data_4PPT # _entry.id 4PPT # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.281 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4PPT RCSB RCSB085071 WWPDB D_1000085071 # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4POU . unspecified PDB 4POY . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4PPT _pdbx_database_status.recvd_initial_deposition_date 2014-02-27 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Fanning, S.W.' 1 ? 'Walter, R.' 2 ? 'Horn, J.R.' 3 ? # _citation.id primary _citation.title ;Structural basis of an engineered dual-specific antibody: conformational diversity leads to a hypervariable loop metal-binding site. ; _citation.journal_abbrev 'Protein Eng.Des.Sel.' _citation.journal_volume 27 _citation.page_first 391 _citation.page_last 397 _citation.year 2014 _citation.journal_id_ASTM ? _citation.country UK _citation.journal_id_ISSN 1741-0126 _citation.journal_id_CSD ? _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25143596 _citation.pdbx_database_id_DOI 10.1093/protein/gzu033 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Fanning, S.W.' 1 primary 'Walter, R.' 2 primary 'Horn, J.R.' 3 # _cell.entry_id 4PPT _cell.length_a 53.824 _cell.length_b 61.926 _cell.length_c 66.319 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4PPT _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Engineered single domain VHH antibody' 12942.348 1 ? ? ? ? 2 non-polymer syn 'NICKEL (II) ION' 58.693 1 ? ? ? ? 3 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 91 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;QVQLVESGGGLVQAGGSLRLSCAASGYPHPYLHMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVY LQMDSLKPEDTATYYCAAGGYELRDRTYGHWGQGTQVTVSS ; _entity_poly.pdbx_seq_one_letter_code_can ;QVQLVESGGGLVQAGGSLRLSCAASGYPHPYLHMGWFRQAPGKEREGVAAMDSGGGGTLYADSVKGRFTISRDKGKNTVY LQMDSLKPEDTATYYCAAGGYELRDRTYGHWGQGTQVTVSS ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLN n 1 2 VAL n 1 3 GLN n 1 4 LEU n 1 5 VAL n 1 6 GLU n 1 7 SER n 1 8 GLY n 1 9 GLY n 1 10 GLY n 1 11 LEU n 1 12 VAL n 1 13 GLN n 1 14 ALA n 1 15 GLY n 1 16 GLY n 1 17 SER n 1 18 LEU n 1 19 ARG n 1 20 LEU n 1 21 SER n 1 22 CYS n 1 23 ALA n 1 24 ALA n 1 25 SER n 1 26 GLY n 1 27 TYR n 1 28 PRO n 1 29 HIS n 1 30 PRO n 1 31 TYR n 1 32 LEU n 1 33 HIS n 1 34 MET n 1 35 GLY n 1 36 TRP n 1 37 PHE n 1 38 ARG n 1 39 GLN n 1 40 ALA n 1 41 PRO n 1 42 GLY n 1 43 LYS n 1 44 GLU n 1 45 ARG n 1 46 GLU n 1 47 GLY n 1 48 VAL n 1 49 ALA n 1 50 ALA n 1 51 MET n 1 52 ASP n 1 53 SER n 1 54 GLY n 1 55 GLY n 1 56 GLY n 1 57 GLY n 1 58 THR n 1 59 LEU n 1 60 TYR n 1 61 ALA n 1 62 ASP n 1 63 SER n 1 64 VAL n 1 65 LYS n 1 66 GLY n 1 67 ARG n 1 68 PHE n 1 69 THR n 1 70 ILE n 1 71 SER n 1 72 ARG n 1 73 ASP n 1 74 LYS n 1 75 GLY n 1 76 LYS n 1 77 ASN n 1 78 THR n 1 79 VAL n 1 80 TYR n 1 81 LEU n 1 82 GLN n 1 83 MET n 1 84 ASP n 1 85 SER n 1 86 LEU n 1 87 LYS n 1 88 PRO n 1 89 GLU n 1 90 ASP n 1 91 THR n 1 92 ALA n 1 93 THR n 1 94 TYR n 1 95 TYR n 1 96 CYS n 1 97 ALA n 1 98 ALA n 1 99 GLY n 1 100 GLY n 1 101 TYR n 1 102 GLU n 1 103 LEU n 1 104 ARG n 1 105 ASP n 1 106 ARG n 1 107 THR n 1 108 TYR n 1 109 GLY n 1 110 HIS n 1 111 TRP n 1 112 GLY n 1 113 GLN n 1 114 GLY n 1 115 THR n 1 116 GLN n 1 117 VAL n 1 118 THR n 1 119 VAL n 1 120 SER n 1 121 