data_4PGV # _entry.id 4PGV # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4PGV pdb_00004pgv 10.2210/pdb4pgv/pdb WWPDB D_1000201250 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-06-04 2 'Structure model' 1 1 2014-06-18 3 'Structure model' 1 2 2017-09-20 4 'Structure model' 1 3 2019-12-25 5 'Structure model' 1 4 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' Other 6 3 'Structure model' 'Source and taxonomy' 7 4 'Structure model' 'Author supporting evidence' 8 5 'Structure model' 'Data collection' 9 5 'Structure model' 'Database references' 10 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' entity_src_gen 3 3 'Structure model' pdbx_audit_support 4 3 'Structure model' pdbx_database_status 5 3 'Structure model' pdbx_struct_assembly 6 3 'Structure model' pdbx_struct_oper_list 7 4 'Structure model' pdbx_audit_support 8 5 'Structure model' chem_comp_atom 9 5 'Structure model' chem_comp_bond 10 5 'Structure model' database_2 11 5 'Structure model' refine_hist # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 3 3 'Structure model' '_pdbx_audit_support.funding_organization' 4 3 'Structure model' '_pdbx_database_status.pdb_format_compatible' 5 3 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 6 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 7 4 'Structure model' '_pdbx_audit_support.funding_organization' 8 5 'Structure model' '_database_2.pdbx_DOI' 9 5 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr . _pdbx_database_status.entry_id 4PGV _pdbx_database_status.recvd_initial_deposition_date 2014-05-02 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs . _pdbx_database_status.methods_development_category . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 4PGR unspecified PDB . 4PGS unspecified PDB . 4PGW unspecified PDB . 4PGU unspecified TargetTrack . NYCOMPS-GO.6 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, Q.' 1 'Chang, Y.' 2 'Hendrickson, W.A.' 3 'New York Consortium on Membrane Protein Structure (NYCOMPS)' 4 # _citation.abstract . _citation.abstract_id_CAS . _citation.book_id_ISBN . _citation.book_publisher ? _citation.book_publisher_city . _citation.book_title . _citation.coordinate_linkage . _citation.country US _citation.database_id_Medline . _citation.details . _citation.id primary _citation.journal_abbrev Science _citation.journal_id_ASTM SCIEAS _citation.journal_id_CSD 0038 _citation.journal_id_ISSN 1095-9203 _citation.journal_full . _citation.journal_issue . _citation.journal_volume 344 _citation.language . _citation.page_first 1131 _citation.page_last 1135 _citation.title 'Structural basis for a pH-sensitive calcium leak across membranes.' _citation.year 2014 _citation.database_id_CSD . _citation.pdbx_database_id_DOI 10.1126/science.1252043 _citation.pdbx_database_id_PubMed 24904158 _citation.unpublished_flag . # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Chang, Y.' 1 ? primary 'Bruni, R.' 2 ? primary 'Kloss, B.' 3 ? primary 'Assur, Z.' 4 ? primary 'Kloppmann, E.' 5 ? primary 'Rost, B.' 6 ? primary 'Hendrickson, W.A.' 7 ? primary 'Liu, Q.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein YetJ' 24116.812 1 ? ? ? ? 2 water nat water 18.015 13 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNAMQATVHESKQSIMQRILTVFVFTLLIATVGLFIGQFVPVALMLPLSILEVAMIILAFWMRRRKAVGYAFVYTFAFVS GITLFPIVSHYASIAGAYVVLEAFGSTFVIFAVLGTIGAKMKKDLSFLWSFLLVAVLALAVVGIFNIFSPLNSAAMMAYS VIGTIVFSLYILYDLNQIKHRHITEDLIPVMALSLYLDFINLFINLLRFFGILSSDD ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMQATVHESKQSIMQRILTVFVFTLLIATVGLFIGQFVPVALMLPLSILEVAMIILAFWMRRRKAVGYAFVYTFAFVS GITLFPIVSHYASIAGAYVVLEAFGSTFVIFAVLGTIGAKMKKDLSFLWSFLLVAVLALAVVGIFNIFSPLNSAAMMAYS VIGTIVFSLYILYDLNQIKHRHITEDLIPVMALSLYLDFINLFINLLRFFGILSSDD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier NYCOMPS-GO.6 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MET n 1 5 GLN n 1 6 ALA n 1 7 THR n 1 8 VAL n 1 9 HIS n 1 10 GLU n 1 11 SER n 1 12 LYS n 1 13 GLN n 1 14 SER n 1 15 ILE n 1 16 MET n 1 17 GLN n 1 18 ARG n 1 19 ILE n 1 20 LEU n 1 21 THR n 1 22 VAL n 1 23 PHE n 1 24 VAL n 1 25 PHE n 1 26 THR n 1 27 LEU n 1 28 LEU n 1 29 ILE n 1 30 ALA n 1 31 THR n 1 32 VAL n 1 33 GLY n 1 34 LEU n 1 35 PHE n 1 36 ILE n 1 37 GLY n 1 38 GLN n 1 39 PHE n 1 40 VAL n 1 41 PRO n 1 42 VAL n 1 43 ALA n 1 44 LEU n 1 45 MET n 1 46 LEU n 1 47 PRO n 1 48 LEU n 1 49 SER n 1 50 ILE n 1 51 LEU n 1 52 GLU n 1 53 VAL n 1 54 ALA n 1 55 MET n 1 56 ILE n 1 57 ILE n 1 58 LEU n 1 59 ALA n 1 60 PHE n 1 61 TRP n 1 62 MET n 1 63 ARG n 1 64 ARG n 1 65 ARG n 1 66 LYS n 1 67 ALA n 1 68 VAL n 1 69 GLY n 1 70 TYR n 1 71 ALA n 1 72 PHE n 1 73 VAL n 1 74 TYR n 1 75 THR n 1 76 PHE n 1 77 ALA n 1 78 PHE n 1 79 VAL n 1 80 SER n 1 81 GLY n 1 82 ILE n 1 83 THR n 1 84 LEU n 1 85 PHE n 1 86 PRO n 1 87 ILE n 1 88 VAL n 1 89 SER n 1 90 HIS n 1 91 TYR n 1 92 ALA n 1 93 SER n 1 94 ILE n 1 95 ALA n 1 96 GLY n 1 97 ALA n 1 98 TYR n 1 99 VAL n 1 100 VAL n 1 101 LEU n 1 102 GLU n 1 103 ALA n 1 104 PHE n 1 105 GLY n 1 106 SER n 1 107 THR n 1 108 PHE n 1 109 VAL n 1 110 ILE n 1 111 PHE n 1 112 ALA n 1 113 VAL n 1 114 LEU n 1 115 GLY n 1 116 THR n 1 117 ILE n 1 118 GLY n 1 119 ALA n 1 120 LYS n 1 121 MET n 1 122 LYS n 1 123 LYS n 1 124 ASP n 1 125 LEU n 1 126 SER n 1 127 PHE n 1 128 LEU n 1 