low 44.250 _refine.ls_extinction_coef . _refine.ls_extinction_coef_esd . _refine.ls_extinction_expression . _refine.ls_extinction_method . _refine.ls_goodness_of_fit_all . _refine.ls_goodness_of_fit_all_esd . _refine.ls_goodness_of_fit_obs . _refine.ls_goodness_of_fit_obs_esd . _refine.ls_hydrogen_treatment . _refine.ls_matrix_type . _refine.ls_number_constraints . _refine.ls_number_parameters . _refine.ls_number_reflns_all . _refine.ls_number_reflns_obs 7558 _refine.ls_number_reflns_R_free 1330 _refine.ls_number_reflns_R_work . _refine.ls_number_restraints . _refine.ls_percent_reflns_obs 94.94 _refine.ls_percent_reflns_R_free 9.82 _refine.ls_R_factor_all . _refine.ls_R_factor_obs 0.1890 _refine.ls_R_factor_R_free 0.2026 _refine.ls_R_factor_R_free_error . _refine.ls_R_factor_R_free_error_details . _refine.ls_R_factor_R_work 0.1875 _refine.ls_R_Fsqd_factor_obs . _refine.ls_R_I_factor_obs . _refine.ls_redundancy_reflns_all . _refine.ls_redundancy_reflns_obs . _refine.ls_restrained_S_all . _refine.ls_restrained_S_obs . _refine.ls_shift_over_esd_max . _refine.ls_shift_over_esd_mean . _refine.ls_structure_factor_coef . _refine.ls_weighting_details . _refine.ls_weighting_scheme . _refine.ls_wR_factor_all . _refine.ls_wR_factor_obs . _refine.ls_wR_factor_R_free . _refine.ls_wR_factor_R_work . _refine.occupancy_max . _refine.occupancy_min . _refine.overall_SU_B . _refine.overall_SU_ML 0.21 _refine.overall_SU_R_Cruickshank_DPI . _refine.overall_SU_R_free . _refine.overall_FOM_free_R_set . _refine.overall_FOM_work_R_set . _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol . _refine.solvent_model_param_ksol . _refine.ls_R_factor_gt . _refine.ls_goodness_of_fit_gt . _refine.ls_goodness_of_fit_ref . _refine.ls_shift_over_su_max . _refine.ls_shift_over_su_max_lt . _refine.ls_shift_over_su_mean . _refine.ls_shift_over_su_mean_lt . _refine.pdbx_ls_sigma_I . _refine.pdbx_ls_sigma_F 1.53 _refine.pdbx_ls_sigma_Fsqd . _refine.pdbx_data_cutoff_high_absF . _refine.pdbx_data_cutoff_high_rms_absF . _refine.pdbx_data_cutoff_low_absF . _refine.pdbx_isotropic_thermal_model . _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model . _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_R_Free_selection_details . _refine.pdbx_stereochem_target_val_spec_case . _refine.pdbx_overall_ESU_R . _refine.pdbx_overall_ESU_R_Free . _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii . _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R . _refine.pdbx_density_correlation . _refine.pdbx_pd_number_of_powder_patterns . _refine.pdbx_pd_number_of_points . _refine.pdbx_pd_meas_number_of_points . _refine.pdbx_pd_proc_ls_prof_R_factor . _refine.pdbx_pd_proc_ls_prof_wR_factor . _refine.pdbx_pd_Marquardt_correlation_coeff . _refine.pdbx_pd_Fsqrd_R_factor . _refine.pdbx_pd_ls_matrix_band_width . _refine.pdbx_overall_phase_error 20.33 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI . _refine.pdbx_overall_SU_R_free_Blow_DPI . _refine.pdbx_overall_SU_R_Blow_DPI . _refine.pdbx_TLS_residual_ADP_flag . _refine.pdbx_diffrn_id 1 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 635 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 643 _refine_hist.d_res_high 2.300 _refine_hist.d_res_low 44.250 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' . 0.009 . 639 . f_bond_d . . 