data_4Q23 # _entry.id 4Q23 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4Q23 pdb_00004q23 10.2210/pdb4q23/pdb RCSB RCSB085506 ? ? WWPDB D_1000085506 ? ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.db_id _pdbx_database_related.details _pdbx_database_related.content_type PDB 4KFA . unspecified PDB 4KPD . unspecified PDB 4KPJ . unspecified PDB 4KQS . unspecified PDB 4KQU . unspecified PDB 4KQ5 . unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4Q23 _pdbx_database_status.recvd_initial_deposition_date 2014-04-05 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tsoumpra, M.K.' 1 'Muniz, J.R.C.' 2 'Barnett, B.L.' 3 'Kwaasi, A.A.' 4 'Pilka, E.S.' 5 'Kavanagh, K.L.' 6 'Evdokimov, A.' 7 'Walter, R.L.' 8 'Ebetino, F.H.' 9 'von Delft, F.' 10 'Oppermann, U.' 11 'Russell, R.G.G.' 12 'Dunford, J.E.' 13 # _citation.id primary _citation.title ;The role of threonine 201 and tyrosine 204 in the human farnesyl pyrophosphate synthase catalytic mechanism and the mode of inhibition by the nitrogen-containing bisphosphonates ; _citation.journal_abbrev 'To be Published' _citation.journal_volume ? _citation.page_first ? _citation.page_last ? _citation.year ? _citation.journal_id_ASTM ? _citation.country ? _citation.journal_id_ISSN ? _citation.journal_id_CSD 0353 _citation.book_publisher ? _citation.pdbx_database_id_PubMed ? _citation.pdbx_database_id_DOI ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tsoumpra, M.K.' 1 ? primary 'Muniz, J.R.C.' 2 ? primary 'Barnett, B.L.' 3 ? primary 'Kwaasi, A.A.' 4 ? primary 'Pilka, E.S.' 5 ? primary 'Kavanagh, K.L.' 6 ? primary 'Evdokimov, A.' 7 ? primary 'Walter, R.L.' 8 ? primary 'Ebetino, F.H.' 9 ? primary 'von Delft, F.' 10 ? primary 'Oppermann, U.' 11 ? primary 'Russell, R.G.G.' 12 ? primary 'Dunford, J.E.' 13 ? # _cell.entry_id 4Q23 _cell.length_a 111.360 _cell.length_b 111.360 _cell.length_c 67.600 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4Q23 _symmetry.space_group_name_H-M 'P 41 21 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 92 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Farnesyl pyrophosphate synthase' 43114.957 1 '2.5.1.10, 2.5.1.1' T201A 'UNP residues 67-419' ? 2 non-polymer syn '1-HYDROXY-2-(3-PYRIDINYL)ETHYLIDENE BIS-PHOSPHONIC ACID' 283.112 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 3 ? ? ? ? 4 non-polymer syn 'SULFATE ION' 96.063 1 ? ? ? ? 5 water nat water 18.015 121 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name ;FPP synthase, FPS, (2E,6E)-farnesyl diphosphate synthase, Dimethylallyltranstransferase, Farnesyl diphosphate synthase, Geranyltranstransferase ; # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSSGRENLYFQGHMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKY NRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEAC IYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKAAFYSFYLPIAAAMYMAG IDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKV ARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSSGRENLYFQGHMNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKY NRGLTVVVAFRELVEPRKQDADSLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEAC IYRLLKLYCREQPYYLNLIELFLQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKAAFYSFYLPIAAAMYMAG IDGEKEHANAKKILLEMGEFFQIQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKV ARVKALYEELDLPAVFLQYEEDSYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 SER n 1 13 GLY n 1 14 ARG n 1 15 GLU n 1 16 ASN n 1 17 LEU n 1 18 TYR n 1 19 PHE n 1 20 GLN n 1 21 GLY n 1 22 HIS n 1 23 MET n 1 24 ASN n 1 25 GLY n 1 26 ASP n 1 27 GLN n 1 28 ASN n 1 29 SER n 1 30 ASP n 1 31 VAL n 1 32 TYR n 1 33 ALA n 1 34 GLN n 1 35 GLU n 1 36 LYS n 1 37 GLN n 1 38 ASP n 1 39 PHE n 1 40 VAL n 1 41 GLN n 1 42 HIS n 1 43 PHE n 1 44 SER n 1 45 GLN n 1 46 ILE n 1 47 VAL n 1 48 ARG n 1 49 VAL n 1 50 LEU n 1 51 THR n 1 52 GLU n 1 53 ASP n 1 54 GLU n 1 55 MET n 1 56 GLY n 1 57 HIS n 1 58 PRO n 1 59 GLU n 1 60 ILE n 1 61 GLY n 1 62 ASP n 1 63 ALA n 1 64 ILE n 1 65 ALA n 1 66 ARG n 1 67 LEU n 1 68 LYS n 1 69 GLU n 1 70 VAL n 1 71 LEU n 1 72 GLU n 1 73 TYR n 1 74 ASN n 1 75 ALA n 1 76 ILE n 1 77 GLY n 1 78 GLY n 1 79 LYS n 1 80 TYR n 1 81 ASN n 1 82 ARG n 1 83 GLY n 1 84 LEU n 1 85 THR n 1 86 VAL n 1 87 VAL n 1 88 VAL n 1 89 ALA n 1 90 PHE n 1 91 ARG n 1 92 GLU n 1 93 LEU n 1 94 VAL n 1 95 GLU n 1 96 PRO n 1 97 ARG n 1 98 LYS n 1 99 GLN n 1 100 ASP n 1 101 ALA n 1 102 ASP n 1 103 SER n 1 104 LEU n 1 105 GLN n 1 106 ARG n 1 107 ALA n 1 108 TRP n 1 109 THR n 1 110 VAL n 1 111 GLY n 1 112 TRP n 1 113 CYS n 1 114 VAL n 1 115 GLU n 1 116 LEU n 1 117 LEU n 1 118 GLN n 1 119 ALA n 1 120 PHE n 1 121 PHE n 1 122 LEU n 1 123 VAL n 1 124 ALA n 1 125 ASP n 1 126 ASP n 1 127 ILE n 1 128 MET n 1 129 ASP n 1 130 SER n 1 131 SER n 1 132 LEU n 1 133 THR n 1 134 ARG n 1 135 ARG n 1 136 GLY n 1 137 GLN n 1 138 ILE n 1 139 CYS n 1 140 TRP n 1 141 TYR n 1 142 GLN n 1 143 LYS n 1 144 PRO n 1 145 GLY n 1 146 VAL n 1 147 GLY n 1 148 LEU n 1 149 ASP n 1 150 ALA n 1 151 ILE n 1 152 ASN n 1 153 ASP n 1 154 ALA n 1 155 ASN n 1 156 LEU n 1 157 LEU n 1 158 GLU n 1 159 ALA n 1 160 CYS n 1 161 ILE n 1 162 TYR n 1 163 ARG n 1 164 LEU n 1 165 LEU n 1 166 LYS n 1 167 LEU n 1 168 TYR n 1 169 CYS n 1 170 ARG n 1 171 GLU n 1 172 GLN n 1 173 PRO n 1 174 TYR n 1 175 TYR n 1 176 LEU n 1 177 ASN n 1 178 LEU n 1 179 ILE n 1 180 GLU n 1 181 LEU n 1 182 PHE n 1 183 LEU n 1 184 GLN n 1 185 SER n 1 186 SER n 1 187 TYR n 1 188 GLN n 1 189 THR n 1 190 GLU n 1 191 ILE n 1 192 GLY n 1 193 GLN n 1 194 THR n 1 195 LEU n 1 196 ASP n 1 197 LEU n 1 198 LEU n 1 199 THR n 1 200 ALA n 1 201 PRO n 1 202 GLN n 1 203 GLY n 1 204 ASN n 1 205 VAL n 1 206 ASP n 1 207 LEU n 1 208 VAL n 1 209 ARG n 1 210 PHE n 1 211 THR n 1 212 GLU n 1 213 LYS n 1 214 ARG n 1 215 TYR n 1 216 LYS n 1 217 SER n 1 218 ILE n 1 219 VAL n 1 220 LYS n 1 221 TYR n 1 222 LYS n 1 223 ALA n 1 224 ALA n 1 225 PHE n 1 226 TYR n 1 227 SER n 1 228 PHE n 1 229 TYR n 1 230 LEU n 1 231 PRO n 1 232 ILE n 1 233 ALA n 1 234 ALA n 1 235 ALA n 1 236 MET n 1 237 TYR n 1 238 MET n 1 239 ALA n 1 240 GLY n 1 241 ILE n 1 242 ASP n 1 243 GLY n 1 244 GLU n 1 245 LYS n 1 246 GLU n 1 247 HIS n 1 248 ALA n 1 249 ASN n 1 250 ALA n 1 251 LYS n 1 252 LYS n 1 253 ILE n 1 254 LEU n 1 255 LEU n 1 256 GLU n 1 257 MET n 1 258 GLY n 1 259 GLU n 1 260 PHE n 1 261 PHE n 1 262 GLN n 1 263 ILE n 1 264 GLN n 1 265 ASP n 1 266 ASP n 1 267 TYR n 1 268 LEU n 1 269 ASP n 1 270 LEU n 1 271 PHE n 1 272 GLY n 1 273 ASP n 1 274 PRO n 1 275 SER n 1 276 VAL n 1 277 THR n 1 278 GLY n 1 279 LYS n 1 280 ILE n 1 281 GLY n 1 282 THR n 1 283 ASP n 1 284 ILE n 1 285 GLN n 1 286 ASP n 1 287 ASN n 1 288 LYS n 1 289 CYS n 1 290 SER n 1 291 TRP n 1 292 LEU n 1 293 VAL n 1 294 VAL n 1 295 GLN n 1 296 CYS n 1 297 LEU n 1 298 GLN n 1 299 ARG n 1 300 ALA n 1 301 THR n 1 302 PRO n 1 303 GLU n 1 304 GLN n 1 305 TYR n 1 306 GLN n 1 307 ILE n 1 308 LEU n 1 309 LYS n 1 310 GLU n 1 311 ASN n 1 312 TYR n 1 313 GLY n 1 314 GLN n 1 315 LYS n 1 316 GLU n 1 317 ALA n 1 318 GLU n 1 319 LYS n 1 320 VAL n 1 321 ALA n 1 322 ARG n 1 323 VAL n 1 324 LYS n 1 325 ALA n 1 326 LEU n 1 327 TYR n 1 328 GLU n 1 329 GLU n 1 330 LEU n 1 331 ASP n 1 332 LEU n 1 333 PRO n 1 334 ALA n 1 335 VAL n 1 336 PHE n 1 337 LEU n 1 338 GLN n 1 339 TYR n 1 340 GLU n 1 341 GLU n 1 342 ASP n 1 343 SER n 1 344 TYR n 1 345 SER n 1 346 HIS n 1 347 ILE n 1 348 MET n 1 349 ALA n 1 350 LEU n 1 351 ILE n 1 352 GLU n 1 353 GLN n 1 354 TYR n 1 355 ALA n 1 356 ALA n 1 357 PRO n 1 358 LEU n 1 359 PRO n 1 360 PRO n 1 361 ALA n 1 362 VAL n 1 363 PHE n 1 364 LEU n 1 365 GLY n 1 366 LEU n 1 367 ALA n 1 368 ARG n 1 369 LYS n 1 370 ILE n 1 371 TYR n 1 372 LYS n 1 373 ARG n 1 374 ARG n 1 375 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'FDPS, FPS, KIAA1293' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type Plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name 'PET 11 Derivative' _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code FPPS_HUMAN _struct_ref.pdbx_db_accession P14324 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MNGDQNSDVYAQEKQDFVQHFSQIVRVLTEDEMGHPEIGDAIARLKEVLEYNAIGGKYNRGLTVVVAFRELVEPRKQDAD SLQRAWTVGWCVELLQAFFLVADDIMDSSLTRRGQICWYQKPGVGLDAINDANLLEACIYRLLKLYCREQPYYLNLIELF LQSSYQTEIGQTLDLLTAPQGNVDLVRFTEKRYKSIVKYKTAFYSFYLPIAAAMYMAGIDGEKEHANAKKILLEMGEFFQ IQDDYLDLFGDPSVTGKIGTDIQDNKCSWLVVQCLQRATPEQYQILKENYGQKEAEKVARVKALYEELDLPAVFLQYEED SYSHIMALIEQYAAPLPPAVFLGLARKIYKRRK ; _struct_ref.pdbx_align_begin 67 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4Q23 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 23 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 375 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P14324 _struct_ref_seq.db_align_beg 67 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 419 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 353 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4Q23 MET A 1 ? UNP P14324 ? ? 