129 TRP n 1 130 SER n 1 131 PHE n 1 132 LEU n 1 133 LEU n 1 134 VAL n 1 135 ALA n 1 136 VAL n 1 137 LEU n 1 138 ALA n 1 139 LEU n 1 140 ALA n 1 141 VAL n 1 142 VAL n 1 143 GLY n 1 144 ILE n 1 145 PHE n 1 146 ASN n 1 147 ILE n 1 148 PHE n 1 149 SER n 1 150 PRO n 1 151 LEU n 1 152 ASN n 1 153 SER n 1 154 ALA n 1 155 ALA n 1 156 MET n 1 157 MET n 1 158 ALA n 1 159 TYR n 1 160 SER n 1 161 VAL n 1 162 ILE n 1 163 GLY n 1 164 THR n 1 165 ILE n 1 166 VAL n 1 167 PHE n 1 168 SER n 1 169 LEU n 1 170 TYR n 1 171 ILE n 1 172 LEU n 1 173 TYR n 1 174 ASP n 1 175 LEU n 1 176 ASN n 1 177 GLN n 1 178 ILE n 1 179 LYS n 1 180 HIS n 1 181 ARG n 1 182 HIS n 1 183 ILE n 1 184 THR n 1 185 GLU n 1 186 ASP n 1 187 LEU n 1 188 ILE n 1 189 PRO n 1 190 VAL n 1 191 MET n 1 192 ALA n 1 193 LEU n 1 194 SER n 1 195 LEU n 1 196 TYR n 1 197 LEU n 1 198 ASP n 1 199 PHE n 1 200 ILE n 1 201 ASN n 1 202 LEU n 1 203 PHE n 1 204 ILE n 1 205 ASN n 1 206 LEU n 1 207 LEU n 1 208 ARG n 1 209 PHE n 1 210 PHE n 1 211 GLY n 1 212 ILE n 1 213 LEU n 1 214 SER n 1 215 SER n 1 216 ASP n 1 217 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 217 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'yetJ, BSU07200' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 168 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224308 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21-Gold(DE3)pLysS AG' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 GLN 5 2 ? ? ? A . n A 1 6 ALA 6 3 ? ? ? A . n A 1 7 THR 7 4 ? ? ? A . n A 1 8 VAL 8 5 ? ? ? A . n A 1 9 HIS 9 6 6 HIS HIS A . n A 1 10 GLU 10 7 7 GLU GLU A . n A 1 11 SER 11 8 8 SER SER A . n A 1 12 LYS 12 9 9 LYS LYS A . n A 1 13 GLN 13 10 10 GLN GLN A . n A 1 14 SER 14 11 11 SER SER A . n A 1 15 ILE 15 12 12 ILE ILE A . n A 1 16 MET 16 13 13 MET MET A . n A 1 17 GLN 17 14 14 GLN GLN A . n A 1 18 ARG 18 15 15 ARG ARG A . n A 1 19 ILE 19 16 16 ILE ILE A . n A 1 20 LEU 20 17 17 LEU LEU A . n A 1 21 THR 21 18 18 THR THR A . n A 1 22 VAL 22 19 19 VAL VAL A . n A 1 23 PHE 23 20 20 PHE PHE A . n A 1 24 VAL 24 21 21 VAL VAL A . n A 1 25 PHE 25 22 22 PHE PHE A . n A 1 26 THR 26 23 23 THR THR A . n A 1 27 LEU 27 24 24 LEU LEU A . n A 1 28 LEU 28 25 25 LEU LEU A . n A 1 29 ILE 29 26 26 ILE ILE A . n A 1 30 ALA 30 27 27 ALA ALA A . n A 1 31 THR 31 28 28 THR THR A . n A 1 32 VAL 32 29 29 VAL VAL A . n A 1 33 GLY 33 30 30 GLY GLY A . n A 1 34 LEU 34 31 31 LEU LEU A . n A 1 35 PHE 35 32 32 PHE PHE A . n A 1 36 ILE 36 33 33 ILE ILE A . n A 1 37 GLY 37 34 34 GLY GLY A . n A 1 38 GLN 38 35 35 GLN GLN A . n A 1 39 PHE 39 36 36 PHE PHE A . n A 1 40 VAL 40 37 37 VAL VAL A . n A 1 41 PRO 41 38 38 PRO PRO A . n A 1 42 VAL 42 39 39 VAL VAL A . n A 1 43 ALA 43 40 40 ALA ALA A . n A 1 44 LEU 44 41 41 LEU LEU A . n A 1 45 MET 45 42 42 MET MET A . n A 1 46 LEU 46 43 43 LEU LEU A . n A 1 47 PRO 47 44 44 PRO PRO A . n A 1 48 LEU 48 45 45 LEU LEU A . n A 1 49 SER 49 46 46 SER SER A . n A 1 50 ILE 50 47 47 ILE ILE A . n A 1 51 LEU 51 48 48 LEU LEU A . n A 1 52 GLU 52 49 49 GLU GLU A . n A 1 53 VAL 53 50 50 VAL VAL A . n A 1 54 ALA 54 51 51 ALA ALA A . n A 1 55 MET 55 52 52 MET MET A . n A 1 56 ILE 56 53 53 ILE ILE A . n A 1 57 ILE 57 54 54 ILE ILE A . n A 1 58 LEU 58 55 55 LEU LEU A . n A 1 59 ALA 59 56 56 ALA ALA A . n A 1 60 PHE 60 57 57 PHE PHE A . n A 1 61 TRP 61 58 58 TRP TRP A . n A 1 62 MET 62 59 59 MET MET A . n A 1 63 ARG 63 60 60 ARG ARG A . n A 1 64 ARG 64 61 61 ARG ARG A . n A 1 65 ARG 65 62 62 ARG ARG A . n A 1 66 LYS 66 63 63 LYS LYS A . n A 1 67 ALA 67 64 64 ALA ALA A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 GLY 69 66 66 GLY GLY A . n A 1 70 TYR 70 67 67 TYR TYR A . n A 1 71 ALA 71 68 68 ALA ALA A . n A 1 72 PHE 72 69 69 PHE PHE A . n A 1 73 VAL 73 70 70 VAL VAL A . n A 1 74 TYR 74 71 71 TYR TYR A . n A 1 75 THR 75 72 72 THR THR A . n A 1 76 PHE 76 73 73 PHE PHE A . n A 1 77 ALA 77 74 74 ALA ALA A . n A 1 78 PHE 78 75 75 PHE PHE A . n A 1 79 VAL 79 76 76 VAL VAL A . n A 1 80 SER 80 77 77 SER SER A . n A 1 81 GLY 81 78 78 GLY GLY A . n A 1 82 ILE 82 79 79 ILE ILE A . n A 1 83 THR 83 80 80 THR THR A . n A 1 84 LEU 84 81 81 LEU LEU A . n A 1 85 PHE 85 82 82 PHE PHE A . n A 1 86 PRO 86 83 83 PRO PRO A . n A 1 87 ILE 87 84 84 ILE ILE A . n A 1 88 VAL 88 85 85 VAL VAL A . n A 1 89 SER 89 86 86 SER SER A . n A 1 90 HIS 90 87 87 HIS HIS A . n A 1 91 TYR 91 88 88 TYR TYR A . n A 1 92 ALA 92 89 89 ALA ALA A . n A 1 93 SER 93 90 90 SER SER A . n A 1 94 ILE 94 91 91 ILE ILE A . n A 1 95 ALA 95 92 92 ALA ALA A . n A 1 96 GLY 96 93 93 GLY GLY A . n A 1 97 ALA 97 94 94 ALA ALA A . n A 1 98 TYR 98 95 95 TYR TYR A . n A 1 99 VAL 99 96 96 VAL VAL A . n A 1 100 VAL 100 97 97 VAL VAL A . n A 1 101 LEU 101 98 98 LEU LEU A . n A 1 102 GLU 102 99 99 GLU GLU A . n A 1 103 ALA 103 100 100 ALA ALA A . n A 1 104 PHE 104 101 101 PHE PHE A . n A 1 105 GLY 105 102 102 GLY GLY A . n A 1 106 SER 106 103 103 SER SER A . n A 1 107 THR 107 104 104 THR THR A . n A 1 108 PHE 108 105 105 PHE PHE A . n A 1 109 VAL 109 106 106 VAL VAL A . n A 1 110 ILE 110 107 107 ILE ILE A . n A 1 111 PHE 111 108 108 PHE PHE A . n A 1 112 ALA 112 109 109 ALA ALA A . n A 1 113 VAL 113 110 110 VAL VAL A . n A 1 114 LEU 114 111 111 LEU LEU A . n A 1 115 GLY 115 112 112 GLY GLY A . n A 1 116 THR 116 