SER n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Lama glama' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9844 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name PDB _struct_ref.db_code 4PPT _struct_ref.pdbx_db_accession 4PPT _struct_ref.entity_id 1 _struct_ref.pdbx_align_begin ? _struct_ref.pdbx_seq_one_letter_code ? _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4PPT _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 121 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession 4PPT _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 121 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 121 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 NI non-polymer . 'NICKEL (II) ION' ? 'Ni 2' 58.693 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4PPT _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.10 _exptl_crystal.density_percent_sol 41.36 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.temp 298.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pdbx_pH_range ? _exptl_crystal_grow.pdbx_details '1.8 M Ammonium Citrate Tribasic, 0.2 M Ammonium Acetate, pH 7.0, VAPOR DIFFUSION, HANGING DROP, temperature 298.15K' # _diffrn.id 1 _diffrn.ambient_temp ? _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'MAR CCD 165 mm' _diffrn_detector.pdbx_collection_date 2010-07-13 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'APS BEAMLINE 22-BM' _diffrn_source.pdbx_synchrotron_site APS _diffrn_source.pdbx_synchrotron_beamline 22-BM _diffrn_source.pdbx_wavelength 0.97 _diffrn_source.pdbx_wavelength_list ? # _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.entry_id 4PPT _reflns.observed_criterion_sigma_I 2.000 _reflns.observed_criterion_sigma_F ? _reflns.d_resolution_low 50.000 _reflns.d_resolution_high 1.500 _reflns.number_obs 110728 _reflns.number_all ? _reflns.percent_possible_obs 99.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy 11.800 _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4PPT _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 16571 _refine.ls_number_reflns_all 16571 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.000 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 34.64 _refine.ls_d_res_high 1.50 _refine.ls_percent_reflns_obs 96.5 _refine.ls_R_factor_obs 0.194 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.192 _refine.ls_R_factor_R_free 0.224 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.200 _refine.ls_number_reflns_R_free 903 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.962 _refine.correlation_coeff_Fo_to_Fc_free 0.943 _refine.B_iso_mean 22.84 _refine.aniso_B[1][1] -0.14000 _refine.aniso_B[2][2] 0.10000 _refine.aniso_B[3][3] 0.04000 _refine.aniso_B[1][2] -0.00000 _refine.aniso_B[1][3] -0.00000 _refine.aniso_B[2][3] 0.00000 _refine.solvent_model_details MASK _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii 0.80 _refine.pdbx_solvent_shrinkage_radii 0.80 _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details 'HYDROGENS HAVE BEEN USED IF PRESENT IN THE INPUT' _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R 0.085 _refine.pdbx_overall_ESU_R_Free 0.086 _refine.overall_SU_ML 0.051 _refine.pdbx_overall_phase_error ? _refine.overall_SU_B 1.351 _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 908 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 91 _refine_hist.number_atoms_total 1005 _refine_hist.d_res_high 1.50 _refine_hist.d_res_low 34.64 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function r_bond_refined_d 0.015 0.019 ? 