'expression tag' -21 1 1 4Q23 GLY A 2 ? UNP P14324 ? ? 'expression tag' -20 2 1 4Q23 SER A 3 ? UNP P14324 ? ? 'expression tag' -19 3 1 4Q23 SER A 4 ? UNP P14324 ? ? 'expression tag' -18 4 1 4Q23 HIS A 5 ? UNP P14324 ? ? 'expression tag' -17 5 1 4Q23 HIS A 6 ? UNP P14324 ? ? 'expression tag' -16 6 1 4Q23 HIS A 7 ? UNP P14324 ? ? 'expression tag' -15 7 1 4Q23 HIS A 8 ? UNP P14324 ? ? 'expression tag' -14 8 1 4Q23 HIS A 9 ? UNP P14324 ? ? 'expression tag' -13 9 1 4Q23 HIS A 10 ? UNP P14324 ? ? 'expression tag' -12 10 1 4Q23 SER A 11 ? UNP P14324 ? ? 'expression tag' -11 11 1 4Q23 SER A 12 ? UNP P14324 ? ? 'expression tag' -10 12 1 4Q23 GLY A 13 ? UNP P14324 ? ? 'expression tag' -9 13 1 4Q23 ARG A 14 ? UNP P14324 ? ? 'expression tag' -8 14 1 4Q23 GLU A 15 ? UNP P14324 ? ? 'expression tag' -7 15 1 4Q23 ASN A 16 ? UNP P14324 ? ? 'expression tag' -6 16 1 4Q23 LEU A 17 ? UNP P14324 ? ? 'expression tag' -5 17 1 4Q23 TYR A 18 ? UNP P14324 ? ? 'expression tag' -4 18 1 4Q23 PHE A 19 ? UNP P14324 ? ? 'expression tag' -3 19 1 4Q23 GLN A 20 ? UNP P14324 ? ? 'expression tag' -2 20 1 4Q23 GLY A 21 ? UNP P14324 ? ? 'expression tag' -1 21 1 4Q23 HIS A 22 ? UNP P14324 ? ? 'expression tag' 0 22 1 4Q23 ALA A 223 ? UNP P14324 THR 267 'engineered mutation' 201 23 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 RIS non-polymer . '1-HYDROXY-2-(3-PYRIDINYL)ETHYLIDENE BIS-PHOSPHONIC ACID' Risedronate 'C7 H11 N O7 P2' 283.112 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.entry_id 4Q23 _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 2.43 _exptl_crystal.density_percent_sol 49.39 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pdbx_details '0.2M NH4Cl, 20% PEG 6000, 10% Glycol, pH 7.5, VAPOR DIFFUSION, SITTING DROP, temperature 293K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.pdbx_collection_date 2009-05-15 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator Graphite _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9796 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'DIAMOND BEAMLINE I02' _diffrn_source.pdbx_synchrotron_site Diamond _diffrn_source.pdbx_synchrotron_beamline I02 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 0.9796 # _reflns.entry_id 4Q23 _reflns.observed_criterion_sigma_I 2.0 _reflns.observed_criterion_sigma_F 2.05 _reflns.d_resolution_low 25.02 _reflns.d_resolution_high 1.98 _reflns.number_obs 29838 _reflns.number_all 30003 _reflns.percent_possible_obs 99.3 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate 39.05 _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _reflns_shell.d_res_high 1.98 _reflns_shell.d_res_low 2.05 _reflns_shell.percent_possible_all 99.3 _reflns_shell.Rmerge_I_obs ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.pdbx_redundancy ? _reflns_shell.percent_possible_obs ? _reflns_shell.number_unique_all ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 # _refine.entry_id 4Q23 _refine.ls_number_reflns_obs 29838 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 25.02 _refine.ls_d_res_high 1.98 _refine.ls_percent_reflns_obs ? _refine.ls_R_factor_obs 0.1931 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1915 _refine.ls_R_factor_R_free 0.2229 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 5.07 _refine.ls_number_reflns_R_free 1512 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc 0.9507 _refine.correlation_coeff_Fo_to_Fc_free 0.9291 _refine.B_iso_mean 51.76 _refine.aniso_B[1][1] 5.4345 _refine.aniso_B[2][2] 5.4345 _refine.aniso_B[3][3] -10.8690 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] 0.0000 _refine.solvent_model_details ? _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.details ? _refine.pdbx_starting_model 3CP6 _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values 'Engh & Huber' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML ? _refine.pdbx_overall_phase_error ? _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_analyze.entry_id 4Q23 _refine_analyze.Luzzati_coordinate_error_obs 0.288 _refine_analyze.Luzzati_sigma_a_obs ? _refine_analyze.Luzzati_d_res_low_obs ? _refine_analyze.Luzzati_coordinate_error_free ? _refine_analyze.Luzzati_sigma_a_free ? _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2642 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 25 _refine_hist.number_atoms_solvent 121 _refine_hist.number_atoms_total 2788 _refine_hist.d_res_high 1.98 _refine_hist.d_res_low 25.02 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id t_bond_d 0.010 ? 2.00 2760 HARMONIC 'X-RAY DIFFRACTION' t_angle_deg 0.93 ? 2.00 3758 HARMONIC 'X-RAY DIFFRACTION' t_dihedral_angle_d ? ? 2.00 1257 SINUSOIDAL 'X-RAY DIFFRACTION' t_trig_c_planes ? ? 2.00 68 HARMONIC 'X-RAY DIFFRACTION' t_gen_planes ? ? 5.00 401 HARMONIC 'X-RAY DIFFRACTION' t_it ? ? 20.00 2760 HARMONIC 'X-RAY DIFFRACTION' t_nbd ? ? 5.00 2 SEMIHARMONIC 'X-RAY DIFFRACTION' t_omega_torsion 2.78 ? ? ? ? 'X-RAY DIFFRACTION' t_other_torsion 2.89 ? ? ? ? 'X-RAY DIFFRACTION' t_chiral_improper_torsion ? ? 5.00 357 SEMIHARMONIC 'X-RAY DIFFRACTION' t_ideal_dist_contact ? ? 4.00 3493 SEMIHARMONIC 'X-RAY DIFFRACTION' # _refine_ls_shell.pdbx_total_number_of_bins_used 15 _refine_ls_shell.d_res_high 1.98 _refine_ls_shell.d_res_low 2.05 _refine_ls_shell.number_reflns_R_work 2761 _refine_ls_shell.R_factor_R_work 0.2315 _refine_ls_shell.percent_reflns_obs ? _refine_ls_shell.R_factor_R_free 0.2728 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.percent_reflns_R_free 5.06 _refine_ls_shell.number_reflns_R_free 147 _refine_ls_shell.number_reflns_all 2908 _refine_ls_shell.R_factor_all 0.2336 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' # _struct.entry_id 4Q23 _struct.title ;The role of threonine 201 and tyrosine 204 in the human farnesyl pyrophosphate synthase catalytic mechanism and the mode of inhibition by the nitrogen-containing bisphosphonates ; _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4Q23 _struct_keywords.pdbx_keywords TRANSFERASE _struct_keywords.text ;ISOPRENE BIOSYNTHESIS, LIPID SYNTHESIS, STEROID BIOSYNTHESIS, TRANSFERASE, ISOPRENOID PATHWAY, CHOLESTEROL SYNTHESIS, BISPHOSPHONATES, Alpha helical prenyltransferase, Isopentyl Pyrophosphate, Dimethylallyl Pyrophospahte ; # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? F N N 4 ? G N N 5 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 TYR A 32 ? HIS A 42 ? TYR A 10 HIS A 20 1 ? 11 HELX_P HELX_P2 2 HIS A 42 ? THR A 51 ? HIS A 20 THR A 29 1 ? 10 HELX_P HELX_P3 3 HIS A 57 ? GLU A 59 ? HIS A 35 GLU A 37 5 ? 3 HELX_P HELX_P4 4 ILE A 60 ? ALA A 75 ? ILE A 38 ALA A 53 1 ? 16 HELX_P HELX_P5 5 TYR A 80 ? VAL A 94 ? TYR A 58 VAL A 72 1 ? 15 HELX_P HELX_P6 6 GLU A 95 ? GLN A 99 ? GLU A 73 GLN A 77 5 ? 