113 113 THR THR A . n A 1 117 ILE 117 114 114 ILE ILE A . n A 1 118 GLY 118 115 115 GLY GLY A . n A 1 119 ALA 119 116 116 ALA ALA A . n A 1 120 LYS 120 117 117 LYS LYS A . n A 1 121 MET 121 118 118 MET MET A . n A 1 122 LYS 122 119 119 LYS LYS A . n A 1 123 LYS 123 120 120 LYS LYS A . n A 1 124 ASP 124 121 121 ASP ASP A . n A 1 125 LEU 125 122 122 LEU LEU A . n A 1 126 SER 126 123 123 SER SER A . n A 1 127 PHE 127 124 124 PHE PHE A . n A 1 128 LEU 128 125 125 LEU LEU A . n A 1 129 TRP 129 126 126 TRP TRP A . n A 1 130 SER 130 127 127 SER SER A . n A 1 131 PHE 131 128 128 PHE PHE A . n A 1 132 LEU 132 129 129 LEU LEU A . n A 1 133 LEU 133 130 130 LEU LEU A . n A 1 134 VAL 134 131 131 VAL VAL A . n A 1 135 ALA 135 132 132 ALA ALA A . n A 1 136 VAL 136 133 133 VAL VAL A . n A 1 137 LEU 137 134 134 LEU LEU A . n A 1 138 ALA 138 135 135 ALA ALA A . n A 1 139 LEU 139 136 136 LEU LEU A . n A 1 140 ALA 140 137 137 ALA ALA A . n A 1 141 VAL 141 138 138 VAL VAL A . n A 1 142 VAL 142 139 139 VAL VAL A . n A 1 143 GLY 143 140 140 GLY GLY A . n A 1 144 ILE 144 141 141 ILE ILE A . n A 1 145 PHE 145 142 142 PHE PHE A . n A 1 146 ASN 146 143 143 ASN ASN A . n A 1 147 ILE 147 144 144 ILE ILE A . n A 1 148 PHE 148 145 145 PHE PHE A . n A 1 149 SER 149 146 146 SER SER A . n A 1 150 PRO 150 147 147 PRO PRO A . n A 1 151 LEU 151 148 148 LEU LEU A . n A 1 152 ASN 152 149 149 ASN ASN A . n A 1 153 SER 153 150 150 SER SER A . n A 1 154 ALA 154 151 151 ALA ALA A . n A 1 155 ALA 155 152 152 ALA ALA A . n A 1 156 MET 156 153 153 MET MET A . n A 1 157 MET 157 154 154 MET MET A . n A 1 158 ALA 158 155 155 ALA ALA A . n A 1 159 TYR 159 156 156 TYR TYR A . n A 1 160 SER 160 157 157 SER SER A . n A 1 161 VAL 161 158 158 VAL VAL A . n A 1 162 ILE 162 159 159 ILE ILE A . n A 1 163 GLY 163 160 160 GLY GLY A . n A 1 164 THR 164 161 161 THR THR A . n A 1 165 ILE 165 162 162 ILE ILE A . n A 1 166 VAL 166 163 163 VAL VAL A . n A 1 167 PHE 167 164 164 PHE PHE A . n A 1 168 SER 168 165 165 SER SER A . n A 1 169 LEU 169 166 166 LEU LEU A . n A 1 170 TYR 170 167 167 TYR TYR A . n A 1 171 ILE 171 168 168 ILE ILE A . n A 1 172 LEU 172 169 169 LEU LEU A . n A 1 173 TYR 173 170 170 TYR TYR A . n A 1 174 ASP 174 171 171 ASP ASP A . n A 1 175 LEU 175 172 172 LEU LEU A . n A 1 176 ASN 176 173 173 ASN ASN A . n A 1 177 GLN 177 174 174 GLN GLN A . n A 1 178 ILE 178 175 175 ILE ILE A . n A 1 179 LYS 179 176 176 LYS LYS A . n A 1 180 HIS 180 177 177 HIS HIS A . n A 1 181 ARG 181 178 178 ARG ARG A . n A 1 182 HIS 182 179 179 HIS HIS A . n A 1 183 ILE 183 180 180 ILE ILE A . n A 1 184 THR 184 181 181 THR THR A . n A 1 185 GLU 185 182 182 GLU GLU A . n A 1 186 ASP 186 183 183 ASP ASP A . n A 1 187 LEU 187 184 184 LEU LEU A . n A 1 188 ILE 188 185 185 ILE ILE A . n A 1 189 PRO 189 186 186 PRO PRO A . n A 1 190 VAL 190 187 187 VAL VAL A . n A 1 191 MET 191 188 188 MET MET A . n A 1 192 ALA 192 189 189 ALA ALA A . n A 1 193 LEU 193 190 190 LEU LEU A . n A 1 194 SER 194 191 191 SER SER A . n A 1 195 LEU 195 192 192 LEU LEU A . n A 1 196 TYR 196 193 193 TYR TYR A . n A 1 197 LEU 197 194 194 LEU LEU A . n A 1 198 ASP 198 195 195 ASP ASP A . n A 1 199 PHE 199 196 196 PHE PHE A . n A 1 200 ILE 200 197 197 ILE ILE A . n A 1 201 ASN 201 198 198 ASN ASN A . n A 1 202 LEU 202 199 199 LEU LEU A . n A 1 203 PHE 203 200 200 PHE PHE A . n A 1 204 ILE 204 201 201 ILE ILE A . n A 1 205 ASN 205 202 202 ASN ASN A . n A 1 206 LEU 206 203 203 LEU LEU A . n A 1 207 LEU 207 204 204 LEU LEU A . n A 1 208 ARG 208 205 205 ARG ARG A . n A 1 209 PHE 209 206 206 PHE PHE A . n A 1 210 PHE 210 207 207 PHE PHE A . n A 1 211 GLY 211 208 208 GLY GLY A . n A 1 212 ILE 212 209 209 ILE ILE A . n A 1 213 LEU 213 210 210 LEU LEU A . n A 1 214 SER 214 211 211 SER SER A . n A 1 215 SER 215 212 212 SER SER A . n A 1 216 ASP 216 213 ? ? ? A . n A 1 217 ASP 217 214 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 6 HOH HOH A . B 2 HOH 2 302 11 HOH HOH A . B 2 HOH 3 303 7 HOH HOH A . B 2 HOH 4 304 5 HOH HOH A . B 2 HOH 5 305 9 HOH HOH A . B 2 HOH 6 306 8 HOH HOH A . B 2 HOH 7 307 1 HOH HOH A . B 2 HOH 8 308 2 HOH HOH A . B 2 HOH 9 309 3 HOH HOH A . B 2 HOH 10 310 4 HOH HOH A . B 2 HOH 11 311 10 HOH HOH A . B 2 HOH 12 312 12 HOH HOH A . B 2 HOH 13 313 13 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ARG 62 ? CG ? A ARG 65 CG 2 1 Y 1 A ARG 62 ? CD ? A ARG 65 CD 3 1 Y 1 A ARG 62 ? NE ? A ARG 65 NE 4 1 Y 1 A ARG 62 ? CZ ? A ARG 65 CZ 5 1 Y 1 A ARG 62 ? NH1 ? A ARG 65 NH1 6 1 Y 1 A ARG 62 ? NH2 ? A ARG 65 NH2 # _software.citation_id ? _software.classification refinement _software.compiler_name . _software.compiler_version . _software.contact_author . _software.contact_author_email . _software.date . _software.description . _software.dependencies . _software.hardware . _software.language . _software.location . _software.mods . _software.name PHENIX _software.os . _software.os_version . _software.type . _software.version '(phenix.refine: 1.8_1069)' _software.pdbx_ordinal 1 # _cell.entry_id 4PGV _cell.length_a 62.146 _cell.length_b 62.146 _cell.length_c 293.305 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4PGV _symmetry.cell_setting . _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall . _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M . # _exptl.absorpt_coefficient_mu . _exptl.absorpt_correction_T_max . _exptl.absorpt_correction_T_min . _exptl.absorpt_correction_type . _exptl.absorpt_process_details . _exptl.entry_id 4PGV _exptl.crystals_number . _exptl.details . _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details . # _exptl_crystal.colour . _exptl_crystal.density_diffrn . _exptl_crystal.density_Matthews 3.39 _exptl_crystal.density_method . _exptl_crystal.density_percent_sol 63.71 _exptl_crystal.description . _exptl_crystal.F_000 . _exptl_crystal.id 1 _exptl_crystal.preparation . _exptl_crystal.size_max . _exptl_crystal.size_mid . _exptl_crystal.size_min . _exptl_crystal.size_rad . _exptl_crystal.colour_lustre . _exptl_crystal.colour_modifier . _exptl_crystal.colour_primary . _exptl_crystal.density_meas . _exptl_crystal.density_meas_esd . _exptl_crystal.density_meas_gt . _exptl_crystal.density_meas_lt . _exptl_crystal.density_meas_temp . _exptl_crystal.density_meas_temp_esd . _exptl_crystal.density_meas_temp_gt . _exptl_crystal.density_meas_temp_lt . _exptl_crystal.pdbx_crystal_image_url . _exptl_crystal.pdbx_crystal_image_format . _exptl_crystal.pdbx_mosaicity . _exptl_crystal.pdbx_mosaicity_esd . # _exptl_crystal_grow.apparatus . _exptl_crystal_grow.atmosphere . _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details . _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref . _exptl_crystal_grow.pH . _exptl_crystal_grow.pressure . _exptl_crystal_grow.pressure_esd . _exptl_crystal_grow.seeding . _exptl_crystal_grow.seeding_ref . _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details . _exptl_crystal_grow.temp_esd . _exptl_crystal_grow.time . _exptl_crystal_grow.pdbx_details '30% PEG 600, 100 mM CaCl2, 100 mM Tris-HCl, pH 8.0' _exptl_crystal_grow.pdbx_pH_range . # _diffrn.ambient_environment . _diffrn.ambient_temp 100 _diffrn.ambient_temp_details . _diffrn.ambient_temp_esd . _diffrn.crystal_id 1 _diffrn.crystal_support . _diffrn.crystal_treatment . _diffrn.details . _diffrn.id 1 _diffrn.ambient_pressure . _diffrn.ambient_pressure_esd . _diffrn.ambient_pressure_gt . _diffrn.ambient_pressure_lt . _diffrn.ambient_temp_gt . _diffrn.ambient_temp_lt . # _diffrn_detector.details . _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.area_resol_mean . _diffrn_detector.dtime . _diffrn_detector.pdbx_frames_total . _diffrn_detector.pdbx_collection_time_total . _diffrn_detector.pdbx_collection_date 2013-04-21 # _diffrn_radiation.collimation . _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge . _diffrn_radiation.inhomogeneity . _diffrn_radiation.monochromator . _diffrn_radiation.polarisn_norm . _diffrn_radiation.polarisn_ratio . _diffrn_radiation.probe . _diffrn_radiation.type . _diffrn_radiation.xray_symbol . _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list . _diffrn_radiation.pdbx_wavelength . _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer . _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current . _diffrn_source.details . _diffrn_source.diffrn_id 1 _diffrn_source.power . _diffrn_source.size . _diffrn_source.source SYNCHROTRON _diffrn_source.target . _diffrn_source.type 'NSLS BEAMLINE X4C' _diffrn_source.voltage . _diffrn_source.take-off_angle . _diffrn_source.pdbx_wavelength_list 0.979 _diffrn_source.pdbx_wavelength . _diffrn_source.pdbx_synchrotron_beamline X4C _diffrn_source.pdbx_synchrotron_site NSLS # _reflns.B_iso_Wilson_estimate . _reflns.entry_id 4PGV _reflns.data_reduction_details . _reflns.data_reduction_method . _reflns.d_resolution_high 2.61 _reflns.d_resolution_low 40.0 _reflns.details . _reflns.limit_h_max . _reflns.limit_h_min . _reflns.limit_k_max . _reflns.limit_k_min . _reflns.limit_l_max . _reflns.limit_l_min . _reflns.number_all . _reflns.number_obs 11124 _reflns.observed_criterion . _reflns.observed_criterion_F_max . _reflns.observed_criterion_F_min . _reflns.observed_criterion_I_max . _reflns.observed_criterion_I_min . _reflns.observed_criterion_sigma_F . _reflns.observed_criterion_sigma_I . _reflns.percent_possible_obs 99.7 _reflns.R_free_details . _reflns.Rmerge_F_all . _reflns.Rmerge_F_obs . _reflns.Friedel_coverage . _reflns.number_gt . _reflns.threshold_expression . _reflns.pdbx_redundancy 10.9 _reflns.pdbx_Rmerge_I_obs . _reflns.pdbx_Rmerge_I_all . _reflns.pdbx_Rsym_value . _reflns.pdbx_netI_over_av_sigmaI . _reflns.pdbx_netI_over_sigmaI 13.0 _reflns.pdbx_res_netI_over_av_sigmaI_2 . _reflns.pdbx_res_netI_over_sigmaI_2 . _reflns.pdbx_chi_squared . _reflns.pdbx_scaling_rejects . _reflns.pdbx_d_res_high_opt . _reflns.pdbx_d_res_low_opt . _reflns.pdbx_d_res_opt_method . _reflns.phase_calculation_details . _reflns.pdbx_Rrim_I_all . _reflns.pdbx_Rpim_I_all . _reflns.pdbx_d_opt . _reflns.pdbx_number_measured_all . _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 # _refine.aniso_B[1][1] . _refine.aniso_B[1][2] . _refine.aniso_B[1][3] . _refine.aniso_B[2][2] . _refine.aniso_B[2][3] . _refine.aniso_B[3][3] . _refine.B_iso_max . _refine.B_iso_mean . _refine.B_iso_min . _refine.correlation_coeff_Fo_to_Fc . _refine.correlation_coeff_Fo_to_Fc_free . _refine.details . _refine.diff_density_max . _refine.diff_density_max_esd . _refine.diff_density_min . _refine.diff_density_min_esd . _refine.diff_density_rms . _refine.diff_density_rms_esd . _refine.entry_id 4PGV _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details . _refine.ls_abs_structure_Flack . _refine.ls_abs_structure_Flack_esd . _refine.ls_abs_structure_Rogers . _refine.ls_abs_structure_Rogers_esd . _refine.ls_d_res_high 2.610 _refine.ls_d_res_low 39.658 _refine.ls_extinction_coef . _refine.ls_extinction_coef_esd . _refine.ls_extinction_expression . _refine.ls_extinction_method . _refine.ls_goodness_of_fit_all . _refine.ls_goodness_of_fit_all_esd . _refine.ls_goodness_of_fit_obs . _refine.ls_goodness_of_fit_obs_esd . _refine.ls_hydrogen_treatment . _refine.ls_matrix_type . _refine.ls_number_constraints . _refine.ls_number_parameters . _refine.ls_number_reflns_all . _refine.ls_number_reflns_obs 11031 _refine.ls_number_reflns_R_free 551 _refine.ls_number_reflns_R_work . _refine.ls_number_restraints . _refine.ls_percent_reflns_obs 99.65 _refine.ls_percent_reflns_R_free 5.00 _refine.ls_R_factor_all . _refine.ls_R_factor_obs 0.2257 _refine.ls_R_factor_R_free 0.2712 _refine.ls_R_factor_R_free_error . _refine.ls_R_factor_R_free_error_details . _refine.ls_R_factor_R_work 0.2233 _refine.ls_R_Fsqd_factor_obs . _refine.ls_R_I_factor_obs . _refine.ls_redundancy_reflns_all . _refine.ls_redundancy_reflns_obs . _refine.ls_restrained_S_all . _refine.ls_restrained_S_obs . _refine.ls_shift_over_esd_max . _refine.ls_shift_over_esd_mean . _refine.ls_structure_factor_coef . _refine.ls_weighting_details . _refine.ls_weighting_scheme . _refine.ls_wR_factor_all . _refine.ls_wR_factor_obs . _refine.ls_wR_factor_R_free . _refine.ls_wR_factor_R_work . _refine.occupancy_max . _refine.occupancy_min . _refine.overall_SU_B . _refine.overall_SU_ML 0.25 _refine.overall_SU_R_Cruickshank_DPI . _refine.overall_SU_R_free . _refine.overall_FOM_free_R_set . _refine.overall_FOM_work_R_set . _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol . _refine.solvent_model_param_ksol . _refine.ls_R_factor_gt . _refine.ls_goodness_of_fit_gt . _refine.ls_goodness_of_fit_ref . _refine.ls_shift_over_su_max . _refine.ls_shift_over_su_max_lt . _refine.ls_shift_over_su_mean . _refine.ls_shift_over_su_mean_lt . _refine.pdbx_ls_sigma_I . _refine.pdbx_ls_sigma_F 1.39 _refine.pdbx_ls_sigma_Fsqd . _refine.pdbx_data_cutoff_high_absF . _refine.pdbx_data_cutoff_high_rms_absF . _refine.pdbx_data_cutoff_low_absF . _refine.pdbx_isotropic_thermal_model . _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct . _refine.pdbx_starting_model . _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details . _refine.pdbx_stereochem_target_val_spec_case . _refine.pdbx_overall_ESU_R . _refine.pdbx_overall_ESU_R_Free . _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii . _refine.pdbx_solvent_shrinkage_radii 0.70 _refine.pdbx_real_space_R . _refine.pdbx_density_correlation . _refine.pdbx_pd_number_of_powder_patterns . _refine.pdbx_pd_number_of_points . _refine.pdbx_pd_meas_number_of_points . _refine.pdbx_pd_proc_ls_prof_R_factor . _refine.pdbx_pd_proc_ls_prof_wR_factor . _refine.pdbx_pd_Marquardt_correlation_coeff . _refine.pdbx_pd_Fsqrd_R_factor . _refine.pdbx_pd_ls_matrix_band_width . _refine.pdbx_overall_phase_error 26.98 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI . _refine.pdbx_overall_SU_R_free_Blow_DPI . _refine.pdbx_overall_SU_R_Blow_DPI . _refine.pdbx_TLS_residual_ADP_flag . _refine.pdbx_diffrn_id 1 # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1626 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 13 _refine_hist.number_atoms_total 1639 _refine_hist.d_res_high 2.610 _refine_hist.d_res_low 39.658 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' . 0.004 . 1667 . f_bond_d . . 'X-RAY DIFFRACTION' . 0.720 . 2267 . f_angle_d . . 'X-RAY DIFFRACTION' . 11.743 . 566 . f_dihedral_angle_d . . 'X-RAY DIFFRACTION' . 0.050 . 279 . f_chiral_restr . . 'X-RAY DIFFRACTION' . 0.003 . 268 . f_plane_restr . . # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error 'X-RAY DIFFRACTION' 2.6101 2.8727 . . 132 2513 100.00 . . . 0.3421 . 0.2620 . . . . . . . . 'X-RAY DIFFRACTION' 2.8727 3.2882 . . 136 2569 100.00 . . . 0.3383 . 0.2490 . . . . . . . . 'X-RAY DIFFRACTION' 3.2882 4.1421 . . 147 2596 100.00 . . . 0.2866 . 0.2191 . . . . . . . . 'X-RAY DIFFRACTION' 4.1421 39.6622 . . 136 2802 99.00 . . . 0.2253 . 0.2103 . . . . . . . . # _struct.entry_id 4PGV _struct.title 'Crystal structure of YetJ from Bacillus Subtilis at pH 8 by back soaking' _struct.pdbx_model_details . _struct.pdbx_formula_weight . _struct.pdbx_formula_weight_method . _struct.pdbx_model_type_details . _struct.pdbx_CASP_flag . # _struct_keywords.entry_id 4PGV _struct_keywords.text ;Membrane protein, 7-TMs, triple-helix sandwich, di-aspartyl pH sensor, calcium leak, closed conformation, Structural Genomics, PSI-Biology, New York Consortium on Membrane Protein Structure, NYCOMPS, Membrance Protein ; _struct_keywords.pdbx_keywords 'Membrance Protein' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YETJ_BACSU _struct_ref.pdbx_db_accession O31539 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQATVHESKQSIMQRILTVFVFTLLIATVGLFIGQFVPVALMLPLSILEVAMIILAFWMRRRKAVGYAFVYTFAFVSGIT LFPIVSHYASIAGAYVVLEAFGSTFVIFAVLGTIGAKMKKDLSFLWSFLLVAVLALAVVGIFNIFSPLNSAAMMAYSVIG TIVFSLYILYDLNQIKHRHITEDLIPVMALSLYLDFINLFINLLRFFGILSSDD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4PGV _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 217 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O31539 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 214 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 214 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4PGV SER A 1 ? UNP O31539 ? ? 