'X-RAY DIFFRACTION' . 1.076 . 858 . f_angle_d . . 'X-RAY DIFFRACTION' . 10.862 . 235 . f_dihedral_angle_d . . 'X-RAY DIFFRACTION' . 0.038 . 104 . f_chiral_restr . . 'X-RAY DIFFRACTION' . 0.004 . 110 . f_plane_restr . . # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error 'X-RAY DIFFRACTION' 2.30 2.3918 . . 126 1157 80.00 . . . 0.2811 . 0.2434 . . . . . . . . 'X-RAY DIFFRACTION' 2.3918 2.5007 . . 143 1282 91.00 . . . 0.2144 . 0.2202 . . . . . . . . 'X-RAY DIFFRACTION' 2.5007 2.6325 . . 147 1314 92.00 . . . 0.2701 . 0.2094 . . . . . . . . 'X-RAY DIFFRACTION' 2.6325 2.7974 . . 144 1365 96.00 . . . 0.2474 . 0.2114 . . . . . . . . 'X-RAY DIFFRACTION' 2.7974 3.0133 . . 153 1391 98.00 . . . 0.2296 . 0.1924 . . . . . . . . 'X-RAY DIFFRACTION' 3.0133 3.3165 . . 149 1430 99.00 . . . 0.2327 . 0.1820 . . . . . . . . 'X-RAY DIFFRACTION' 3.3165 3.7962 . . 150 1415 99.00 . . . 0.1993 . 0.1753 . . . . . . . . 'X-RAY DIFFRACTION' 3.7962 4.7819 . . 156 1427 100.00 . . . 0.1707 . 0.1638 . . . . . . . . 'X-RAY DIFFRACTION' 4.7819 44.2582 . . 162 1432 100.00 . . . 0.1950 . 0.2016 . . . . . . . . # _struct.entry_id 4PGO _struct.title 'Crystal structure of hypothetical protein PF0907 from Pyrococcus furiosus solved by sulfur SAD using Swiss Light Source data' _struct.pdbx_model_details . _struct.pdbx_formula_weight . _struct.pdbx_formula_weight_method . _struct.pdbx_model_type_details . _struct.pdbx_CASP_flag . # _struct_keywords.entry_id 4PGO _struct_keywords.text 'Sulfur SAD, SOUTHEAST COLLABORATORY FOR STRUCTURAL GENOMICS, SECSG, STRUCTURAL GENOMICS, UNKNOWN FUNCTION' _struct_keywords.pdbx_keywords 'UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8U2D2_PYRFU _struct_ref.pdbx_db_accession Q8U2D2 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;GLFDFLKRKEVKEEEKIEILSKKPAGKVVVEEVVNIMGKDVIIGTVESGMIGVGFKVKGPSGIGGIVRIERNREKVEFAI AGDRIGISIEGKIGKVKKGDVLEIYQT ; _struct_ref.pdbx_align_begin 2 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4PGO _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 10 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 116 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8U2D2 _struct_ref_seq.db_align_beg 2 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 108 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 2 _struct_ref_seq.pdbx_auth_seq_align_end 108 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4PGO ALA A 1 ? UNP Q8U2D2 ? ? 'expression tag' -7 1 1 4PGO HIS A 2 ? UNP Q8U2D2 ? ? 'expression tag' -6 2 1 4PGO HIS A 3 ? UNP Q8U2D2 ? ? 'expression tag' -5 3 1 4PGO HIS A 4 ? UNP Q8U2D2 ? ? 'expression tag' -4 4 1 4PGO HIS A 5 ? UNP Q8U2D2 ? ? 'expression tag' -3 5 1 4PGO HIS A 6 ? UNP Q8U2D2 ? ? 'expression tag' -2 6 1 4PGO HIS A 7 ? UNP Q8U2D2 ? ? 'expression tag' -1 7 1 4PGO GLY A 8 ? UNP Q8U2D2 ? ? 'expression tag' 0 8 1 4PGO SER A 9 ? UNP Q8U2D2 ? ? 