5 HELX_P HELX_P7 7 ASP A 100 ? ASP A 129 ? ASP A 78 ASP A 107 1 ? 30 HELX_P HELX_P8 8 TRP A 140 ? LYS A 143 ? TRP A 118 LYS A 121 5 ? 4 HELX_P HELX_P9 9 VAL A 146 ? LEU A 148 ? VAL A 124 LEU A 126 5 ? 3 HELX_P HELX_P10 10 ASP A 149 ? ARG A 170 ? ASP A 127 ARG A 148 1 ? 22 HELX_P HELX_P11 11 TYR A 174 ? ALA A 200 ? TYR A 152 ALA A 178 1 ? 27 HELX_P HELX_P12 12 ASP A 206 ? PHE A 210 ? ASP A 184 PHE A 188 5 ? 5 HELX_P HELX_P13 13 THR A 211 ? ALA A 223 ? THR A 189 ALA A 201 1 ? 13 HELX_P HELX_P14 14 ALA A 223 ? PHE A 228 ? ALA A 201 PHE A 206 1 ? 6 HELX_P HELX_P15 15 PHE A 228 ? ALA A 239 ? PHE A 206 ALA A 217 1 ? 12 HELX_P HELX_P16 16 GLY A 243 ? GLY A 272 ? GLY A 221 GLY A 250 1 ? 30 HELX_P HELX_P17 17 ASP A 273 ? GLY A 278 ? ASP A 251 GLY A 256 1 ? 6 HELX_P HELX_P18 18 SER A 290 ? GLN A 298 ? SER A 268 GLN A 276 1 ? 9 HELX_P HELX_P19 19 THR A 301 ? TYR A 312 ? THR A 279 TYR A 290 1 ? 12 HELX_P HELX_P20 20 GLU A 316 ? LEU A 330 ? GLU A 294 LEU A 308 1 ? 15 HELX_P HELX_P21 21 ASP A 331 ? ALA A 355 ? ASP A 309 ALA A 333 1 ? 25 HELX_P HELX_P22 22 PRO A 360 ? TYR A 371 ? PRO A 338 TYR A 349 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A ASP 125 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 103 A MG 902 1_555 ? ? ? ? ? ? ? 2.031 ? ? metalc2 metalc ? ? A ASP 125 OD1 ? ? ? 1_555 E MG . MG ? ? A ASP 103 A MG 904 1_555 ? ? ? ? ? ? ? 1.949 ? ? metalc3 metalc ? ? A ASP 129 OD2 ? ? ? 1_555 C MG . MG ? ? A ASP 107 A MG 902 1_555 ? ? ? ? ? ? ? 2.263 ? ? metalc4 metalc ? ? A ASP 129 OD2 ? ? ? 1_555 E MG . MG ? ? A ASP 107 A MG 904 1_555 ? ? ? ? ? ? ? 2.033 ? ? metalc5 metalc ? ? A ASP 265 OD2 ? ? ? 1_555 D MG . MG ? ? A ASP 243 A MG 903 1_555 ? ? ? ? ? ? ? 2.113 ? ? metalc6 metalc ? ? B RIS . O15 ? ? ? 1_555 C MG . MG ? ? A RIS 901 A MG 902 1_555 ? ? ? ? ? ? ? 2.084 ? ? metalc7 metalc ? ? B RIS . O12 ? ? ? 1_555 C MG . MG ? ? A RIS 901 A MG 902 1_555 ? ? ? ? ? ? ? 2.240 ? ? metalc8 metalc ? ? B RIS . O11 ? ? ? 1_555 D MG . MG ? ? A RIS 901 A MG 903 1_555 ? ? ? ? ? ? ? 1.915 ? ? metalc9 metalc ? ? B RIS . O16 ? ? ? 1_555 D MG . MG ? ? A RIS 901 A MG 903 1_555 ? ? ? ? ? ? ? 1.969 ? ? metalc10 metalc ? ? B RIS . O15 ? ? ? 1_555 E MG . MG ? ? A RIS 901 A MG 904 1_555 ? ? ? ? ? ? ? 2.075 ? ? metalc11 metalc ? ? C MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 902 A HOH 1090 1_555 ? ? ? ? ? ? ? 2.078 ? ? metalc12 metalc ? ? C MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 902 A HOH 1092 1_555 ? ? ? ? ? ? ? 2.129 ? ? metalc13 metalc ? ? D MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 903 A HOH 1088 1_555 ? ? ? ? ? ? ? 2.129 ? ? metalc14 metalc ? ? D MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 903 A HOH 1089 1_555 ? ? ? ? ? ? ? 2.006 ? ? metalc15 metalc ? ? D MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 903 A HOH 1093 1_555 ? ? ? ? ? ? ? 2.133 ? ? metalc16 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 904 A HOH 1094 1_555 ? ? ? ? ? ? ? 2.030 ? ? metalc17 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 904 A HOH 1095 1_555 ? ? ? ? ? ? ? 2.169 ? ? metalc18 metalc ? ? E MG . MG ? ? ? 1_555 G HOH . O ? ? A MG 904 A HOH 1096 1_555 ? ? ? ? ? ? ? 2.074 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 356 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 334 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 357 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 335 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 7.81 # _struct_sheet.id A _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id A _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 THR A 133 ? ARG A 134 ? THR A 111 ARG A 112 A 2 GLN A 137 ? ILE A 138 ? GLN A 115 ILE A 116 # _pdbx_struct_sheet_hbond.sheet_id A _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ARG _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 134 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ARG _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 112 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id GLN _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 137 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id GLN _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 115 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A RIS 901 ? 19 'BINDING SITE FOR RESIDUE RIS A 901' AC2 Software A MG 902 ? 6 'BINDING SITE FOR RESIDUE MG A 902' AC3 Software A MG 903 ? 5 'BINDING SITE FOR RESIDUE MG A 903' AC4 Software A MG 904 ? 7 'BINDING SITE FOR RESIDUE MG A 904' AC5 Software A SO4 905 ? 8 'BINDING SITE FOR RESIDUE SO4 A 905' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 19 LEU A 122 ? LEU A 100 . ? 1_555 ? 2 AC1 19 ASP A 125 ? ASP A 103 . ? 1_555 ? 3 AC1 19 ASP A 129 ? ASP A 107 . ? 1_555 ? 4 AC1 19 ARG A 134 ? ARG A 112 . ? 1_555 ? 5 AC1 19 GLN A 193 ? GLN A 171 . ? 1_555 ? 6 AC1 19 LYS A 222 ? LYS A 200 . ? 1_555 ? 7 AC1 19 ASP A 265 ? ASP A 243 . ? 1_555 ? 8 AC1 19 LYS A 279 ? LYS A 257 . ? 1_555 ? 9 AC1 19 MG C . ? MG A 902 . ? 1_555 ? 10 AC1 19 MG D . ? MG A 903 . ? 1_555 ? 11 AC1 19 MG E . ? MG A 904 . ? 1_555 ? 12 AC1 19 HOH G . ? HOH A 1001 . ? 1_555 ? 13 AC1 19 HOH G . ? HOH A 1003 . ? 1_555 ? 14 AC1 19 HOH G . ? HOH A 1088 . ? 1_555 ? 15 AC1 19 HOH G . ? HOH A 1089 . ? 1_555 ? 16 AC1 19 HOH G . ? HOH A 1092 . ? 1_555 ? 17 AC1 19 HOH G . ? HOH A 1093 . ? 1_555 ? 18 AC1 19 HOH G . ? HOH A 1094 . ? 1_555 ? 19 AC1 19 HOH G . ? HOH A 1096 . ? 1_555 ? 20 AC2 6 ASP A 125 ? ASP A 103 . ? 1_555 ? 21 AC2 6 ASP A 129 ? ASP A 107 . ? 1_555 ? 22 AC2 6 RIS B . ? RIS A 901 . ? 1_555 ? 23 AC2 6 MG E . ? MG A 904 . ? 1_555 ? 24 AC2 6 HOH G . ? HOH A 1090 . ? 1_555 ? 25 AC2 6 HOH G . ? HOH A 1092 . ? 1_555 ? 26 AC3 5 ASP A 265 ? ASP A 243 . ? 1_555 ? 27 AC3 5 RIS B . ? RIS A 901 . ? 1_555 ? 28 AC3 5 HOH G . ? HOH A 1088 . ? 1_555 ? 29 AC3 5 HOH G . ? HOH A 1089 . ? 1_555 ? 30 AC3 5 HOH G . ? HOH A 1093 . ? 1_555 ? 31 AC4 7 ASP A 125 ? ASP A 103 . ? 1_555 ? 32 AC4 7 ASP A 129 ? ASP A 107 . ? 1_555 ? 33 AC4 7 RIS B . ? RIS A 901 . ? 1_555 ? 34 AC4 7 MG C . ? MG A 902 . ? 1_555 ? 35 AC4 7 HOH G . ? HOH A 1094 . ? 1_555 ? 36 AC4 7 HOH G . ? HOH A 1095 . ? 1_555 ? 37 AC4 7 HOH G . ? HOH A 1096 . ? 1_555 ? 38 AC5 8 GLY A 78 ? GLY A 56 . ? 1_555 ? 39 AC5 8 LYS A 79 ? LYS A 57 . ? 1_555 ? 40 AC5 8 GLN A 118 ? GLN A 96 . ? 1_555 ? 41 AC5 8 ARG A 135 ? ARG A 113 . ? 1_555 ? 42 AC5 8 HOH G . ? HOH A 1016 . ? 1_555 ? 43 AC5 8 HOH G . ? HOH A 1056 . ? 1_555 ? 44 AC5 8 HOH G . ? HOH A 1099 . ? 1_555 ? 45 AC5 8 HOH G . ? HOH A 1119 . ? 1_555 ? # _database_PDB_matrix.entry_id 4Q23 _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4Q23 _atom_sites.fract_transf_matrix[1][1] 0.008980 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008980 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014793 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O P S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 -21 ? ? ? A . n A 1 2 GLY 2 -20 ? ? ? A . n A 1 3 SER 3 -19 ? ? ? A . n A 1 4 SER 4 -18 ? ? ? A . n A 1 5 HIS 5 -17 ? ? ? A . n A 1 6 HIS 6 -16 ? ? ? A . n A 1 7 HIS 7 -15 ? ? ? A . n A 1 8 HIS 8 -14 ? ? ? A . n A 1 9 HIS 9 -13 ? ? ? A . n A 1 10 HIS 10 -12 ? ? ? A . n A 1 11 SER 11 -11 ? ? ? A . n A 1 12 SER 12 -10 ? ? ? A . n A 1 13 GLY 13 -9 ? ? ? A . n A 1 14 ARG 14 -8 ? ? ? A . n A 1 15 GLU 15 -7 ? ? ? A . n A 1 16 ASN 16 -6 ? ? ? A . n A 1 17 LEU 17 -5 ? ? ? A . n A 1 18 TYR 18 -4 ? ? ? A . n A 1 19 PHE 19 -3 ? ? ? A . n A 1 20 GLN 20 -2 ? ? ? A . n A 1 21 GLY 21 -1 ? ? ? A . n A 1 22 HIS 22 0 ? ? ? A . n A 1 23 MET 23 1 ? ? ? A . n A 1 24 ASN 24 2 ? ? ? A . n A 1 25 GLY 25 3 ? ? ? A . n A 1 26 ASP 26 4 ? ? ? A . n A 1 27 GLN 27 5 ? ? ? A . n A 1 28 ASN 28 6 ? ? ? A . n A 1 29 SER 29 7 ? ? ? A . n A 1 30 ASP 30 8 ? ? ? A . n A 1 31 VAL 31 9 9 VAL VAL A . n A 1 32 TYR 32 10 10 TYR TYR A . n A 1 33 ALA 33 11 11 ALA ALA A . n A 1 34 GLN 34 12 12 GLN GLN A . n