950 'X-RAY DIFFRACTION' ? r_bond_other_d ? ? ? ? 'X-RAY DIFFRACTION' ? r_angle_refined_deg 1.570 1.950 ? 1288 'X-RAY DIFFRACTION' ? r_angle_other_deg ? ? ? ? 'X-RAY DIFFRACTION' ? r_dihedral_angle_1_deg 8.754 5.000 ? 124 'X-RAY DIFFRACTION' ? r_dihedral_angle_2_deg 33.311 22.927 ? 41 'X-RAY DIFFRACTION' ? r_dihedral_angle_3_deg 13.438 15.000 ? 146 'X-RAY DIFFRACTION' ? r_dihedral_angle_4_deg 26.596 15.000 ? 7 'X-RAY DIFFRACTION' ? r_chiral_restr 0.126 0.200 ? 132 'X-RAY DIFFRACTION' ? r_gen_planes_refined 0.016 0.021 ? 739 'X-RAY DIFFRACTION' ? r_gen_planes_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_nbtor_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_xyhbond_nbd_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_vdw_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_hbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_symmetry_metal_ion_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_mcangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scbond_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_it ? ? ? ? 'X-RAY DIFFRACTION' ? r_scangle_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_refined ? ? ? ? 'X-RAY DIFFRACTION' ? r_long_range_B_other ? ? ? ? 'X-RAY DIFFRACTION' ? r_rigid_bond_restr ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_free ? ? ? ? 'X-RAY DIFFRACTION' ? r_sphericity_bonded ? ? ? ? 'X-RAY DIFFRACTION' ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.d_res_high 1.50 _refine_ls_shell.d_res_low 1.54 _refine_ls_shell.number_reflns_R_work 1100 _refine_ls_shell.R_factor_R_work 0.2810 _refine_ls_shell.percent_reflns_obs 94.45 _refine_ls_shell.R_factor_R_free 0.3250 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.number_reflns_R_free 74 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.number_reflns_obs ? # _pdbx_refine.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine.entry_id 4PPT _pdbx_refine.R_factor_all_no_cutoff ? _pdbx_refine.R_factor_obs_no_cutoff ? _pdbx_refine.free_R_factor_no_cutoff ? _pdbx_refine.free_R_error_no_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_no_cutoff ? _pdbx_refine.free_R_val_test_set_ct_no_cutoff ? _pdbx_refine.R_factor_all_4sig_cutoff ? _pdbx_refine.R_factor_obs_4sig_cutoff ? _pdbx_refine.free_R_factor_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_size_perc_4sig_cutoff ? _pdbx_refine.free_R_val_test_set_ct_4sig_cutoff ? _pdbx_refine.number_reflns_obs_4sig_cutoff ? # _struct.entry_id 4PPT _struct.title 'Engineered Dual Specific VHH Antibody in Complex with a Nickel (II) Ion' _struct.pdbx_descriptor 'Engineered single domain VHH antibody' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4PPT _struct_keywords.pdbx_keywords 'IMMUNE SYSTEM' _struct_keywords.text ;Single domain antibody, VHH, Metalloregulation, Bispecific, Dual-Function, Protein Engineering, Affinity Control, Protein-Switch, Antibody Engineering, Nickel Binding Protein, Protein-Metal Coordination Geometry, Loop Dynamics, Protein Flexibility, Antibody-metal Complex, IMMUNE SYSTEM ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASP A 62 ? LYS A 65 ? ASP A 62 LYS A 65 5 ? 