'expression tag' 1 9 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 GLU A 83 ? VAL A 85 ? GLU A 75 VAL A 77 AA1 2 GLY A 71 ? ARG A 80 ? GLY A 63 ARG A 72 AA1 3 LYS A 65 ? GLY A 68 ? LYS A 57 GLY A 60 AA1 4 VAL A 110 ? TYR A 114 ? VAL A 102 TYR A 106 AA1 5 GLY A 35 ? ILE A 45 ? GLY A 27 ILE A 37 AA1 6 LYS A 48 ? GLY A 61 ? LYS A 40 GLY A 53 AA1 7 PHE A 87 ? ILE A 89 ? PHE A 79 ILE A 81 AA2 1 GLU A 83 ? VAL A 85 ? GLU A 75 VAL A 77 AA2 2 GLY A 71 ? ARG A 80 ? GLY A 63 ARG A 72 AA2 3 ARG A 93 ? GLU A 99 ? ARG A 85 GLU A 91 AA2 4 LYS A 48 ? GLY A 61 ? LYS A 40 GLY A 53 AA2 5 PHE A 87 ? ILE A 89 ? PHE A 79 ILE A 81 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 83 ? O GLU A 75 N ARG A 80 ? N ARG A 72 AA1 2 3 O GLY A 73 ? O GLY A 65 N VAL A 66 ? N VAL A 58 AA1 3 4 N LYS A 65 ? N LYS A 57 O TYR A 114 ? O TYR A 106 AA1 4 5 O ILE A 113 ? O ILE A 105 N GLY A 35 ? N GLY A 27 AA1 5 6 N VAL A 43 ? N VAL A 35 O VAL A 50 ? O VAL A 42 AA1 6 7 N ILE A 60 ? N ILE A 52 O ALA A 88 ? O ALA A 80 AA2 1 2 O GLU A 83 ? O GLU A 75 N ARG A 80 ? N ARG A 72 AA2 2 3 N GLU A 79 ? N GLU A 71 O GLY A 95 ? O GLY A 87 AA2 3 4 O ILE A 94 ? O ILE A 86 N GLY A 53 ? N GLY A 45 AA2 4 5 N ILE A 60 ? N ILE A 52 O ALA A 88 ? O ALA A 80 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CL 201 ? 2 'binding site for residue CL A 201' AC2 Software A CL 202 ? 3 'binding site for residue CL A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 ARG A 93 ? ARG A 85 . ? 10_665 ? 2 AC1 2 LYS A 107 ? LYS A 99 . ? 1_555 ? 3 AC2 3 GLU A 56 ? GLU A 48 . ? 1_555 ? 4 AC2 3 GLY A 108 ? GLY A 100 . ? 10_665 ? 5 AC2 3 VAL A 110 ? VAL A 102 . ? 10_665 ? # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id SER _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 62 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -144.59 _pdbx_validate_torsion.psi 25.96 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name ? _pdbx_SG_project.full_name_of_center 'Southeast Collaboratory for Structural Genomics' _pdbx_SG_project.initial_of_center SECSG # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' . refined 75.2420 20.6931 2.4499 0.5356 . -0.0455 . -0.0259 . 0.7206 . -0.0151 . 0.4983 . 0.0132 . -0.0685 . -0.0397 . 0.2862 . 0.1918 . 0.1178 . -0.2130 . -0.1137 . -0.1093 . 0.0024 . 0.1551 . -0.2274 . 0.0117 . 0.1903 . -0.0001 . 2 'X-RAY DIFFRACTION' . refined 58.2659 25.9657 -7.0307 0.6234 . -0.0097 . -0.0187 . 0.5951 . 0.0769 . 0.6296 . 0.3788 . -0.4098 . 0.1848 . 0.4132 . -0.1970 . 0.0795 . 0.0918 . 0.3900 . -0.0057 . 0.0854 . 0.6441 . -0.5734 . 0.6263 . -0.1762 . 0.0010 . 3 'X-RAY DIFFRACTION' . refined 65.3007 23.1316 3.2345 0.5518 . -0.0630 . -0.0247 . 0.5523 . 0.0197 . 0.5142 . 0.9394 . -0.6255 . -0.8531 . 0.4416 . 0.5103 . 0.7849 . 0.2836 . 0.1241 . 0.1508 . -0.4791 . 0.2990 . -0.6114 . 0.2897 . 0.5227 . 0.0000 . 4 'X-RAY DIFFRACTION' . refined 67.4957 28.6919 1.8138 0.6573 . -0.1557 . -0.1057 . 0.5065 . -0.0065 . 0.5902 . 0.8408 . -0.2936 . 0.8334 . 0.4945 . 0.2780 . 1.5310 . -0.2973 . 0.4722 . 0.6131 . -0.4394 . 0.3022 . 0.3190 . -0.3195 . -0.1993 . 0.0011 . 5 'X-RAY DIFFRACTION' . refined 67.5812 23.0604 1.4237 0.5690 . -0.0603 . -0.0339 . 0.5738 . -0.0871 . 0.5748 . 0.9962 . 1.0894 . -0.1452 . 1.2051 . -0.0412 . 0.2673 . -0.2338 . 0.0602 . 0.0454 . -0.2518 . 0.1265 . -0.2037 . -0.2176 . 