A 1 35 GLU 35 13 13 GLU GLU A . n A 1 36 LYS 36 14 14 LYS LYS A . n A 1 37 GLN 37 15 15 GLN GLN A . n A 1 38 ASP 38 16 16 ASP ASP A . n A 1 39 PHE 39 17 17 PHE PHE A . n A 1 40 VAL 40 18 18 VAL VAL A . n A 1 41 GLN 41 19 19 GLN GLN A . n A 1 42 HIS 42 20 20 HIS HIS A . n A 1 43 PHE 43 21 21 PHE PHE A . n A 1 44 SER 44 22 22 SER SER A . n A 1 45 GLN 45 23 23 GLN GLN A . n A 1 46 ILE 46 24 24 ILE ILE A . n A 1 47 VAL 47 25 25 VAL VAL A . n A 1 48 ARG 48 26 26 ARG ARG A . n A 1 49 VAL 49 27 27 VAL VAL A . n A 1 50 LEU 50 28 28 LEU LEU A . n A 1 51 THR 51 29 29 THR THR A . n A 1 52 GLU 52 30 ? ? ? A . n A 1 53 ASP 53 31 ? ? ? A . n A 1 54 GLU 54 32 ? ? ? A . n A 1 55 MET 55 33 ? ? ? A . n A 1 56 GLY 56 34 34 GLY GLY A . n A 1 57 HIS 57 35 35 HIS HIS A . n A 1 58 PRO 58 36 36 PRO PRO A . n A 1 59 GLU 59 37 37 GLU GLU A . n A 1 60 ILE 60 38 38 ILE ILE A . n A 1 61 GLY 61 39 39 GLY GLY A . n A 1 62 ASP 62 40 40 ASP ASP A . n A 1 63 ALA 63 41 41 ALA ALA A . n A 1 64 ILE 64 42 42 ILE ILE A . n A 1 65 ALA 65 43 43 ALA ALA A . n A 1 66 ARG 66 44 44 ARG ARG A . n A 1 67 LEU 67 45 45 LEU LEU A . n A 1 68 LYS 68 46 46 LYS LYS A . n A 1 69 GLU 69 47 47 GLU GLU A . n A 1 70 VAL 70 48 48 VAL VAL A . n A 1 71 LEU 71 49 49 LEU LEU A . n A 1 72 GLU 72 50 50 GLU GLU A . n A 1 73 TYR 73 51 51 TYR TYR A . n A 1 74 ASN 74 52 52 ASN ASN A . n A 1 75 ALA 75 53 53 ALA ALA A . n A 1 76 ILE 76 54 54 ILE ILE A . n A 1 77 GLY 77 55 55 GLY GLY A . n A 1 78 GLY 78 56 56 GLY GLY A . n A 1 79 LYS 79 57 57 LYS LYS A . n A 1 80 TYR 80 58 58 TYR TYR A . n A 1 81 ASN 81 59 59 ASN ASN A . n A 1 82 ARG 82 60 60 ARG ARG A . n A 1 83 GLY 83 61 61 GLY GLY A . n A 1 84 LEU 84 62 62 LEU LEU A . n A 1 85 THR 85 63 63 THR THR A . n A 1 86 VAL 86 64 64 VAL VAL A . n A 1 87 VAL 87 65 65 VAL VAL A . n A 1 88 VAL 88 66 66 VAL VAL A . n A 1 89 ALA 89 67 67 ALA ALA A . n A 1 90 PHE 90 68 68 PHE PHE A . n A 1 91 ARG 91 69 69 ARG ARG A . n A 1 92 GLU 92 70 70 GLU GLU A . n A 1 93 LEU 93 71 71 LEU LEU A . n A 1 94 VAL 94 72 72 VAL VAL A . n A 1 95 GLU 95 73 73 GLU GLU A . n A 1 96 PRO 96 74 74 PRO PRO A . n A 1 97 ARG 97 75 75 ARG ARG A . n A 1 98 LYS 98 76 76 LYS LYS A . n A 1 99 GLN 99 77 77 GLN GLN A . n A 1 100 ASP 100 78 78 ASP ASP A . n A 1 101 ALA 101 79 79 ALA ALA A . n A 1 102 ASP 102 80 80 ASP ASP A . n A 1 103 SER 103 81 81 SER SER A . n A 1 104 LEU 104 82 82 LEU LEU A . n A 1 105 GLN 105 83 83 GLN GLN A . n A 1 106 ARG 106 84 84 ARG ARG A . n A 1 107 ALA 107 85 85 ALA ALA A . n A 1 108 TRP 108 86 86 TRP TRP A . n A 1 109 THR 109 87 87 THR THR A . n A 1 110 VAL 110 88 88 VAL VAL A . n A 1 111 GLY 111 89 89 GLY GLY A . n A 1 112 TRP 112 90 90 TRP TRP A . n A 1 113 CYS 113 91 91 CYS CYS A . n A 1 114 VAL 114 92 92 VAL VAL A . n A 1 115 GLU 115 93 93 GLU GLU A . n A 1 116 LEU 116 94 94 LEU LEU A . n A 1 117 LEU 117 95 95 LEU LEU A . n A 1 118 GLN 118 96 96 GLN GLN A . n A 1 119 ALA 119 97 97 ALA ALA A . n A 1 120 PHE 120 98 98 PHE PHE A . n A 1 121 PHE 121 99 99 PHE PHE A . n A 1 122 LEU 122 100 100 LEU LEU A . n A 1 123 VAL 123 101 101 VAL VAL A . n A 1 124 ALA 124 102 102 ALA ALA A . n A 1 125 ASP 125 103 103 ASP ASP A . n A 1 126 ASP 126 104 104 ASP ASP A . n A 1 127 ILE 127 105 105 ILE ILE A . n A 1 128 MET 128 106 106 MET MET A . n A 1 129 ASP 129 107 107 ASP ASP A . n A 1 130 SER 130 108 108 SER SER A . n A 1 131 SER 131 109 109 SER SER A . n A 1 132 LEU 132 110 110 LEU LEU A . n A 1 133 THR 133 111 111 THR THR A . n A 1 134 ARG 134 112 112 ARG ARG A . n A 1 135 ARG 135 113 113 ARG ARG A . n A 1 136 GLY 136 114 114 GLY GLY A . n A 1 137 GLN 137 115 115 GLN GLN A . n A 1 138 ILE 138 116 116 ILE ILE A . n A 1 139 CYS 139 117 117 CYS CYS A . n A 1 140 TRP 140 118 118 TRP TRP A . n A 1 141 TYR 141 119 119 TYR TYR A . n A 1 142 GLN 142 120 120 GLN GLN A . n A 1 143 LYS 143 121 121 LYS LYS A . n A 1 144 PRO 144 122 122 PRO PRO A . n A 1 145 GLY 145 123 123 GLY GLY A . n A 1 146 VAL 146 124 124 VAL VAL A . n A 1 147 GLY 147 125 125 GLY GLY A . n A 1 148 LEU 148 126 126 LEU LEU A . n A 1 149 ASP 149 127 127 ASP ASP A . n A 1 150 ALA 150 128 128 ALA ALA A . n A 1 151 ILE 151 129 129 ILE ILE A . n A 1 152 ASN 152 130 130 ASN ASN A . n A 1 153 ASP 153 131 131 ASP ASP A . n A 1 154 ALA 154 132 132 ALA ALA A . n A 1 155 ASN 155 133 133 ASN ASN A . n A 1 156 LEU 156 134 134 LEU LEU A . n A 1 157 LEU 157 135 135 LEU LEU A . n A 1 158 GLU 158 136 136 GLU GLU A . n A 1 159 ALA 159 137 137 ALA ALA A . n A 1 160 CYS 160 138 138 CYS CYS A . n A 1 161 ILE 161 139 139 ILE ILE A . n A 1 162 TYR 162 140 140 TYR TYR A . n A 1 163 ARG 163 141 141 ARG ARG A . n A 1 164 LEU 164 142 142 LEU LEU A . n A 1 165 LEU 165 143 143 LEU LEU A . n A 1 166 LYS 166 144 144 LYS LYS A . n A 1 167 LEU 167 145 145 LEU LEU A . n A 1 168 TYR 168 146 146 TYR TYR A . n A 1 169 CYS 169 147 147 CYS CYS A . n A 1 170 ARG 170 148 148 ARG ARG A . n A 1 171 GLU 171 149 149 GLU GLU A . n A 1 172 GLN 172 150 150 GLN GLN A . n A 1 173 PRO 173 151 151 PRO PRO A . n A 1 174 TYR 174 152 152 TYR TYR A . n A 1 175 TYR 175 153 153 TYR TYR A . n A 1 176 LEU 176 154 154 LEU LEU A . n A 1 177 ASN 177 155 155 ASN ASN A . n A 1 178 LEU 178 156 156 LEU LEU A . n A 1 179 ILE 179 157 157 ILE ILE A . n A 1 180 GLU 180 158 158 GLU GLU A . n A 1 181 LEU 181 159 159 LEU LEU A . n A 1 182 PHE 182 160 160 PHE PHE A . n A 1 183 LEU 183 161 161 LEU LEU A . n A 1 184 GLN 184 162 162 GLN GLN A . n A 1 185 SER 185 163 163 SER SER A . n A 1 186 SER 186 164 164 SER SER A . n A 1 187 TYR 187 165 165 TYR TYR A . n A 1 188 GLN 188 166 166 GLN GLN A . n A 1 189 THR 189 167 167 THR THR A . n A 1 190 GLU 190 168 168 GLU GLU A . n A 1 191 ILE 191 169 169 ILE ILE A . n A 1 192 GLY 192 170 170 GLY GLY A . n A 1 193 GLN 193 171 171 GLN GLN A . n A 1 194 THR 194 172 172 THR THR A . n A 1 195 LEU 195 173 173 LEU LEU A . n A 1 196 ASP 196 174 174 ASP ASP A . n A 1 197 LEU 197 175 175 LEU LEU A . n A 1 198 LEU 198 176 176 LEU LEU A . n A 1 199 THR 199 177 177 THR THR A . n A 1 200 ALA 200 178 178 ALA ALA A . n A 1 201 PRO 201 179 179 PRO PRO A . n A 1 202 GLN 202 180 180 GLN GLN A . n A 1 203 GLY 203 181 181 GLY GLY A . n A 1 204 ASN 204 182 182 ASN ASN A . n A 1 205 VAL 205 183 183 VAL VAL A . n A 1 206 ASP 206 184 184 ASP ASP A . n A 1 207 LEU 207 185 185 LEU LEU A . n A 1 208 VAL 208 186 186 VAL VAL A . n A 1 209 ARG 209 187 187 ARG ARG A . n A 1 210 PHE 210 188 188 PHE PHE A . n A 1 211 THR 211 189 189 THR THR A . n A 1 212 GLU 212 190 190 GLU GLU A . n A 1 213 LYS 213 191 191 LYS LYS A . n A 1 214 ARG 214 192 192 ARG ARG A . n A 1 215 TYR 215 193 193 TYR TYR A . n A 1 216 LYS 216 194 194 LYS LYS A . n A 1 217 SER 217 195 195 SER SER A . n A 1 218 ILE 218 196 196 ILE ILE A . n A 1 219 VAL 219 197 197 VAL VAL A . n A 1 220 LYS 220 198 198 LYS LYS A . n A 1 221 TYR 221 199 199 TYR TYR A . n A 1 222 LYS 222 200 200 LYS LYS A . n A 1 223 ALA 223 201 201 ALA ALA A . n A 1 224 ALA 224 202 202 ALA ALA A . n A 1 225 PHE 225 203 203 PHE PHE A . n A 1 226 TYR 226 204 204 TYR TYR A . n A 1 227 SER 227 205 205 SER SER A . n A 1 228 PHE 228 206 206 PHE PHE A . n A 1 229 TYR 229 207 207 TYR TYR A . n A 1 230 LEU 230 208 208 LEU LEU A . n A 1 231 PRO 231 209 209 PRO PRO A . n A 1 232 ILE 232 210 210 ILE ILE A . n A 1 233 ALA 233 211 211 ALA ALA A . n A 1 234 ALA 234 212 212 ALA ALA A . n A 1 235 ALA 235 213 213 ALA ALA A . n A 1 236 MET 236 214 214 MET MET A . n A 1 237 TYR 237 215 215 TYR TYR A . n A 1 238 MET 238 216 216 MET MET A . n A 1 239 ALA 239 217 217 ALA ALA A . n A 1 240 GLY 240 218 218 GLY GLY A . n A 1 241 ILE 241 219 219 ILE ILE A . n A 1 242 ASP 242 220 220 ASP ASP A . n A 1 243 GLY 243 221 221 GLY GLY A . n A 1 244 GLU 244 222 222 GLU GLU A . n A 1 245 LYS 245 223 223 LYS LYS A . n A 1 246 GLU 246 224 224 GLU GLU A . n A 1 247 HIS 247 225 225 HIS HIS A . n A 1 248 ALA 248 226 226 ALA