4 HELX_P HELX_P2 2 LYS A 87 ? THR A 91 ? LYS A 87 THR A 91 5 ? 5 HELX_P HELX_P3 3 ARG A 104 ? TYR A 108 ? ARG A 104 TYR A 108 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 96 SG A ? A CYS 22 A CYS 96 1_555 ? ? ? ? ? ? ? 2.107 ? disulf2 disulf ? ? A CYS 22 SG ? ? ? 1_555 A CYS 96 SG B ? A CYS 22 A CYS 96 1_555 ? ? ? ? ? ? ? 2.215 ? metalc1 metalc ? ? A GLN 1 OE1 ? ? ? 1_555 B NI . NI ? ? A GLN 1 A NI 201 1_555 ? ? ? ? ? ? ? 1.964 ? metalc2 metalc ? ? A HIS 29 NE2 ? ? ? 1_555 B NI . NI ? ? A HIS 29 A NI 201 1_555 ? ? ? ? ? ? ? 2.015 ? metalc3 metalc ? ? A HIS 110 NE2 ? ? ? 1_555 B NI . NI ? ? A HIS 110 A NI 201 1_555 ? ? ? ? ? ? ? 2.112 ? metalc4 metalc ? ? B NI . NI ? ? ? 1_555 D HOH . O ? ? A NI 201 A HOH 358 1_555 ? ? ? ? ? ? ? 2.165 ? metalc5 metalc ? ? B NI . NI ? ? ? 1_555 D HOH . O ? ? A NI 201 A HOH 348 1_555 ? ? ? ? ? ? ? 2.189 ? # loop_ _struct_conn_type.id _struct_conn_type.criteria _struct_conn_type.reference disulf ? ? metalc ? ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id HIS _struct_mon_prot_cis.label_seq_id 29 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id HIS _struct_mon_prot_cis.auth_seq_id 29 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 30 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 30 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle -3.20 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 4 ? B ? 6 ? C ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? anti-parallel A 2 3 ? anti-parallel A 3 4 ? anti-parallel B 1 2 ? parallel B 2 3 ? anti-parallel B 3 4 ? anti-parallel B 4 5 ? anti-parallel B 5 6 ? anti-parallel C 1 2 ? parallel C 2 3 ? anti-parallel C 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LEU A 4 ? SER A 7 ? LEU A 4 SER A 7 A 2 LEU A 18 ? ALA A 24 ? LEU A 18 ALA A 24 A 3 THR A 78 ? MET A 83 ? THR A 78 MET A 83 A 4 PHE A 68 ? ASP A 73 ? PHE A 68 ASP A 73 B 1 GLY A 10 ? VAL A 12 ? GLY A 10 VAL A 12 B 2 THR A 115 ? VAL A 119 ? THR A 115 VAL A 119 B 3 ALA A 92 ? GLY A 100 ? ALA A 92 GLY A 100 B 4 HIS A 33 ? GLN A 39 ? HIS A 33 GLN A 39 B 5 GLU A 46 ? ASP A 52 ? GLU A 46 ASP A 52 B 6 THR A 58 ? TYR A 60 ? THR A 58 TYR A 60 C 1 GLY A 10 ? VAL A 12 ? GLY A 10 VAL A 12 C 2 THR A 115 ? VAL A 119 ? THR A 115 VAL A 119 C 3 ALA A 92 ? GLY A 100 ? ALA A 92 GLY A 100 C 4 HIS A 110 ? TRP A 111 ? HIS A 110 TRP A 111 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N SER A 7 ? N SER A 7 O SER A 21 ? O SER A 21 A 2 3 N LEU A 18 ? N LEU A 18 O MET A 83 ? O MET A 83 A 3 4 O GLN A 82 ? O GLN A 82 N THR A 69 ? N THR A 69 B 1 2 N GLY A 10 ? N GLY A 10 O THR A 118 ? O THR A 118 B 2 3 O THR A 115 ? O THR A 115 N TYR A 94 ? N TYR A 94 B 3 4 O TYR A 95 ? O TYR A 95 N PHE A 37 ? N PHE A 37 B 4 5 N TRP A 36 ? N TRP A 36 O ALA A 49 ? O ALA A 49 B 5 6 N ALA A 50 ? N ALA A 50 O LEU A 59 ? O LEU A 59 C 1 2 N GLY A 10 ? N GLY A 10 O THR A 118 ? O THR A 118 C 2 3 O THR A 115 ? O THR A 115 N TYR A 94 ? N TYR A 94 C 3 4 N ALA A 98 ? N ALA A 98 O HIS A 110 ? O HIS A 110 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE NI A 201' AC2 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE SO4 A 202' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 GLN A 1 ? GLN A 1 . ? 