'expression tag' -2 1 1 4PGV ASN A 2 ? UNP O31539 ? ? 'expression tag' -1 2 1 4PGV ALA A 3 ? UNP O31539 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 11 ? GLY A 37 ? SER A 8 GLY A 34 1 ? 27 HELX_P HELX_P2 AA2 GLN A 38 ? VAL A 40 ? GLN A 35 VAL A 37 5 ? 3 HELX_P HELX_P3 AA3 PRO A 41 ? MET A 45 ? PRO A 38 MET A 42 5 ? 5 HELX_P HELX_P4 AA4 PRO A 47 ? MET A 62 ? PRO A 44 MET A 59 1 ? 16 HELX_P HELX_P5 AA5 GLY A 69 ? LEU A 84 ? GLY A 66 LEU A 81 1 ? 16 HELX_P HELX_P6 AA6 LEU A 84 ? SER A 93 ? LEU A 81 SER A 90 1 ? 10 HELX_P HELX_P7 AA7 ALA A 97 ? MET A 121 ? ALA A 94 MET A 118 1 ? 25 HELX_P HELX_P8 AA8 ASP A 124 ? PHE A 127 ? ASP A 121 PHE A 124 5 ? 4 HELX_P HELX_P9 AA9 LEU A 128 ? SER A 149 ? LEU A 125 SER A 146 1 ? 22 HELX_P HELX_P10 AB1 ASN A 152 ? ARG A 181 ? ASN A 149 ARG A 178 1 ? 30 HELX_P HELX_P11 AB2 LEU A 187 ? SER A 214 ? LEU A 184 SER A 211 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A GLY 34 ? ? O A HOH 311 ? ? 2.12 2 1 OE2 A GLU 182 ? ? O A HOH 310 ? ? 2.17 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 60 ? ? -96.63 43.90 2 1 ARG A 62 ? ? -69.01 3.11 3 1 ALA A 92 ? ? -140.30 -9.22 4 1 SER A 211 ? ? -99.04 32.38 # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'New York Consortium on Membrane Protein Structure' _pdbx_SG_project.initial_of_center NYCOMPS # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' . refined 17.4591 34.3763 -5.2055 0.1619 . -0.0675 . 0.0150 . 0.6472 . 0.0518 . 0.4383 . 3.5299 . -0.6647 . -0.9510 . 6.1234 . 0.0794 . 2.8805 . -0.2439 . 0.1778 . 0.3517 . -0.5829 . 0.5879 . 0.1318 . -0.1767 . -0.0800 . -0.0652 . 2 'X-RAY DIFFRACTION' . refined 18.5544 18.3469 11.3982 0.2139 . 0.0878 . -0.0450 . 0.7295 . 0.0003 . 0.7096 . 2.3302 . -0.5504 . -3.3909 . 1.7783 . 1.5149 . 5.9742 . -0.6943 . -0.3689 . -1.0118 . 0.4967 . 0.1262 . -0.4472 . 1.1189 . 0.0058 . 0.2414 . 3 'X-RAY DIFFRACTION' . refined 19.6892 38.3548 11.5876 0.5042 . 0.1092 . 0.0474 . 0.7764 . 0.0033 . 0.6677 . 8.3766 . -2.2219 . -4.9323 . 1.6976 . 1.6104 . 2.9739 . 0.8930 . -0.5641 . 2.7430 . 0.8197 . 0.3816 . -1.0190 . -1.2325 . 0.2808 . -0.8640 . 4 'X-RAY DIFFRACTION' . refined 13.4309 21.1112 1.4310 0.2000 . -0.0232 . -0.0331 . 0.9373 . -0.0195 . 0.5701 . 0.7315 . -0.8499 . -0.3294 . 0.9536 . 0.4026 . 0.1160 . -0.2435 . 1.3122 . -0.6145 . 0.1922 . 0.3593 . 0.1554 . 0.4393 . 0.1655 . 0.0467 . 5 'X-RAY DIFFRACTION' . refined 1.1611 41.6651 -1.0621 -0.0012 . 0.0852 . 0.1464 . 1.2740 . 0.4558 . 0.5813 . 2.8290 . 1.3757 . -1.1985 . 0.7214 . -1.0145 . 3.6119 . 0.0479 . 0.2211 . 0.6402 . -0.0004 . 0.5932 . 0.0769 . -0.6777 . -1.1153 . -0.1632 . 6 'X-RAY DIFFRACTION' . refined 6.0443 29.1660 18.4007 0.2205 . 0.0719 . 0.0557 . 0.5064 . 0.0979 . 0.3950 . 2.7300 . 0.1213 . 0.5812 . 4.4781 . -1.8432 . 3.6934 . -0.1836 . 0.0336 . -0.2745 . 0.5029 . 0.7416 . 0.7973 . -0.2213 . -0.1656 . -0.4687 . 7 'X-RAY DIFFRACTION' . refined 6.9000 37.1056 6.6660 0.2451 . 0.1863 . -0.0075 . 0.7807 . 0.0907 . 0.5214 . 2.0497 . 1.0888 . -1.2300 . 2.2582 . -0.0872 . 1.3578 . 0.0798 . 0.1586 . 0.5673 . 0.3175 . 0.0689 . -0.1920 . -0.2546 . -0.0959 . -0.0298 . 8 'X-RAY DIFFRACTION' . refined 8.8194 25.9485 4.9486 0.2634 . -0.0058 . 0.0092 . 0.8014 . 0.0158 . 0.5755 . 4.4349 . 1.3053 . -0.4258 . 1.2076 . -0.5666 . 1.2757 . -0.2745 . 0.2018 . 0.0654 . -0.1912 . 0.4486 . 0.3841 . 0.0510 . -0.2434 . -0.0695 . # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 . . . . . . . . . '(chain A and resid 6:35)' 2 'X-RAY DIFFRACTION' 2 . . . . . . . . . '(chain A and resid 36:56)' 3 'X-RAY DIFFRACTION' 3 . . . . . . . . . '(chain A and resid 57:66)' 4 'X-RAY DIFFRACTION' 4 . . . . . . . . . '(chain A and resid 67:107)' 5 'X-RAY DIFFRACTION' 5 . . . . . . . . . '(chain A and resid 108:121)' 6 'X-RAY DIFFRACTION' 6 . . . . . . . . . '(chain A and resid 122:151)' 7 'X-RAY DIFFRACTION' 7 . . . . . . . . . '(chain A and resid 152:184)' 8 'X-RAY DIFFRACTION' 8 . . . . . . . . . '(chain A and resid 185:212)' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A ALA 0 ? A ALA 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A GLN 2 ? A GLN 5 6 1 Y 1 A ALA 3 ? A ALA 6 7 1 Y 1 A THR 4 ? A THR 7 8 1 Y 1 A VAL 5 ? A VAL 8 9 1 Y 1 A ASP 213 ? A ASP 216 10 1 Y 1 A ASP 214 ? A ASP 217 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 GLN N N N N 74 GLN CA C N S 75 GLN C C N N 76 GLN O O N N 77 GLN CB C N N 78 GLN CG C N N 79 GLN CD C N N 80 GLN OE1 O N N 81 GLN NE2 N N N 82 GLN OXT O N N 83 GLN H H N N 84 GLN H2 H N N 85 GLN HA H N N 86 GLN HB2 H N N 87 GLN HB3 H N N 88 GLN HG2 H N N 89 GLN HG3 H N N 90 GLN HE21 H N N 91 GLN HE22 H N N 92 GLN HXT H N N 93 GLU N N N N 94 GLU CA C N S 95 GLU C C N N 96 GLU O O N N 97 GLU CB C N N 98 GLU CG C N N 99 GLU CD C N N 100 GLU OE1 O N N 101 GLU OE2 O N N 102 GLU OXT O N N 103 GLU H H N N 104 GLU H2 H N