ALA A . n A 1 249 ASN 249 227 227 ASN ASN A . n A 1 250 ALA 250 228 228 ALA ALA A . n A 1 251 LYS 251 229 229 LYS LYS A . n A 1 252 LYS 252 230 230 LYS LYS A . n A 1 253 ILE 253 231 231 ILE ILE A . n A 1 254 LEU 254 232 232 LEU LEU A . n A 1 255 LEU 255 233 233 LEU LEU A . n A 1 256 GLU 256 234 234 GLU GLU A . n A 1 257 MET 257 235 235 MET MET A . n A 1 258 GLY 258 236 236 GLY GLY A . n A 1 259 GLU 259 237 237 GLU GLU A . n A 1 260 PHE 260 238 238 PHE PHE A . n A 1 261 PHE 261 239 239 PHE PHE A . n A 1 262 GLN 262 240 240 GLN GLN A . n A 1 263 ILE 263 241 241 ILE ILE A . n A 1 264 GLN 264 242 242 GLN GLN A . n A 1 265 ASP 265 243 243 ASP ASP A . n A 1 266 ASP 266 244 244 ASP ASP A . n A 1 267 TYR 267 245 245 TYR TYR A . n A 1 268 LEU 268 246 246 LEU LEU A . n A 1 269 ASP 269 247 247 ASP ASP A . n A 1 270 LEU 270 248 248 LEU LEU A . n A 1 271 PHE 271 249 249 PHE PHE A . n A 1 272 GLY 272 250 250 GLY GLY A . n A 1 273 ASP 273 251 251 ASP ASP A . n A 1 274 PRO 274 252 252 PRO PRO A . n A 1 275 SER 275 253 253 SER SER A . n A 1 276 VAL 276 254 254 VAL VAL A . n A 1 277 THR 277 255 255 THR THR A . n A 1 278 GLY 278 256 256 GLY GLY A . n A 1 279 LYS 279 257 257 LYS LYS A . n A 1 280 ILE 280 258 258 ILE ILE A . n A 1 281 GLY 281 259 259 GLY GLY A . n A 1 282 THR 282 260 260 THR THR A . n A 1 283 ASP 283 261 261 ASP ASP A . n A 1 284 ILE 284 262 262 ILE ILE A . n A 1 285 GLN 285 263 263 GLN GLN A . n A 1 286 ASP 286 264 264 ASP ASP A . n A 1 287 ASN 287 265 265 ASN ASN A . n A 1 288 LYS 288 266 266 LYS LYS A . n A 1 289 CYS 289 267 267 CYS CYS A . n A 1 290 SER 290 268 268 SER SER A . n A 1 291 TRP 291 269 269 TRP TRP A . n A 1 292 LEU 292 270 270 LEU LEU A . n A 1 293 VAL 293 271 271 VAL VAL A . n A 1 294 VAL 294 272 272 VAL VAL A . n A 1 295 GLN 295 273 273 GLN GLN A . n A 1 296 CYS 296 274 274 CYS CYS A . n A 1 297 LEU 297 275 275 LEU LEU A . n A 1 298 GLN 298 276 276 GLN GLN A . n A 1 299 ARG 299 277 277 ARG ARG A . n A 1 300 ALA 300 278 278 ALA ALA A . n A 1 301 THR 301 279 279 THR THR A . n A 1 302 PRO 302 280 280 PRO PRO A . n A 1 303 GLU 303 281 281 GLU GLU A . n A 1 304 GLN 304 282 282 GLN GLN A . n A 1 305 TYR 305 283 283 TYR TYR A . n A 1 306 GLN 306 284 284 GLN GLN A . n A 1 307 ILE 307 285 285 ILE ILE A . n A 1 308 LEU 308 286 286 LEU LEU A . n A 1 309 LYS 309 287 287 LYS LYS A . n A 1 310 GLU 310 288 288 GLU GLU A . n A 1 311 ASN 311 289 289 ASN ASN A . n A 1 312 TYR 312 290 290 TYR TYR A . n A 1 313 GLY 313 291 291 GLY GLY A . n A 1 314 GLN 314 292 292 GLN GLN A . n A 1 315 LYS 315 293 293 LYS LYS A . n A 1 316 GLU 316 294 294 GLU GLU A . n A 1 317 ALA 317 295 295 ALA ALA A . n A 1 318 GLU 318 296 296 GLU GLU A . n A 1 319 LYS 319 297 297 LYS LYS A . n A 1 320 VAL 320 298 298 VAL VAL A . n A 1 321 ALA 321 299 299 ALA ALA A . n A 1 322 ARG 322 300 300 ARG ARG A . n A 1 323 VAL 323 301 301 VAL VAL A . n A 1 324 LYS 324 302 302 LYS LYS A . n A 1 325 ALA 325 303 303 ALA ALA A . n A 1 326 LEU 326 304 304 LEU LEU A . n A 1 327 TYR 327 305 305 TYR TYR A . n A 1 328 GLU 328 306 306 GLU GLU A . n A 1 329 GLU 329 307 307 GLU GLU A . n A 1 330 LEU 330 308 308 LEU LEU A . n A 1 331 ASP 331 309 309 ASP ASP A . n A 1 332 LEU 332 310 310 LEU LEU A . n A 1 333 PRO 333 311 311 PRO PRO A . n A 1 334 ALA 334 312 312 ALA ALA A . n A 1 335 VAL 335 313 313 VAL VAL A . n A 1 336 PHE 336 314 314 PHE PHE A . n A 1 337 LEU 337 315 315 LEU LEU A . n A 1 338 GLN 338 316 316 GLN GLN A . n A 1 339 TYR 339 317 317 TYR TYR A . n A 1 340 GLU 340 318 318 GLU GLU A . n A 1 341 GLU 341 319 319 GLU GLU A . n A 1 342 ASP 342 320 320 ASP ASP A . n A 1 343 SER 343 321 321 SER SER A . n A 1 344 TYR 344 322 322 TYR TYR A . n A 1 345 SER 345 323 323 SER SER A . n A 1 346 HIS 346 324 324 HIS HIS A . n A 1 347 ILE 347 325 325 ILE ILE A . n A 1 348 MET 348 326 326 MET MET A . n A 1 349 ALA 349 327 327 ALA ALA A . n A 1 350 LEU 350 328 328 LEU LEU A . n A 1 351 ILE 351 329 329 ILE ILE A . n A 1 352 GLU 352 330 330 GLU GLU A . n A 1 353 GLN 353 331 331 GLN GLN A . n A 1 354 TYR 354 332 332 TYR TYR A . n A 1 355 ALA 355 333 333 ALA ALA A . n A 1 356 ALA 356 334 334 ALA ALA A . n A 1 357 PRO 357 335 335 PRO PRO A . n A 1 358 LEU 358 336 336 LEU LEU A . n A 1 359 PRO 359 337 337 PRO PRO A . n A 1 360 PRO 360 338 338 PRO PRO A . n A 1 361 ALA 361 339 339 ALA ALA A . n A 1 362 VAL 362 340 340 VAL VAL A . n A 1 363 PHE 363 341 341 PHE PHE A . n A 1 364 LEU 364 342 342 LEU LEU A . n A 1 365 GLY 365 343 343 GLY GLY A . n A 1 366 LEU 366 344 344 LEU LEU A . n A 1 367 ALA 367 345 345 ALA ALA A . n A 1 368 ARG 368 346 346 ARG ARG A . n A 1 369 LYS 369 347 347 LYS LYS A . n A 1 370 ILE 370 348 348 ILE ILE A . n A 1 371 TYR 371 349 349 TYR TYR A . n A 1 372 LYS 372 350 ? ? ? A . n A 1 373 ARG 373 351 ? ? ? A . n A 1 374 ARG 374 352 ? ? ? A . n A 1 375 LYS 375 353 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 RIS 1 901 901 RIS RIS A . C 3 MG 1 902 907 MG MG A . D 3 MG 1 903 908 MG MG A . E 3 MG 1 904 909 MG MG A . F 4 SO4 1 905 1 SO4 SO4 A . G 5 HOH 1 1001 4 HOH HOH A . G 5 HOH 2 1002 6 HOH HOH A . G 5 HOH 3 1003 11 HOH HOH A . G 5 HOH 4 1004 12 HOH HOH A . G 5 HOH 5 1005 13 HOH HOH A . G 5 HOH 6 1006 14 HOH HOH A . G 5 HOH 7 1007 15 HOH HOH A . G 5 HOH 8 1008 16 HOH HOH A . G 5 HOH 9 1009 17 HOH HOH A . G 5 HOH 10 1010 18 HOH HOH A . G 5 HOH 11 1011 19 HOH HOH A . G 5 HOH 12 1012 21 HOH HOH A . G 5 HOH 13 1013 22 HOH HOH A . G 5 HOH 14 1014 23 HOH HOH A . G 5 HOH 15 1015 24 HOH HOH A . G 5 HOH 16 1016 25 HOH HOH A . G 5 HOH 17 1017 26 HOH HOH A . G 5 HOH 18 1018 27 HOH HOH A . G 5 HOH 19 1019 28 HOH HOH A . G 5 HOH 20 1020 30 HOH HOH A . G 5 HOH 21 1021 32 HOH HOH A . G 5 HOH 22 1022 33 HOH HOH A . G 5 HOH 23 1023 34 HOH HOH A . G 5 HOH 24 1024 35 HOH HOH A . G 5 HOH 25 1025 36 HOH HOH A . G 5 HOH 26 1026 37 HOH HOH A . G 5 HOH 27 1027 38 HOH HOH A . G 5 HOH 28 1028 39 HOH HOH A . G 5 HOH 29 1029 40 HOH HOH A . G 5 HOH 30 1030 41 HOH HOH A . G 5 HOH 31 1031 43 HOH HOH A . G 5 HOH 32 1032 44 HOH HOH A . G 5 HOH 33 1033 45 HOH HOH A . G 5 HOH 34 1034 46 HOH HOH A . G 5 HOH 35 1035 47 HOH HOH A . G 5 HOH 36 1036 48 HOH HOH A . G 5 HOH 37 1037 50 HOH HOH A . G 5 HOH 38 1038 51 HOH HOH A . G 5 HOH 39 1039 52 HOH HOH A . G 5 HOH 40 1040 53 HOH HOH A . G 5 HOH 41 1041 54 HOH HOH A . G 5 HOH 42 1042 55 HOH HOH A . G 5 HOH 43 1043 56 HOH HOH A . G 5 HOH 44 1044 57 HOH HOH A . G 5 HOH 45 1045 58 HOH HOH A . G 5 HOH 46 1046 59 HOH HOH A . G 5 HOH 47 1047 61 HOH HOH A . G 5 HOH 48 1048 62 HOH HOH A . G 5 HOH 49 1049 63 HOH HOH A . G 5 HOH 50 1050 64 HOH HOH A . G 5 HOH 51 1051 65 HOH HOH A . G 5 HOH 52 1052 67 HOH HOH A . G 5 HOH 53 1053 68 HOH HOH A . G 5 HOH 54 1054 69 HOH HOH A . G 5 HOH 55 1055 71 HOH HOH A . G 5 HOH 56 1056 72 HOH HOH A . G 5 HOH 57 1057 74 HOH HOH A . G 5 HOH 58 1058 75 HOH HOH A . G 5 HOH 59 1059 76 HOH HOH A . G 5 HOH 60 1060 77 HOH HOH A . G 5 HOH 61 1061 79 HOH HOH A . G 5 HOH 62 1062 80 HOH HOH A . G 5 HOH 63 1063 81 HOH HOH A . G 5 HOH 64 1064 82 HOH HOH A . G 5 HOH 65 1065 84 HOH HOH A . G 5 HOH 66 1066 86 HOH HOH A . G 5 HOH 67 1067 88 HOH HOH A . G 5 HOH 68 1068 91 HOH HOH A . G 5 HOH 69 1069 92 HOH HOH A . G 5 HOH 70 1070 93 HOH HOH A . G 5 HOH 71 1071 94 HOH HOH A . G 5 HOH 72 1072 95 HOH HOH A . G 5 HOH 73 1073 98 HOH HOH A . G 5 HOH 74 1074 100 HOH HOH A . G 5 HOH 75 1075 101 HOH HOH A . G 5 HOH 76 1076 102 HOH HOH A . G 5 HOH 77 1077 104 HOH HOH A . G 5 HOH 78 1078 107 HOH HOH A . G 5 HOH 79 1079 110 HOH HOH A . G 5 HOH 80 1080 111 HOH HOH A . G 5 HOH 81 1081 113 HOH HOH A . G 5 HOH 82 1082 114 HOH HOH A . G 5 HOH 83 1083 116 HOH HOH A . G 5 HOH 84 1084 121 HOH HOH A . G 5 HOH 85 1085 122 HOH HOH A . G 5 HOH 86 1086 123 HOH HOH A . G 5 HOH 87 1087 124 HOH HOH A . G 5 HOH 88 1088 125 HOH HOH A . G 5 HOH 89 1089 126 HOH HOH A . G 5 HOH 90 1090 127 HOH HOH A . G 5 HOH 91 1091 128 HOH HOH A . G 5 HOH 92 1092 129 HOH HOH A . G 5 HOH 93 1093 130 HOH HOH A . G 5 HOH 94 1094 131 HOH HOH A . G 5 HOH 95 1095 132 HOH HOH A . G 5 HOH 96 1096 133 HOH HOH A . G 5 HOH 97 1097 134 HOH HOH A . G 5 HOH 98 1098 135 HOH HOH A . G 5 HOH 99 1099 136 HOH HOH A . G 5 HOH 100 1100 137 HOH HOH A . G 5 HOH 101 1101 138 HOH HOH A . G 5 HOH 102 1102 139 HOH HOH A . G 5 HOH 103 1103 140 HOH HOH A . G 5 HOH 104 1104 141 HOH HOH A . G 5 HOH 105 1105 142 HOH HOH A . G 5 HOH 106 1106 143 HOH HOH A . G 5 HOH 107 1107 144 HOH HOH A . G 5 HOH 108 1108 145 HOH HOH A . G 5 HOH 109 1109 146 HOH HOH A . G 5 HOH 110 1110 148 HOH HOH A . G 5 HOH 111 1111 150 HOH HOH A . G 5 HOH 112 1112 151 HOH HOH A . G 5 HOH 113 1113 152 HOH HOH A . G 5 HOH 114 1114 153 HOH HOH A . G 5 HOH 115 1115 154 HOH HOH A . G 5 HOH 116 1116 155 HOH HOH A . G 5 HOH 117 1117 156 HOH HOH A . G 5 HOH 118 1118 157 HOH HOH A . G 5 HOH 119 1119 158 HOH HOH A . G 5 HOH 120 1120 159 HOH HOH A . G 5 HOH 121 1121 160 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6520 ? 