1_555 ? 2 AC1 5 HIS A 29 ? HIS A 29 . ? 1_555 ? 3 AC1 5 HIS A 110 ? HIS A 110 . ? 1_555 ? 4 AC1 5 HOH D . ? HOH A 348 . ? 1_555 ? 5 AC1 5 HOH D . ? HOH A 358 . ? 1_555 ? 6 AC2 5 GLY A 10 ? GLY A 10 . ? 6_545 ? 7 AC2 5 LEU A 11 ? LEU A 11 . ? 6_545 ? 8 AC2 5 ARG A 104 ? ARG A 104 . ? 1_555 ? 9 AC2 5 ARG A 106 ? ARG A 106 . ? 3_655 ? 10 AC2 5 HOH D . ? HOH A 330 . ? 6_545 ? # _database_PDB_matrix.entry_id 4PPT _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4PPT _atom_sites.fract_transf_matrix[1][1] 0.018579 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.016148 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015079 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N NI O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLN 1 1 1 GLN GLN A . n A 1 2 VAL 2 2 2 VAL VAL A . n A 1 3 GLN 3 3 3 GLN GLN A . n A 1 4 LEU 4 4 4 LEU LEU A . n A 1 5 VAL 5 5 5 VAL VAL A . n A 1 6 GLU 6 6 6 GLU GLU A . n A 1 7 SER 7 7 7 SER SER A . n A 1 8 GLY 8 8 8 GLY GLY A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 GLY 10 10 10 GLY GLY A . n A 1 11 LEU 11 11 11 LEU LEU A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 GLN 13 13 13 GLN GLN A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLY 15 15 15 GLY GLY A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 SER 17 17 17 SER SER A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 LEU 20 20 20 LEU LEU A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 CYS 22 22 22 CYS CYS A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ALA 24 24 24 ALA ALA A . n A 1 25 SER 25 25 25 SER SER A . n A 1 26 GLY 26 26 26 GLY GLY A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 PRO 28 28 28 PRO PRO A . n A 1 29 HIS 29 29 29 HIS HIS A . n A 1 30 PRO 30 30 30 PRO PRO A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 HIS 33 33 33 HIS HIS A . n A 1 34 MET 34 34 34 MET MET A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 TRP 36 36 36 TRP TRP A . n A 1 37 PHE 37 37 37 PHE PHE A . n A 1 38 ARG 38 38 38 ARG ARG A . n A 1 39 GLN 39 39 39 GLN GLN A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 PRO 41 41 41 PRO PRO A . n A 1 42 GLY 42 42 42 GLY GLY A . n A 1 43 LYS 43 43 43 LYS LYS A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 GLU 46 46 46 GLU GLU A . n A 1 47 GLY 47 47 47 GLY GLY A . n A 1 48 VAL 48 48 48 VAL VAL A . n A 1 49 ALA 49 49 49 ALA ALA A . n A 1 50 ALA 50 50 50 ALA ALA A . n A 1 51 MET 51 51 51 MET MET A . n A 1 52 ASP 52 52 52 ASP ASP A . n A 1 53 SER 53 53 53 SER GLY A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 GLY 55 55 55 GLY GLY A . n A 1 56 GLY 56 56 56 GLY GLY A . n A 1 57 GLY 57 57 57 GLY GLY A . n A 1 58 THR 58 58 58 THR THR A . n A 1 59 LEU 59 59 59 LEU LEU A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 ALA 61 61 61 ALA ALA A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 LYS 65 65 65 LYS LYS A . n A 1 66 GLY 66 66 66 GLY GLY A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 PHE 68 68 68 PHE PHE A . n A 1 69 THR 69 69 69 THR THR A . n A 1 70 ILE 70 70 70 ILE ILE A . n A 1 71 SER 71 71 71 SER SER A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ASP 73 73 73 ASP ASP A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 