N 105 GLU HA H N N 106 GLU HB2 H N N 107 GLU HB3 H N N 108 GLU HG2 H N N 109 GLU HG3 H N N 110 GLU HE2 H N N 111 GLU HXT H N N 112 GLY N N N N 113 GLY CA C N N 114 GLY C C N N 115 GLY O O N N 116 GLY OXT O N N 117 GLY H H N N 118 GLY H2 H N N 119 GLY HA2 H N N 120 GLY HA3 H N N 121 GLY HXT H N N 122 HIS N N N N 123 HIS CA C N S 124 HIS C C N N 125 HIS O O N N 126 HIS CB C N N 127 HIS CG C Y N 128 HIS ND1 N Y N 129 HIS CD2 C Y N 130 HIS CE1 C Y N 131 HIS NE2 N Y N 132 HIS OXT O N N 133 HIS H H N N 134 HIS H2 H N N 135 HIS HA H N N 136 HIS HB2 H N N 137 HIS HB3 H N N 138 HIS HD1 H N N 139 HIS HD2 H N N 140 HIS HE1 H N N 141 HIS HE2 H N N 142 HIS HXT H N N 143 HOH O O N N 144 HOH H1 H N N 145 HOH H2 H N N 146 ILE N N N N 147 ILE CA C N S 148 ILE C C N N 149 ILE O O N N 150 ILE CB C N S 151 ILE CG1 C N N 152 ILE CG2 C N N 153 ILE CD1 C N N 154 ILE OXT O N N 155 ILE H H N N 156 ILE H2 H N N 157 ILE HA H N N 158 ILE HB H N N 159 ILE HG12 H N N 160 ILE HG13 H N N 161 ILE HG21 H N N 162 ILE HG22 H N N 163 ILE HG23 H N N 164 ILE HD11 H N N 165 ILE HD12 H N N 166 ILE HD13 H N N 167 ILE HXT H N N 168 LEU N N N N 169 LEU CA C N S 170 LEU C C N N 171 LEU O O N N 172 LEU CB C N N 173 LEU CG C N N 174 LEU CD1 C N N 175 LEU CD2 C N N 176 LEU OXT O N N 177 LEU H H N N 178 LEU H2 H N N 179 LEU HA H N N 180 LEU HB2 H N N 181 LEU HB3 H N N 182 LEU HG H N N 183 LEU HD11 H N N 184 LEU HD12 H N N 185 LEU HD13 H N N 186 LEU HD21 H N N 187 LEU HD22 H N N 188 LEU HD23 H N N 189 LEU HXT H N N 190 LYS N N N N 191 LYS CA C N S 192 LYS C C N N 193 LYS O O N N 194 LYS CB C N N 195 LYS CG C N N 196 LYS CD C N N 197 LYS CE C N N 198 LYS NZ N N N 199 LYS OXT O N N 200 LYS H H N N 201 LYS H2 H N N 202 LYS HA H N N 203 LYS HB2 H N N 204 LYS HB3 H N N 205 LYS HG2 H N N 206 LYS HG3 H N N 207 LYS HD2 H N N 208 LYS HD3 H N N 209 LYS HE2 H N N 210 LYS HE3 H N N 211 LYS HZ1 H N N 212 LYS HZ2 H N N 213 LYS HZ3 H N N 214 LYS HXT H N N 215 MET N N N N 216 MET CA C N S 217 MET C C N N 218 MET O O N N 219 MET CB C N N 220 MET CG C N N 221 MET SD S N N 222 MET CE C N N 223 MET OXT O N N 224 MET H H N N 225 MET H2 H N N 226 MET HA H N N 227 MET HB2 H N N 228 MET HB3 H N N 229 MET HG2 H N N 230 MET HG3 H N N 231 MET HE1 H N N 232 MET HE2 H N N 233 MET HE3 H N N 234 MET HXT H N N 235 PHE N N N N 236 PHE CA C N S 237 PHE C C N N 238 PHE O O N N 239 PHE CB C N N 240 PHE CG C Y N 241 PHE CD1 C Y N 242 PHE CD2 C Y N 243 PHE CE1 C Y N 244 PHE CE2 C Y N 245 PHE CZ C Y N 246 PHE OXT O N N 247 PHE H H N N 248 PHE H2 H N N 249 PHE HA H N N 250 PHE HB2 H N N 251 PHE HB3 H N N 252 PHE HD1 H N N 253 PHE HD2 H N N 254 PHE HE1 H N N 255 PHE HE2 H N N 256 PHE HZ H N N 257 PHE HXT H N N 258 PRO N N N N 259 PRO CA C N S 260 PRO C C N N 261 PRO O O N N 262 PRO CB C N N 263 PRO CG C N N 264 PRO CD C N N 265 PRO OXT O N N 266 PRO H H N N 267 PRO HA H N N 268 PRO HB2 H N N 269 PRO HB3 H N N 270 PRO HG2 H N N 271 PRO HG3 H N N 272 PRO HD2 H N N 273 PRO HD3 H N N 274 PRO HXT H N N 275 SER N N N N 276 SER CA C N S 277 SER C C N N 278 SER O O N N 279 SER CB C N N 280 SER OG O N N 281 SER OXT O N N 282 SER H H N N 283 SER H2 H N N 284 SER HA H N N 285 SER HB2 H N N 286 SER HB3 H N N 287 SER HG H N N 288 SER HXT H N N 289 THR N N N N 290 THR CA C N S 291 THR C C N N 292 THR O O N N 293 THR CB C N R 294 THR OG1 O N N 295 THR CG2 C N N 296 THR OXT O N N 297 THR H H N N 298 THR H2 H N N 299 THR HA H N N 300 THR HB H N N 301 THR HG1 H N N 302 THR HG21 H N N 303 THR HG22 H N N 304 THR HG23 H N N 305 THR HXT H N N 306 TRP N N N N 307 TRP CA C N S 308 TRP C C N N 309 TRP O O N N 310 TRP CB C N N 311 TRP CG C Y N 312 TRP CD1 C Y N 313 TRP CD2 C Y N 314 TRP NE1 N Y N 315 TRP CE2 C Y N 316 TRP CE3 C Y N 317 TRP CZ2 C Y N 318 TRP CZ3 C Y N 319 TRP CH2 C Y N 320 TRP OXT O N N 321 TRP H H N N 322 TRP H2 H N N 323 TRP HA H N N 324 TRP HB2 H N N 325 TRP HB3 H N N 326 TRP HD1 H N N 327 TRP HE1 H N N 328 TRP HE3 H N N 329 TRP HZ2 H N N 330 TRP HZ3 H N N 331 TRP HH2 H N N 332 TRP HXT H N N 333 TYR N N N N 334 TYR CA C N S 335 TYR C C N N 336 TYR O O N N 337 TYR CB C N N 338 TYR CG C Y N 339 TYR CD1 C Y N 340 TYR CD2 C Y N 341 TYR CE1 C Y N 342 TYR CE2 C Y N 343 TYR CZ C Y N 344 TYR OH O N N 345 TYR OXT O N N 346 TYR H H N N 347 TYR H2 H N N 348 TYR HA H N N 349 TYR HB2 H N N 350 TYR HB3 H N N 351 TYR HD1 H N N 352 TYR HD2 H N N 353 TYR HE1 H N N 354 TYR HE2 H N N 355 TYR HH H N N 356 TYR HXT H N N 357 VAL N N N N 358 VAL CA C N S 359 VAL C C N N 360 VAL O O N N 361 VAL CB C N N 362 VAL CG1 C N N 363 VAL CG2 C N N 364 VAL OXT O N N 365 VAL H H N N 366 VAL H2 H N N 367 VAL HA H N N 368 VAL HB H N N 369 VAL HG11 H N N 370 VAL HG12 H N N 371 VAL HG13 H N N 372 VAL HG21 H N N 373 VAL HG22 H N N 374 VAL HG23 H N N 375 VAL HXT H N N 376 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 HOH O H1 sing N N 137 HOH O H2 sing N N 138 ILE N CA sing N N 139 ILE N H sing N N 140 ILE N H2 sing N N 141 ILE CA C sing N N 142 ILE CA CB sing N N 143 ILE CA HA sing N N 144 ILE C O doub N N 145 ILE C OXT sing N N 146 ILE CB CG1 sing N N 147 ILE CB CG2 sing N N 148 ILE CB HB sing N N 149 ILE CG1 CD1 sing N N 150 ILE CG1 HG12 sing N N 151 ILE CG1 HG13 sing N N 152 ILE CG2 HG21 sing N N 153 ILE CG2 HG22 sing N N 154 ILE CG2 HG23 sing N N 155 ILE CD1 HD11 sing