1 MORE -107 ? 1 'SSA (A^2)' 25950 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 8_554 -y,-x,-z-1/2 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 -33.8000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 OD2 ? A ASP 125 ? A ASP 103 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 OD2 ? A ASP 129 ? A ASP 107 ? 1_555 85.8 ? 2 OD2 ? A ASP 125 ? A ASP 103 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O15 ? B RIS . ? A RIS 901 ? 1_555 88.5 ? 3 OD2 ? A ASP 129 ? A ASP 107 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O15 ? B RIS . ? A RIS 901 ? 1_555 76.7 ? 4 OD2 ? A ASP 125 ? A ASP 103 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O12 ? B RIS . ? A RIS 901 ? 1_555 96.1 ? 5 OD2 ? A ASP 129 ? A ASP 107 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O12 ? B RIS . ? A RIS 901 ? 1_555 169.3 ? 6 O15 ? B RIS . ? A RIS 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O12 ? B RIS . ? A RIS 901 ? 1_555 92.8 ? 7 OD2 ? A ASP 125 ? A ASP 103 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? G HOH . ? A HOH 1090 ? 1_555 167.7 ? 8 OD2 ? A ASP 129 ? A ASP 107 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? G HOH . ? A HOH 1090 ? 1_555 84.3 ? 9 O15 ? B RIS . ? A RIS 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? G HOH . ? A HOH 1090 ? 1_555 96.4 ? 10 O12 ? B RIS . ? A RIS 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? G HOH . ? A HOH 1090 ? 1_555 94.9 ? 11 OD2 ? A ASP 125 ? A ASP 103 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? G HOH . ? A HOH 1092 ? 1_555 83.1 ? 12 OD2 ? A ASP 129 ? A ASP 107 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? G HOH . ? A HOH 1092 ? 1_555 101.1 ? 13 O15 ? B RIS . ? A RIS 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? G HOH . ? A HOH 1092 ? 1_555 171.5 ? 14 O12 ? B RIS . ? A RIS 901 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? G HOH . ? A HOH 1092 ? 1_555 89.6 ? 15 O ? G HOH . ? A HOH 1090 ? 1_555 MG ? C MG . ? A MG 902 ? 1_555 O ? G HOH . ? A HOH 1092 ? 1_555 91.6 ? 16 OD1 ? A ASP 125 ? A ASP 103 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 OD2 ? A ASP 129 ? A ASP 107 ? 1_555 89.6 ? 17 OD1 ? A ASP 125 ? A ASP 103 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O15 ? B RIS . ? A RIS 901 ? 1_555 94.3 ? 18 OD2 ? A ASP 129 ? A ASP 107 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O15 ? B RIS . ? A RIS 901 ? 1_555 82.2 ? 19 OD1 ? A ASP 125 ? A ASP 103 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O ? G HOH . ? A HOH 1094 ? 1_555 172.2 ? 20 OD2 ? A ASP 129 ? A ASP 107 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O ? G HOH . ? A HOH 1094 ? 1_555 93.9 ? 21 O15 ? B RIS . ? A RIS 901 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O ? G HOH . ? A HOH 1094 ? 1_555 93.1 ? 22 OD1 ? A ASP 125 ? A ASP 103 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O ? G HOH . ? A HOH 1095 ? 1_555 87.6 ? 23 OD2 ? A ASP 129 ? A ASP 107 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O ? G HOH . ? A HOH 1095 ? 1_555 98.4 ? 24 O15 ? B RIS . ? A RIS 901 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O ? G HOH . ? A HOH 1095 ? 1_555 178.0 ? 25 O ? G HOH . ? A HOH 1094 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O ? G HOH . ? A HOH 1095 ? 1_555 85.0 ? 26 OD1 ? A ASP 125 ? A ASP 103 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O ? G HOH . ? A HOH 1096 ? 1_555 89.9 ? 27 OD2 ? A ASP 129 ? A ASP 107 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O ? G HOH . ? A HOH 1096 ? 1_555 173.6 ? 28 O15 ? B RIS . ? A RIS 901 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O ? G HOH . ? A HOH 1096 ? 1_555 91.5 ? 29 O ? G HOH . ? A HOH 1094 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O ? G HOH . ? A HOH 1096 ? 1_555 87.4 ? 30 O ? G HOH . ? A HOH 1095 ? 1_555 MG ? E MG . ? A MG 904 ? 1_555 O ? G HOH . ? A HOH 1096 ? 1_555 87.9 ? 31 OD2 ? A ASP 265 ? A ASP 243 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O11 ? B RIS . ? A RIS 901 ? 1_555 102.2 ? 32 OD2 ? A ASP 265 ? A ASP 243 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O16 ? B RIS . ? A RIS 901 ? 1_555 96.5 ? 33 O11 ? B RIS . ? A RIS 901 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O16 ? B RIS . ? A RIS 901 ? 1_555 95.9 ? 34 OD2 ? A ASP 265 ? A ASP 243 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O ? G HOH . ? A HOH 1088 ? 1_555 89.4 ? 35 O11 ? B RIS . ? A RIS 901 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O ? G HOH . ? A HOH 1088 ? 1_555 87.6 ? 36 O16 ? B RIS . ? A RIS 901 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O ? G HOH . ? A HOH 1088 ? 1_555 172.3 ? 37 OD2 ? A ASP 265 ? A ASP 243 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O ? G HOH . ? A HOH 1089 ? 1_555 157.7 ? 38 O11 ? B RIS . ? A RIS 901 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O ? G HOH . ? A HOH 1089 ? 1_555 98.0 ? 39 O16 ? B RIS . ? A RIS 901 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O ? G HOH . ? A HOH 1089 ? 1_555 90.5 ? 40 O ? G HOH . ? A HOH 1088 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O ? G HOH . ? A HOH 1089 ? 1_555 82.2 ? 41 OD2 ? A ASP 265 ? A ASP 243 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O ? G HOH . ? A HOH 1093 ? 1_555 81.5 ? 42 O11 ? B RIS . ? A RIS 901 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O ? G HOH . ? A HOH 1093 ? 1_555 174.7 ? 43 O16 ? B RIS . ? A RIS 901 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O ? G HOH . ? A HOH 1093 ? 1_555 87.4 ? 44 O ? G HOH . ? A HOH 1088 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O ? G HOH . ? A HOH 1093 ? 1_555 88.6 ? 45 O ? G HOH . ? A HOH 1089 ? 1_555 MG ? D MG . ? A MG 903 ? 1_555 O ? G HOH . ? A HOH 1093 ? 