0.3966 . -0.0002 . # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 . . . . . . . . . ;chain 'A' and (resid 19 through 31 ) ; 2 'X-RAY DIFFRACTION' 2 . . . . . . . . . ;chain 'A' and (resid 32 through 39 ) ; 3 'X-RAY DIFFRACTION' 3 . . . . . . . . . ;chain 'A' and (resid 40 through 53 ) ; 4 'X-RAY DIFFRACTION' 4 . . . . . . . . . ;chain 'A' and (resid 54 through 77 ) ; 5 'X-RAY DIFFRACTION' 5 . . . . . . . . . ;chain 'A' and (resid 78 through 108 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A ALA -7 ? A ALA 1 2 1 Y 1 A HIS -6 ? A HIS 2 3 1 Y 1 A HIS -5 ? A HIS 3 4 1 Y 1 A HIS -4 ? A HIS 4 5 1 Y 1 A HIS -3 ? A HIS 5 6 1 Y 1 A HIS -2 ? A HIS 6 7 1 Y 1 A HIS -1 ? A HIS 7 8 1 Y 1 A GLY 0 ? A GLY 8 9 1 Y 1 A SER 1 ? A SER 9 10 1 Y 1 A GLY 2 ? A GLY 10 11 1 Y 1 A LEU 3 ? A LEU 11 12 1 Y 1 A PHE 4 ? A PHE 12 13 1 Y 1 A ASP 5 ? A ASP 13 14 1 Y 1 A PHE 6 ? A PHE 14 15 1 Y 1 A LEU 7 ? A LEU 15 16 1 Y 1 A LYS 8 ? A LYS 16 17 1 Y 1 A ARG 9 ? A ARG 17 18 1 Y 1 A LYS 10 ? A LYS 18 19 1 Y 1 A GLU 11 ? A GLU 19 20 1 Y 1 A VAL 12 ? A VAL 20 21 1 Y 1 A LYS 13 ? A LYS 21 22 1 Y 1 A GLU 14 ? A GLU 22 23 1 Y 1 A GLU 15 ? A GLU 23 24 1 Y 1 A GLU 16 ? A GLU 24 25 1 Y 1 A LYS 17 ? A LYS 25 26 1 Y 1 A ILE 18 ? A ILE 26 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MET N N N N 217 MET CA C N S 218 MET C C N N 219 MET O O N N 220 MET CB C N N 221 MET CG C N N 222 MET SD S N N 223 MET CE C N N 224 MET OXT O N N 225 MET H H N N 226 MET H2 H N N 227 MET HA H N N 228 MET HB2 H N N 229 MET HB3 H N N 230 MET HG2 H N N 231 MET HG3 H N N 232 MET HE1 H N N 233 MET HE2 H N N 234 MET HE3 H N N 235 MET HXT H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TYR N N N N 308 TYR CA C N S 309 TYR C C N N 310 TYR O O N N 311 TYR CB C N N 312 TYR CG C Y N 313 TYR CD1 C Y N 314 TYR CD2 C Y N 315 TYR CE1 C Y N 316 TYR CE2 C Y N 317 TYR CZ C Y N 318 TYR OH O N N 319 TYR OXT O N N 320 TYR H H N N 321 TYR H2 H N N 322 TYR HA H N N 323 TYR HB2 H N N 324 TYR HB3 H N N 325 TYR HD1 H N N 326 TYR HD2 H N N 327 TYR HE1 H N N 328 TYR HE2 H N N 329 TYR HH H N N 330 TYR HXT H N N 331 VAL N N N N 332 VAL CA C N S 333 VAL C C N N 334 VAL O O N N 335 VAL CB C N N 336 VAL CG1 C N N 337 VAL CG2 C N N 338 VAL OXT O N N 339 VAL H H N N 340 VAL H2 H N N 341 VAL HA H N N 342 VAL HB H N N 343 VAL HG11 H N N 344 VAL HG12 H N N 345 VAL HG13 H N N 346 VAL HG21 H N N 347 VAL HG22 H N N 348 VAL HG23 H N N 349 VAL HXT H N N 350 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TYR N CA sing N N 293 TYR N H sing N N 294 TYR N H2 sing N N 295 TYR CA C sing N N 296 TYR CA CB sing N N 297 TYR CA HA sing N N 298 TYR C O doub N N 299 TYR C OXT sing N N 300 TYR CB CG sing N N 301 TYR CB HB2 sing N N 302 TYR CB HB3 sing N N 303 TYR CG CD1 doub Y N 304 TYR CG CD2 sing Y N 305 TYR CD1 CE1 sing Y N 306 TYR CD1 HD1 sing N N 307 TYR CD2 CE2 doub Y N 308 TYR CD2 HD2 sing N N 309 TYR CE1 CZ doub Y N 310 TYR CE1 HE1 sing N N 311 TYR CE2 CZ sing Y N 312 TYR CE2 HE2 sing N N 313 TYR CZ OH sing N N 314 TYR OH HH sing N N 315 TYR OXT HXT sing N N 316 VAL N CA sing N N 317 VAL N H sing N N 318 VAL N H2 sing N N 319 VAL CA C sing N N 320 VAL CA CB sing N N 321 VAL CA HA sing N N 322 VAL C O doub N N 323 VAL C OXT sing N N 324 VAL CB CG1 sing N N 325 VAL CB CG2 sing N N 326 VAL CB HB sing N N 327 VAL CG1 HG11 sing N N 328 VAL CG1 HG12 sing N N 329 VAL CG1 HG13 sing N N 330 VAL CG2 HG21 sing N N 331 VAL CG2 HG22 sing N N 332 VAL CG2 HG23 sing N N 333 VAL OXT HXT sing N N 334 # _atom_sites.entry_id 4PGO _atom_sites.fract_transf_matrix[1][1] 0.011299 _atom_sites.fract_transf_matrix[1][2] 0.006524 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013047 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.013676 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CL N O S # loop_