GLY 75 75 75 GLY GLY A . n A 1 76 LYS 76 76 76 LYS LYS A . n A 1 77 ASN 77 77 77 ASN ASN A . n A 1 78 THR 78 78 78 THR THR A . n A 1 79 VAL 79 79 79 VAL VAL A . n A 1 80 TYR 80 80 80 TYR TYR A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 GLN 82 82 82 GLN GLN A . n A 1 83 MET 83 83 83 MET MET A . n A 1 84 ASP 84 84 84 ASP ASP A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 LEU 86 86 86 LEU LEU A . n A 1 87 LYS 87 87 87 LYS LYS A . n A 1 88 PRO 88 88 88 PRO PRO A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ASP 90 90 90 ASP ASP A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 THR 93 93 93 THR THR A . n A 1 94 TYR 94 94 94 TYR TYR A . n A 1 95 TYR 95 95 95 TYR TYR A . n A 1 96 CYS 96 96 96 CYS CYS A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 GLY 99 99 99 GLY GLY A . n A 1 100 GLY 100 100 100 GLY GLY A . n A 1 101 TYR 101 101 101 TYR TYR A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 LEU 103 103 103 LEU LEU A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 ASP 105 105 105 ASP ASP A . n A 1 106 ARG 106 106 106 ARG ARG A . n A 1 107 THR 107 107 107 THR THR A . n A 1 108 TYR 108 108 108 TYR TYR A . n A 1 109 GLY 109 109 109 GLY GLY A . n A 1 110 HIS 110 110 110 HIS HIS A . n A 1 111 TRP 111 111 111 TRP TRP A . n A 1 112 GLY 112 112 112 GLY GLY A . n A 1 113 GLN 113 113 113 GLN GLN A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 THR 115 115 115 THR THR A . n A 1 116 GLN 116 116 116 GLN GLN A . n A 1 117 VAL 117 117 117 VAL VAL A . n A 1 118 THR 118 118 118 THR THR A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 SER 121 121 121 SER SER A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OE1 ? A GLN 1 ? A GLN 1 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 29 ? A HIS 29 ? 1_555 100.6 ? 2 OE1 ? A GLN 1 ? A GLN 1 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 110 ? A HIS 110 ? 1_555 115.1 ? 3 NE2 ? A HIS 29 ? A HIS 29 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 NE2 ? A HIS 110 ? A HIS 110 ? 1_555 87.1 ? 4 OE1 ? A GLN 1 ? A GLN 1 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 O ? D HOH . ? A HOH 358 ? 1_555 58.4 ? 5 NE2 ? A HIS 29 ? A HIS 29 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 O ? D HOH . ? A HOH 358 ? 1_555 101.8 ? 6 NE2 ? A HIS 110 ? A HIS 110 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 O ? D HOH . ? A HOH 358 ? 1_555 169.6 ? 7 OE1 ? A GLN 1 ? A GLN 1 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 O ? D HOH . ? A HOH 348 ? 1_555 150.6 ? 8 NE2 ? A HIS 29 ? A HIS 29 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 O ? D HOH . ? A HOH 348 ? 1_555 88.4 ? 9 NE2 ? A HIS 110 ? A HIS 110 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 O ? D HOH . ? A HOH 348 ? 1_555 93.0 ? 10 O ? D HOH . ? A HOH 358 ? 1_555 NI ? B NI . ? A NI 201 ? 1_555 O ? D HOH . ? A HOH 348 ? 1_555 92.5 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-09-03 2 'Structure model' 1 1 2014-10-01 3 'Structure model' 1 2 2014-10-22 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Database references' # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 PHASER phasing . ? 