1_555 77.7 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-03-18 2 'Structure model' 1 1 2018-01-31 3 'Structure model' 1 2 2023-09-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 2 'Structure model' 'Structure summary' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Database references' 5 3 'Structure model' 'Derived calculations' 6 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' audit_author 2 2 'Structure model' citation_author 3 3 'Structure model' chem_comp_atom 4 3 'Structure model' chem_comp_bond 5 3 'Structure model' database_2 6 3 'Structure model' pdbx_initial_refinement_model 7 3 'Structure model' pdbx_struct_conn_angle 8 3 'Structure model' struct_conn 9 3 'Structure model' struct_ref_seq_dif 10 3 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_audit_author.name' 2 2 'Structure model' '_chem_comp.pdbx_synonyms' 3 2 'Structure model' '_citation_author.name' 4 3 'Structure model' '_database_2.pdbx_DOI' 5 3 'Structure model' '_database_2.pdbx_database_accession' 6 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 7 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 8 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_asym_id' 9 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 10 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 11 3 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 12 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_auth_seq_id' 13 3 'Structure model' '_pdbx_struct_conn_angle.ptnr2_label_asym_id' 14 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 15 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 16 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_asym_id' 17 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 18 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 19 3 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 20 3 'Structure model' '_pdbx_struct_conn_angle.value' 21 3 'Structure model' '_struct_conn.pdbx_dist_value' 22 3 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 23 3 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 24 3 'Structure model' '_struct_conn.ptnr1_label_asym_id' 25 3 'Structure model' '_struct_conn.ptnr1_label_atom_id' 26 3 'Structure model' '_struct_conn.ptnr1_label_comp_id' 27 3 'Structure model' '_struct_conn.ptnr1_label_seq_id' 28 3 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 29 3 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 30 3 'Structure model' '_struct_conn.ptnr2_label_asym_id' 31 3 'Structure model' '_struct_conn.ptnr2_label_atom_id' 32 3 'Structure model' '_struct_conn.ptnr2_label_comp_id' 33 3 'Structure model' '_struct_ref_seq_dif.details' 34 3 'Structure model' '_struct_site.pdbx_auth_asym_id' 35 3 'Structure model' '_struct_site.pdbx_auth_comp_id' 36 3 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][3] 'X-RAY DIFFRACTION' 1 ? refined -0.8730 29.0744 -25.9506 -0.2773 0.0833 0.2114 -0.1518 0.1393 0.0585 0.3985 3.3141 4.3325 -1.5641 -1.1312 -1.5366 0.1045 0.2020 0.2582 -0.1763 -0.1367 -0.1910 -0.2706 0.3437 0.0322 'X-RAY DIFFRACTION' 2 ? refined -15.9259 27.9344 -31.1703 -0.1390 -0.0077 0.1104 -0.0484 0.0926 -0.0023 0.6539 0.3922 3.5647 -2.7107 -1.8593 0.3210 -0.0561 0.4347 -0.1810 -0.1450 -0.1724 -0.2562 -0.0316 0.2596 0.2286 'X-RAY DIFFRACTION' 3 ? refined 3.8472 27.7589 -15.0814 -0.2921 -0.0747 0.2253 -0.0827 -0.0165 -0.0831 2.7218 0.1888 5.5334 2.2449 2.3130 -1.8843 -0.0444 0.1895 0.1425 -0.0639 0.1460 -0.1559 -0.0883 0.5442 -0.1016 'X-RAY DIFFRACTION' 4 ? refined 11.5562 18.9292 -22.5258 -0.2437 0.2936 0.3040 0.0037 0.0456 -0.1502 2.1279 0.6188 0.1188 -0.3929 -1.0433 2.2018 0.0098 0.0228 0.0236 -0.0023 -0.0328 -0.0425 0.0437 0.0523 0.0230 'X-RAY DIFFRACTION' 5 ? refined -13.9317 24.7999 -16.7155 -0.1615 -0.1554 0.0944 -0.0194 -0.0014 -0.0109 2.5070 1.1876 1.3468 -0.1828 0.6334 0.3426 0.0060 0.1546 -0.1166 -0.0613 0.1143 -0.1239 -0.0098 0.1562 -0.1203 'X-RAY DIFFRACTION' 6 ? refined -17.0032 29.1886 2.2435 -0.1785 -0.2266 0.2433 -0.0051 -0.1520 0.0415 2.6001 8.1679 2.8000 -1.2906 2.7725 2.2633 0.1238 -0.2565 -0.3151 0.4850 0.0424 -0.5028 0.1462 -0.1831 -0.1662 'X-RAY DIFFRACTION' 7 ? refined 0.7820 19.7472 -4.8659 -0.1799 -0.0946 0.2651 0.0045 -0.0907 -0.0384 3.3187 3.3857 4.8065 -0.6109 -0.2603 2.0301 0.0737 -0.0220 -0.3565 0.2128 0.0271 -0.0584 0.2938 0.2764 -0.1009 'X-RAY DIFFRACTION' 8 ? refined -14.4406 40.1496 -2.7291 -0.1047 -0.1651 0.1117 -0.0162 -0.0789 -0.0341 2.5259 1.7670 1.9872 -0.3669 0.1387 0.1412 -0.1095 -0.2788 0.4821 0.1920 0.1126 -0.3368 -0.2605 0.1031 -0.0032 'X-RAY DIFFRACTION' 9 ? refined -25.7915 46.2915 6.2031 0.0073 -0.0053 0.1031 0.0854 -0.0145 -0.1065 1.7373 1.3707 4.0085 0.2340 -0.1798 -0.9790 -0.0376 -0.5442 0.5207 0.5442 0.2184 0.1262 -0.1697 -0.1883 -0.1807 'X-RAY DIFFRACTION' 10 ? refined 0.3930 35.4883 2.5736 -0.1829 -0.1098 0.1641 -0.0444 -0.0917 -0.0554 4.6088 3.7409 1.9197 -2.1278 -0.1996 1.5903 -0.0648 -0.1419 0.4354 0.0284 -0.0592 -0.1537 -0.2738 0.0281 0.1241 # loop_ _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection_details _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.selection 'X-RAY DIFFRACTION' 1 1 A 9 A 34 '{A|9 - 34}' ? ? ? ? ? 'X-RAY DIFFRACTION' 2 2 A 35 A 55 '{A|35 - 55}' ? ? ? ? ? 'X-RAY DIFFRACTION' 3 3 A 56 A 73 '{A|56 - 73}' ? ? ? ? ? 'X-RAY DIFFRACTION' 4 4 A 74 A 83 '{A|74 - 83}' ? ? ? ? ? 'X-RAY DIFFRACTION' 5 5 A 84 A 181 '{A|84 - 181}' ? ? ? ? ? 'X-RAY DIFFRACTION' 6 6 A 182 A 205 '{A|182 - 205}' ? ? ? ? ? 'X-RAY DIFFRACTION' 7 7 A 206 A 234 '{A|206 - 234}' ? ? ? ? ? 'X-RAY DIFFRACTION' 8 8 A 235 A 273 '{A|235 - 273}' ? ? ? ? ? 'X-RAY DIFFRACTION' 9 9 A 274 A 305 '{A|274 - 305}' ? ? ? ? ? 'X-RAY DIFFRACTION' 10 10 A 306 A 349 '{A|306 - 349}' ? ? ? ? ? # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal ADSC 'data collection' Quantum ? 1 PHASER phasing . ? 2 BUSTER refinement 2.8.0 ? 3 MOSFLM 'data reduction' . ? 4 SCALA 'data scaling' . ? 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 36 ? ? -66.91 1.36 2 1 VAL A 124 ? ? -100.05 -70.83 3 1 ALA A 178 ? ? -117.90 57.99 4 1 ALA A 201 ? ? -120.48 -51.82 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A VAL 9 ? CG1 ? A VAL 31 CG1 2 1 Y 1 A VAL 9 ? CG2 ? A VAL 31 CG2 3 1 Y 1 A GLN 12 ? CG ? A GLN 34 CG 4 1 Y 1 A GLN 12 ? CD ? A GLN 34 CD 5 1 Y 1 A GLN 12 ? OE1 ? A GLN 34 OE1 6 1 Y 1 A GLN 12 ? NE2 ? A GLN 34 NE2 7 1 Y 1 A GLU 13 ? OE1 ? A GLU 35 OE1 8 1 Y 1 A GLU 13 ? OE2 ? A GLU 35 OE2 9 1 Y 1 A GLN 15 ? CG ? A GLN 37 CG 10 1 Y 1 A GLN 15 ? CD ? A GLN 37 CD 11 1 Y 1 A GLN 15 ? OE1 ? A GLN 37 OE1 12 1 Y 1 A GLN 15 ? NE2 ? A GLN 37 NE2 13 1 Y 1 A ASP 16 ? CG ? A ASP 38 CG 14 1 Y 1 A ASP 16 ? OD1 ? A ASP 38 OD1 15 1 Y 1 A ASP 16 ? OD2 ? A ASP 38 OD2 16 1 Y 1 A GLN 19 ? CG ? A GLN 41 CG 17 1 Y 1 A GLN 19 ? CD ? A GLN 41 CD 18 1 Y 1 A GLN 19 ? OE1 ? A GLN 41 OE1 19 1 Y 1 A GLN 19 ? NE2 ? A GLN 41 NE2 20 1 Y 1 A ARG 26 ? CG ? A ARG 48 CG 21 1 Y 1 A ARG 26 ? CD ? A ARG 48 CD 22 1 Y 1 A ARG 26 ? NE ? A ARG 48 NE 23 1 Y 1 A ARG 26 ? CZ ? A ARG 48 CZ 24 1 Y 1 A ARG 26 ? NH1 ? A ARG 48 NH1 25 1 Y 1 A ARG 26 ? NH2 ? A ARG 48 NH2 26 1 Y 1 A HIS 35 ? CG ? A HIS 57 CG 27 1 Y 1 A HIS 35 ? ND1 ? A HIS 57 ND1 28 1 Y 1 A HIS 35 ? CD2 ? A HIS 57 CD2 29 1 Y 1 A HIS 35 ? CE1 ? A HIS 57 CE1 30 1 Y 1 A HIS 35 ? NE2 ? A HIS 57 NE2 31 1 Y 1 A ILE 38 ? CG1 ? A ILE 60 CG1 32 1 Y 1 A ILE 38 ? CG2 ? A ILE 60 CG2 33 1 Y 1 A ILE 38 ? CD1 ? A ILE 60 CD1 34 1 Y 1 A GLU 73 ? CG ? A GLU 95 CG 35 1 Y 1 A GLU 73 ? CD ? A GLU 95 CD 36 1 Y 1 A GLU 73 ? OE1 ? A GLU 95 OE1 37 1 Y 1 A GLU 73 ? OE2 ? A GLU 95 OE2 38 1 Y 1 A GLU 149 ? OE1 ? A GLU 171 OE1 39 1 Y 1 A GLU 149 ? OE2 ? A GLU 171 OE2 40 1 Y 1 A GLN 180 ? CG ? A GLN 202 CG 41 1 Y 1 A GLN 180 ? CD ? A GLN 202 CD 42 1 Y 1 A GLN 180 ? OE1 ? A GLN 202 OE1 43 1 Y 1 A GLN 180 ? NE2 ? A GLN 202 NE2 44 1 Y 1 A ASP 184 ? CG ? A ASP 206 CG 45 1 Y 1 A ASP 184 ? OD1 ? A ASP 206 OD1 46 1 Y 1 A ASP 184 ? OD2 ? A ASP 206 OD2 47 1 Y 1 A ARG 187 ? CG ? A ARG 209 CG 48 1 Y 1 A ARG 187 ? CD ? A ARG 209 CD 49 1 Y 1 A ARG 187 ? NE ? A ARG 209 NE 50 1 Y 1 A ARG 187 ? CZ ? A ARG 209 CZ 51 1 Y 1 A ARG 187 ? NH1 ? A ARG 209 NH1 52 1 Y 1 A ARG 187 ? NH2 ? A ARG 209 NH2 53 1 Y 1 A LYS 191 ? CG ? A LYS 213 CG 54 1 Y 1 A LYS 191 ? CD ? A LYS 213 CD 55 1 Y 1 A LYS 191 ? CE ? A LYS 213 CE 56 1 Y 1 A LYS 191 ? NZ ? A LYS 213 NZ 57 1 Y 1 A LYS 223 ? CG ? A LYS 245 CG 58 1 Y 1 A LYS 223 ? CD ? A LYS 245 CD 59 1 Y 1 A LYS 223 ? CE ? A LYS 245 CE 60 1 Y 1 A LYS 223 ? NZ ? A LYS 245 NZ 61 1 Y 1 A GLU 281 ? CG ? A GLU 303 CG 62 1 Y 1 A GLU 281 ? CD ? A GLU 303 CD 63 1 Y 1 A GLU 281 ? OE1 ? A GLU 303 OE1 64 1 Y 1 A GLU 281 ? OE2 ? A GLU 303 OE2 65 1 Y 1 A LYS 287 ? NZ ? A LYS 309 NZ 66 1 Y 1 A GLU 296 ? CD ? A GLU 318 CD 67 1 Y 1 A GLU 296 ? OE1 ? A GLU 318 OE1 68 1 Y 1 A GLU 296 ? OE2 ? A GLU 318 OE2 69 1 Y 1 A ARG 300 ? CD ? A ARG 322 CD 70 1 Y 1 A ARG 300 ? NE ? A ARG 322 NE 71 1 Y 1 A ARG 300 ? CZ ? A ARG 322 CZ 72 1 Y 1 A ARG 300 ? NH1 ? A ARG 322 NH1 73 1 Y 1 A ARG 300 ? NH2 ? A ARG 322 NH2 74 1 Y 1 A ARG 346 ? CG ? A ARG 368 CG 75 1 Y 1 A ARG 346 ? CD ? A ARG 368 CD 76 1 Y 1 A ARG 346 ? NE ? A ARG 368 NE 77 1 Y 1 A ARG 346 ? CZ ? A ARG 368 CZ 78 1 Y 1 A ARG 346 ? NH1 ? A ARG 368 NH1 79 1 Y 1 A ARG 346 ? NH2 ? A ARG 368 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET -21 ? A MET 1 2 1 Y 1 A GLY -20 ? A GLY 2 3 1 Y 1 A SER -19 ? A SER 3 4 1 Y 1 A SER -18 ? A SER 4 5 1 Y 1 A HIS -17 ? A HIS 5 6 1 Y 1 A HIS -16 ? A HIS 6 7 1 Y 1 A HIS -15 ? A HIS 7 8 1 Y 1 A HIS -14 ? A HIS 8 9 1 Y 1 A HIS -13 ? A HIS 9 10 1 Y 1 A HIS -12 ? A HIS 10 11 1 Y 1 A SER -11 ? A SER 11 12 1 Y 1 A SER -10 ? A SER 12 13 1 Y 1 A GLY -9 ? A GLY 13 14 1 Y 1 A ARG -8 ? A ARG 14 15 1 Y 1 A GLU -7 ? A GLU 15 16 1 Y 1 A ASN -6 ? A ASN 16 17 1 Y 1 A LEU -5 ? A LEU 17 18 1 Y 1 A TYR -4 ? A TYR 18 19 1 Y 1 A PHE -3 ? A PHE 19 20 1 Y 1 A GLN -2 ? A GLN 20 21 1 Y 1 A GLY -1 ? A GLY 21 22 1 Y 1 A HIS 0 ? A HIS 22 23 1 Y 1 A MET 1 ? A MET 23 24 1 Y 1 A ASN 2 ? A ASN 24 25 1 Y 1 A GLY 3 ? A GLY 25 26 1 Y 1 A ASP 4 ? A ASP 26 27 1 Y 1 A GLN 5 ? A GLN 27 28 1 Y 1 A ASN 6 ? A ASN 28 29 1 Y 1 A SER 7 ? A SER 29 30 1 Y 1 A ASP 8 ? A ASP 30 31 1 Y 1 A GLU 30 ? A GLU 52 32 1 Y 1 A ASP 31 ? A ASP 53 33 1 Y 1 A GLU 32 ? A GLU 54 34 1 Y 1 A MET 33 ? A MET 55 35 1 Y 1 A LYS 350 ? A LYS 372 36 1 Y 1 A ARG 351 ? A ARG 373 37 1 Y 1 A ARG 352 ? A ARG 374 38 1 Y 1 A LYS 353 ? A LYS 375 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 MG MG MG N N 250 PHE N N N N 251 PHE CA C N S 252 PHE C C N N 253 PHE O O N N 254 PHE CB C N N 255 PHE CG C Y N 256 PHE CD1 C Y N 257 PHE CD2 C Y N 258 PHE CE1 C Y N 259 PHE CE2 C Y N 260 PHE CZ C Y N 261 PHE OXT O N N 262 PHE H H N N 263 PHE H2 H N N 264 PHE HA H N N 265 PHE HB2 H N N 266 PHE HB3 H N N 267 PHE HD1 H N N 268 PHE HD2 H N N 269 PHE HE1 H N N 270 PHE HE2 H N N 271 PHE HZ H N N 272 PHE HXT H N N 273 PRO N N N N 274 PRO CA C N S 275 PRO C C N N 276 PRO O O N N 277 PRO CB C N N 278 PRO CG C N N 279 PRO CD C N N 280 PRO OXT O N N 281 PRO H H N N 282 PRO HA H N N 283 PRO HB2 H N N 284 PRO HB3 H N N 285 PRO HG2 H N N 286 PRO HG3 H N N 287 PRO HD2 H N N 288 PRO HD3 H N N 289 PRO HXT H N N 290 RIS O12 O N N 291 RIS P9 P N N 292 RIS O11 O N N 293 RIS O10 O N N 294 RIS C8 C N N 295 RIS O13 O N N 296 RIS P14 P N N 297 RIS O16 O N N 298 RIS O15 O N N 299 RIS O17 O N N 300 RIS C7 C N N 301 RIS C2 C Y N 302 RIS C1 C Y N 303 RIS C6 C Y N 304 RIS C5 C Y N 305 RIS N4 N Y N 306 RIS C3 C Y N 307 RIS H12 H N N 308 RIS H13 H N N 309 RIS H16 H N N 310 RIS H15 H N N 311 RIS HC71 H N N 312 RIS HC72 H N N 313 RIS HC1 H N N 314 RIS HC6 H N N 315 RIS HC5 H N N 316 RIS HC3 H N N 317 RIS HO1 H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 SO4 S S N N 333 SO4 O1 O N N 334 SO4 O2 O N N 335 SO4 O3 O N N 336 SO4 O4 O N N 337 THR N N N N 338 THR CA C N S 339 THR C C N N 340 THR O O N N 341 THR CB C N R 342 THR OG1 O N N 343 THR CG2 C N N 344 THR OXT O N N 345 THR H H N N 346 THR H2 H N N 347 THR HA H N N 348 THR HB H N N 349 THR HG1 H N N 350 THR HG21 H N N 351 THR HG22 H N N 352 THR HG23 H N N 353 THR HXT H N N 354 TRP N N N N 355 TRP CA C N S 356 TRP C C N N 357 TRP O O N N 358 TRP CB C N N 359 TRP CG C Y N 360 TRP CD1 C Y N 361 TRP CD2 C Y N 362 TRP NE1 N Y N 363 TRP CE2 C Y N 364 TRP CE3 C Y N 365 TRP CZ2 C Y N 366 TRP CZ3 C Y N 367 TRP CH2 C Y N 368 TRP OXT O N N 369 TRP H H N N 370 TRP H2 H N N 371 TRP HA H N N 372 TRP HB2 H N N 373 TRP HB3 H N N 374 TRP HD1 H N N 375 TRP HE1 H N N 376 TRP HE3 H N N 377 TRP HZ2 H N N 378 TRP HZ3 H N N 379 TRP HH2 H N N 380 TRP HXT H N N 381 TYR N N N N 382 TYR CA C N S 383 TYR C C N N 384 TYR O O N N 385 TYR CB C N N 386 TYR CG C Y N 387 TYR CD1 C Y N 388 TYR CD2 C Y N 389 TYR CE1 C Y N 390 TYR CE2 C Y N 391 TYR CZ C Y N 392 TYR OH O N N 393 TYR OXT O N N 394 TYR H H N N 395 TYR H2 H N N 396 TYR HA H N N 397 TYR HB2 H N N 398 TYR HB3 H N N 399 TYR HD1 H N N 400 TYR HD2 H N N 401 TYR HE1 H N N 402 TYR HE2 H N N 403 TYR HH H N N 404 TYR HXT H N N 405 VAL N N N N 406 VAL CA C N S 407 VAL C C N N 408 VAL O O N N 409 VAL CB C N N 410 VAL CG1 C N N 411 VAL CG2 C N N 412 VAL OXT O N N 413 VAL H H N N 414 VAL H2 H N N 415 VAL HA H N N 416 VAL HB H N N 417 VAL HG11 H N N 418 VAL HG12 H N N 419 VAL HG13 H N N 420 VAL HG21 H N N 421 VAL HG22 H N N 422 VAL HG23 H N N 423 VAL HXT H N N 424 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 RIS O12 P9 sing N N 277 RIS O12 H12 sing N N 278 RIS P9 O11 doub N N 279 RIS P9 O10 sing N N 280 RIS P9 C8 sing N N 281 RIS C8 O13 sing N N 282 RIS C8 P14 sing N N 283 RIS C8 C7 sing N N 284 RIS O13 H13 sing N N 285 RIS P14 O16 sing N N 286 RIS P14 O15 sing N N 287 RIS P14 O17 doub N N 288 RIS O16 H16 sing N N 289 RIS O15 H15 sing N N 290 RIS C7 C2 sing N N 291 RIS C7 HC71 sing N N 292 RIS C7 HC72 sing N N 293 RIS C2 C1 doub Y N 294 RIS C2 C3 sing Y N 295 RIS C1 C6 sing Y N 296 RIS C1 HC1 sing N N 297 RIS C6 C5 doub Y N 298 RIS C6 HC6 sing N N 299 RIS C5 N4 sing Y N 300 RIS C5 HC5 sing N N 301 RIS N4 C3 doub Y N 302 RIS C3 HC3 sing N N 303 RIS HO1 O10 sing N N 304 SER N CA sing N N 305 SER N H sing N N 306 SER N H2 sing N N 307 SER CA C sing N N 308 SER CA CB sing N N 309 SER CA HA sing N N 310 SER C O doub N N 311 SER C OXT sing N N 312 SER CB OG sing N N 313 SER CB HB2 sing N N 314 SER CB HB3 sing N N 315 SER OG HG sing N N 316 SER OXT HXT sing N N 317 SO4 S O1 doub N N 318 SO4 S O2 doub N N 319 SO4 S O3 sing N N 320 SO4 S O4 sing N N 321 THR N CA sing N N 322 THR N H sing N N 323 THR N H2 sing N N 324 THR CA C sing N N 325 THR CA CB sing N N 326 THR CA HA sing N N 327 THR C O doub N N 328 THR C OXT sing N N 329 THR CB OG1 sing N N 330 THR CB CG2 sing N N 331 THR CB HB sing N N 332 THR OG1 HG1 sing N N 333 THR CG2 HG21 sing N N 334 THR CG2 HG22 sing N N 335 THR CG2 HG23 sing N N 336 THR OXT HXT sing N N 337 TRP N CA sing N N 338 TRP N H sing N N 339 TRP N H2 sing N N 340 TRP CA C sing N N 341 TRP CA CB sing N N 342 TRP CA HA sing N N 343 TRP C O doub N N 344 TRP C OXT sing N N 345 TRP CB CG sing N N 346 TRP CB HB2 sing N N 347 TRP CB HB3 sing N N 348 TRP CG CD1 doub Y N 349 TRP CG CD2 sing Y N 350 TRP CD1 NE1 sing Y N 351 TRP CD1 HD1 sing N N 352 TRP CD2 CE2 doub Y N 353 TRP CD2 CE3 sing Y N 354 TRP NE1 CE2 sing Y N 355 TRP NE1 HE1 sing N N 356 TRP CE2 CZ2 sing Y N 357 TRP CE3 CZ3 doub Y N 358 TRP CE3 HE3 sing N N 359 TRP CZ2 CH2 doub Y N 360 TRP CZ2 HZ2 sing N N 361 TRP CZ3 CH2 sing Y N 362 TRP CZ3 HZ3 sing N N 363 TRP CH2 HH2 sing N N 364 TRP OXT HXT sing N N 365 TYR N CA sing N N 366 TYR N H sing N N 367 TYR N H2 sing N N 368 TYR CA C sing N N 369 TYR CA CB sing N N 370 TYR CA HA sing N N 371 TYR C O doub N N 372 TYR C OXT sing N N 373 TYR CB CG sing N N 374 TYR CB HB2 sing N N 375 TYR CB HB3 sing N N 376 TYR CG CD1 doub Y N 377 TYR CG CD2 sing Y N 378 TYR CD1 CE1 sing Y N 379 TYR CD1 HD1 sing N N 380 TYR CD2 CE2 doub Y N 381 TYR CD2 HD2 sing N N 382 TYR CE1 CZ doub Y N 383 TYR CE1 HE1 sing N N 384 TYR CE2 CZ sing Y N 385 TYR CE2 HE2 sing N N 386 TYR CZ OH sing N N 387 TYR OH HH sing N N 388 TYR OXT HXT sing N N 389 VAL N CA sing N N 390 VAL N H sing N N 391 VAL N H2 sing N N 392 VAL CA C sing N N 393 VAL CA CB sing N N 394 VAL CA HA sing N N 395 VAL C O doub N N 396 VAL C OXT sing N N 397 VAL CB CG1 sing N N 398 VAL CB CG2 sing N N 399 VAL CB HB sing N N 400 VAL CG1 HG11 sing N N 401 VAL CG1 HG12 sing N N 402 VAL CG1 HG13 sing N N 403 VAL CG2 HG21 sing N N 404 VAL CG2 HG22 sing N N 405 VAL CG2 HG23 sing N N 406 VAL OXT HXT sing N N 407 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '1-HYDROXY-2-(3-PYRIDINYL)ETHYLIDENE BIS-PHOSPHONIC ACID' RIS 3 'MAGNESIUM ION' MG 4 'SULFATE ION' SO4 5 water HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3CP6 _pdbx_initial_refinement_model.details ? #