N N 156 ILE CD1 HD12 sing N N 157 ILE CD1 HD13 sing N N 158 ILE OXT HXT sing N N 159 LEU N CA sing N N 160 LEU N H sing N N 161 LEU N H2 sing N N 162 LEU CA C sing N N 163 LEU CA CB sing N N 164 LEU CA HA sing N N 165 LEU C O doub N N 166 LEU C OXT sing N N 167 LEU CB CG sing N N 168 LEU CB HB2 sing N N 169 LEU CB HB3 sing N N 170 LEU CG CD1 sing N N 171 LEU CG CD2 sing N N 172 LEU CG HG sing N N 173 LEU CD1 HD11 sing N N 174 LEU CD1 HD12 sing N N 175 LEU CD1 HD13 sing N N 176 LEU CD2 HD21 sing N N 177 LEU CD2 HD22 sing N N 178 LEU CD2 HD23 sing N N 179 LEU OXT HXT sing N N 180 LYS N CA sing N N 181 LYS N H sing N N 182 LYS N H2 sing N N 183 LYS CA C sing N N 184 LYS CA CB sing N N 185 LYS CA HA sing N N 186 LYS C O doub N N 187 LYS C OXT sing N N 188 LYS CB CG sing N N 189 LYS CB HB2 sing N N 190 LYS CB HB3 sing N N 191 LYS CG CD sing N N 192 LYS CG HG2 sing N N 193 LYS CG HG3 sing N N 194 LYS CD CE sing N N 195 LYS CD HD2 sing N N 196 LYS CD HD3 sing N N 197 LYS CE NZ sing N N 198 LYS CE HE2 sing N N 199 LYS CE HE3 sing N N 200 LYS NZ HZ1 sing N N 201 LYS NZ HZ2 sing N N 202 LYS NZ HZ3 sing N N 203 LYS OXT HXT sing N N 204 MET N CA sing N N 205 MET N H sing N N 206 MET N H2 sing N N 207 MET CA C sing N N 208 MET CA CB sing N N 209 MET CA HA sing N N 210 MET C O doub N N 211 MET C OXT sing N N 212 MET CB CG sing N N 213 MET CB HB2 sing N N 214 MET CB HB3 sing N N 215 MET CG SD sing N N 216 MET CG HG2 sing N N 217 MET CG HG3 sing N N 218 MET SD CE sing N N 219 MET CE HE1 sing N N 220 MET CE HE2 sing N N 221 MET CE HE3 sing N N 222 MET OXT HXT sing N N 223 PHE N CA sing N N 224 PHE N H sing N N 225 PHE N H2 sing N N 226 PHE CA C sing N N 227 PHE CA CB sing N N 228 PHE CA HA sing N N 229 PHE C O doub N N 230 PHE C OXT sing N N 231 PHE CB CG sing N N 232 PHE CB HB2 sing N N 233 PHE CB HB3 sing N N 234 PHE CG CD1 doub Y N 235 PHE CG CD2 sing Y N 236 PHE CD1 CE1 sing Y N 237 PHE CD1 HD1 sing N N 238 PHE CD2 CE2 doub Y N 239 PHE CD2 HD2 sing N N 240 PHE CE1 CZ doub Y N 241 PHE CE1 HE1 sing N N 242 PHE CE2 CZ sing Y N 243 PHE CE2 HE2 sing N N 244 PHE CZ HZ sing N N 245 PHE OXT HXT sing N N 246 PRO N CA sing N N 247 PRO N CD sing N N 248 PRO N H sing N N 249 PRO CA C sing N N 250 PRO CA CB sing N N 251 PRO CA HA sing N N 252 PRO C O doub N N 253 PRO C OXT sing N N 254 PRO CB CG sing N N 255 PRO CB HB2 sing N N 256 PRO CB HB3 sing N N 257 PRO CG CD sing N N 258 PRO CG HG2 sing N N 259 PRO CG HG3 sing N N 260 PRO CD HD2 sing N N 261 PRO CD HD3 sing N N 262 PRO OXT HXT sing N N 263 SER N CA sing N N 264 SER N H sing N N 265 SER N H2 sing N N 266 SER CA C sing N N 267 SER CA CB sing N N 268 SER CA HA sing N N 269 SER C O doub N N 270 SER C OXT sing N N 271 SER CB OG sing N N 272 SER CB HB2 sing N N 273 SER CB HB3 sing N N 274 SER OG HG sing N N 275 SER OXT HXT sing N N 276 THR N CA sing N N 277 THR N H sing N N 278 THR N H2 sing N N 279 THR CA C sing N N 280 THR CA CB sing N N 281 THR CA HA sing N N 282 THR C O doub N N 283 THR C OXT sing N N 284 THR CB OG1 sing N N 285 THR CB CG2 sing N N 286 THR CB HB sing N N 287 THR OG1 HG1 sing N N 288 THR CG2 HG21 sing N N 289 THR CG2 HG22 sing N N 290 THR CG2 HG23 sing N N 291 THR OXT HXT sing N N 292 TRP N CA sing N N 293 TRP N H sing N N 294 TRP N H2 sing N N 295 TRP CA C sing N N 296 TRP CA CB sing N N 297 TRP CA HA sing N N 298 TRP C O doub N N 299 TRP C OXT sing N N 300 TRP CB CG sing N N 301 TRP CB HB2 sing N N 302 TRP CB HB3 sing N N 303 TRP CG CD1 doub Y N 304 TRP CG CD2 sing Y N 305 TRP CD1 NE1 sing Y N 306 TRP CD1 HD1 sing N N 307 TRP CD2 CE2 doub Y N 308 TRP CD2 CE3 sing Y N 309 TRP NE1 CE2 sing Y N 310 TRP NE1 HE1 sing N N 311 TRP CE2 CZ2 sing Y N 312 TRP CE3 CZ3 doub Y N 313 TRP CE3 HE3 sing N N 314 TRP CZ2 CH2 doub Y N 315 TRP CZ2 HZ2 sing N N 316 TRP CZ3 CH2 sing Y N 317 TRP CZ3 HZ3 sing N N 318 TRP CH2 HH2 sing N N 319 TRP OXT HXT sing N N 320 TYR N CA sing N N 321 TYR N H sing N N 322 TYR N H2 sing N N 323 TYR CA C sing N N 324 TYR CA CB sing N N 325 TYR CA HA sing N N 326 TYR C O doub N N 327 TYR C OXT sing N N 328 TYR CB CG sing N N 329 TYR CB HB2 sing N N 330 TYR CB HB3 sing N N 331 TYR CG CD1 doub Y N 332 TYR CG CD2 sing Y N 333 TYR CD1 CE1 sing Y N 334 TYR CD1 HD1 sing N N 335 TYR CD2 CE2 doub Y N 336 TYR CD2 HD2 sing N N 337 TYR CE1 CZ doub Y N 338 TYR CE1 HE1 sing N N 339 TYR CE2 CZ sing Y N 340 TYR CE2 HE2 sing N N 341 TYR CZ OH sing N N 342 TYR OH HH sing N N 343 TYR OXT HXT sing N N 344 VAL N CA sing N N 345 VAL N H sing N N 346 VAL N H2 sing N N 347 VAL CA C sing N N 348 VAL CA CB sing N N 349 VAL CA HA sing N N 350 VAL C O doub N N 351 VAL C OXT sing N N 352 VAL CB CG1 sing N N 353 VAL CB CG2 sing N N 354 VAL CB HB sing N N 355 VAL CG1 HG11 sing N N 356 VAL CG1 HG12 sing N N 357 VAL CG1 HG13 sing N N 358 VAL CG2 HG21 sing N N 359 VAL CG2 HG22 sing N N 360 VAL CG2 HG23 sing N N 361 VAL OXT HXT sing N N 362 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM095315 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 4PGV _atom_sites.fract_transf_matrix[1][1] 0.016091 _atom_sites.fract_transf_matrix[1][2] 0.009290 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018580 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003409 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_