2 REFMAC refinement 5.6.0117 ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLN _pdbx_validate_close_contact.auth_seq_id_1 1 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 358 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 2.02 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ALA A 92 ? ? 179.20 173.27 2 1 GLU A 102 ? ? 55.71 -133.68 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'NICKEL (II) ION' NI 3 'SULFATE ION' SO4 4 water HOH # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 NI 1 201 1000 NI NI A . C 3 SO4 1 202 300 SO4 SO4 A . D 4 HOH 1 301 200 HOH HOH A . D 4 HOH 2 302 201 HOH HOH A . D 4 HOH 3 303 202 HOH HOH A . D 4 HOH 4 304 203 HOH HOH A . D 4 HOH 5 305 204 HOH HOH A . D 4 HOH 6 306 205 HOH HOH A . D 4 HOH 7 307 206 HOH HOH A . D 4 HOH 8 308 207 HOH HOH A . D 4 HOH 9 309 208 HOH HOH A . D 4 HOH 10 310 209 HOH HOH A . D 4 HOH 11 311 210 HOH HOH A . D 4 HOH 12 312 211 HOH HOH A . D 4 HOH 13 313 212 HOH HOH A . D 4 HOH 14 314 214 HOH HOH A . D 4 HOH 15 315 216 HOH HOH A . D 4 HOH 16 316 217 HOH HOH A . D 4 HOH 17 317 218 HOH HOH A . D 4 HOH 18 318 219 HOH HOH A . D 4 HOH 19 319 220 HOH HOH A . D 4 HOH 20 320 222 HOH HOH A . D 4 HOH 21 321 223 HOH HOH A . D 4 HOH 22 322 224 HOH HOH A . D 4 HOH 23 323 226 HOH HOH A . D 4 HOH 24 324 228 HOH HOH A . D 4 HOH 25 325 229 HOH HOH A . D 4 HOH 26 326 230 HOH HOH A . D 4 HOH 27 327 231 HOH HOH A . D 4 HOH 28 328 232 HOH HOH A . D 4 HOH 29 329 233 HOH HOH A . D 4 HOH 30 330 236 HOH HOH A . D 4 HOH 31 331 237 HOH HOH A . D 4 HOH 32 332 238 HOH HOH A . D 4 HOH 33 333 239 HOH HOH A . D 4 HOH 34 334 240 HOH HOH A . D 4 HOH 35 335 241 HOH HOH A . D 4 HOH 36 336 242 HOH HOH A . D 4 HOH 37 337 244 HOH HOH A . D 4 HOH 38 338 245 HOH HOH A . D 4 HOH 39 339 246 HOH HOH A . D 4 HOH 40 340 248 HOH HOH A . D 4 HOH 41 341 250 HOH HOH A . D 4 HOH 42 342 251 HOH HOH A . D 4 HOH 43 343 252 HOH HOH A . D 4 HOH 44 344 257 HOH HOH A . D 4 HOH 45 345 259 HOH HOH A . D 4 HOH 46 346 260 HOH HOH A . D 4 HOH 47 347 262 HOH HOH A . D 4 HOH 48 348 265 HOH HOH A . D 4 HOH 49 349 266 HOH HOH A . D 4 HOH 50 350 267 HOH HOH A . D 4 HOH 51 351 268 HOH HOH A . D 4 HOH 52 352 269 HOH HOH A . D 4 HOH 53 353 270 HOH HOH A . D 4 HOH 54 354 271 HOH HOH A . D 4 HOH 55 355 272 HOH HOH A . D 4 HOH 56 356 274 HOH HOH A . D 4 HOH 57 357 276 HOH HOH A . D 4 HOH 58 358 277 HOH HOH A . D 4 HOH 59 359 279 HOH HOH A . D 4 HOH 60 360 280 HOH HOH A . D 4 HOH 61 361 281 HOH HOH A . D 4 HOH 62 362 283 HOH HOH A . D 4 HOH 63 363 284 HOH HOH A . D 4 HOH 64 364 285 HOH HOH A . D 4 HOH 65 365 286 HOH HOH A . D 4 HOH 66 366 287 HOH HOH A . D 4 HOH 67 367 288 HOH HOH A . D 4 HOH 68 368 289 HOH HOH A . D 4 HOH 69 369 290 HOH HOH A . D 4 HOH 70 370 291 HOH HOH A . D 4 HOH 71 371 292 HOH HOH A . D 4 HOH 72 372 293 HOH HOH A . D 4 HOH 73 373 295 HOH HOH A . D 4 HOH 74 374 296 HOH HOH A . D 4 HOH 75 375 297 HOH HOH A . D 4 HOH 76 376 298 HOH HOH A . D 4 HOH 77 377 299 HOH HOH A . D 4 HOH 78 378 300 HOH HOH A . D 4 HOH 79 379 303 HOH HOH A . D 4 HOH 80 380 304 HOH HOH A . D 4 HOH 81 381 305 HOH HOH A . D 4 HOH 82 382 307 HOH HOH A . D 4 HOH 83 383 309 HOH HOH A . D 4 HOH 84 384 310 HOH HOH A . D 4 HOH 85 385 312 HOH HOH A . D 4 HOH 86 386 314 HOH HOH A . D 4 HOH 87 387 316 HOH HOH A . D 4 HOH 88 388 317 HOH HOH A . D 4 HOH 89 389 318 HOH HOH A . D 4 HOH 90 390 320 HOH HOH A . D 4 HOH 91 391 321 HOH HOH A . #