data_4Q3J # _entry.id 4Q3J # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.279 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4Q3J RCSB RCSB085558 WWPDB D_1000085558 # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4Q3J _pdbx_database_status.recvd_initial_deposition_date 2014-04-11 _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.SG_entry ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Sousa, M.C.' 1 'Turco, M.M.' 2 # _citation.id primary _citation.title ;The Structure and Specificity of the Type III Secretion System Effector NleC Suggest a DNA Mimicry Mechanism of Substrate Recognition. ; _citation.journal_abbrev Biochemistry _citation.journal_volume 53 _citation.page_first 5131 _citation.page_last 5139 _citation.year 2014 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 25040221 _citation.pdbx_database_id_DOI 10.1021/bi500593e # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal primary 'Turco, M.M.' 1 primary 'Sousa, M.C.' 2 # _cell.entry_id 4Q3J _cell.length_a 45.205 _cell.length_b 67.480 _cell.length_c 81.688 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 4 _cell.pdbx_unique_axis ? _cell.length_a_esd ? _cell.length_b_esd ? _cell.length_c_esd ? _cell.angle_alpha_esd ? _cell.angle_beta_esd ? _cell.angle_gamma_esd ? # _symmetry.entry_id 4Q3J _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'NFkB-p65-degrading zinc protease family protein' 37388.914 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer syn 'MAGNESIUM ION' 24.305 1 ? ? ? ? 4 water nat water 18.015 186 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKIPSLQSNFNFSAPAGYSAPIAPNRAENAYADYVLDIGKRIPLSAADLSNVYESVIRAVHDSRSRLIDQHTVDMIGNTV LDALSRSQTFRDAVSYGIHNEKVHIGCIKYRNEYELNEESSVKIDDIQSLTCNELYEYDVGQEPIFPICEAGENDNEEPY VSFSVAPDTDSYEMPSWQEGLIHEIIHHVTGSSDPSGDSNIELGPTEILARRVAQELGWSVPDFKGYAEPEREAHLRLRN LNALRQAAMRHEENERAFFERLGTISDRYEASPDFTEYSAVSNIGYGFIQQHDFPGLAINDNLQDANQIQLYHGAPYIFT FGDVDKHNQQPG ; _entity_poly.pdbx_seq_one_letter_code_can ;MKIPSLQSNFNFSAPAGYSAPIAPNRAENAYADYVLDIGKRIPLSAADLSNVYESVIRAVHDSRSRLIDQHTVDMIGNTV LDALSRSQTFRDAVSYGIHNEKVHIGCIKYRNEYELNEESSVKIDDIQSLTCNELYEYDVGQEPIFPICEAGENDNEEPY VSFSVAPDTDSYEMPSWQEGLIHEIIHHVTGSSDPSGDSNIELGPTEILARRVAQELGWSVPDFKGYAEPEREAHLRLRN LNALRQAAMRHEENERAFFERLGTISDRYEASPDFTEYSAVSNIGYGFIQQHDFPGLAINDNLQDANQIQLYHGAPYIFT FGDVDKHNQQPG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ILE n 1 4 PRO n 1 5 SER n 1 6 LEU n 1 7 GLN n 1 8 SER n 1 9 ASN n 1 10 PHE n 1 11 ASN n 1 12 PHE n 1 13 SER n 1 14 ALA n 1 15 PRO n 1 16 ALA n 1 17 GLY n 1 18 TYR n 1 19 SER n 1 20 ALA n 1 21 PRO n 1 22 ILE n 1 23 ALA n 1 24 PRO n 1 25 ASN n 1 26 ARG n 1 27 ALA n 1 28 GLU n 1 29 ASN n 1 30 ALA n 1 31 TYR n 1 32 ALA n 1 33 ASP n 1 34 TYR n 1 35 VAL n 1 36 LEU n 1 37 ASP n 1 38 ILE n 1 39 GLY n 1 40 LYS n 1 41 ARG n 1 42 ILE n 1 43 PRO n 1 44 LEU n 1 45 SER n 1 46 ALA n 1 47 ALA n 1 48 ASP n 1 49 LEU n 1 50 SER n 1 51 ASN n 1 52 VAL n 1 53 TYR n 1 54 GLU n 1 55 SER n 1 56 VAL n 1 57 ILE n 1 58 ARG n 1 59 ALA n 1 60 VAL n 1 61 HIS n 1 62 ASP n 1 63 SER n 1 64 ARG n 1 65 SER n 1 66 ARG n 1 67 LEU n 1 68 ILE n 1 69 ASP n 1 70 GLN n 1 71 HIS n 1 72 THR n 1 73 VAL n 1 74 ASP n 1 75 MET n 1 76 ILE n 1 77 GLY n 1 78 ASN n 1 79 THR n 1 80 VAL n 1 81 LEU n 1 82 ASP n 1 83 ALA n 1 84 LEU n 1 85 SER n 1 86 ARG n 1 87 SER n 1 88 GLN n 1 89 THR n 1 90 PHE n 1 91 ARG n 1 92 ASP n 1 93 ALA n 1 94 VAL n 1 95 SER n 1 96 TYR n 1 97 GLY n 1 98 ILE n 1 99 HIS n 1 100 ASN n 1 101 GLU n 1 102 LYS n 1 103 VAL n 1 104 HIS n 1 105 ILE n 1 106 GLY n 1 107 CYS n 1 108 ILE n 1 109 LYS n 1 110 TYR n 1 111 ARG n 1 112 ASN n 1 113 GLU n 1 114 TYR n 1 115 GLU n 1 116 LEU n 1 117 ASN n 1 118 GLU n 1 119 GLU n 1 120 SER n 1 121 SER n 1 122 VAL n 1 123 LYS n 1 124 ILE n 1 125 ASP n 1 126 ASP n 1 127 ILE n 1 128 GLN n 1 129 SER n 1 130 LEU n 1 131 THR n 1 132 CYS n 1 133 ASN n 1 134 GLU n 1 135 LEU n 1 136 TYR n 1 137 GLU n 1 138 TYR n 1 139 ASP n 1 140 VAL n 1 141 GLY n 1 142 GLN n 1 143 GLU n 1 144 PRO n 1 145 ILE n 1 146 PHE n 1 147 PRO n 1 148 ILE n 1 149 CYS n 1 150 GLU n 1 151 ALA n 1 152 GLY n 1 153 GLU n 1 154 ASN n 1 155 ASP n 1 156 ASN n 1 157 GLU n 1 158 GLU n 1 159 PRO n 1 160 TYR n 1 161 VAL n 1 162 SER n 1 163 PHE n 1 164 SER n 1 165 VAL n 1 166 ALA n 1 167 PRO n 1 168 ASP n 1 169 THR n 1 170 ASP n 1 171 SER n 1 172 TYR n 1 173 GLU n 1 174 MET n 1 175 PRO n 1 176 SER n 1 177 TRP n 1 178 GLN n 1 179 GLU n 1 180 GLY n 1 181 LEU n 1 182 ILE n 1 183 HIS n 1 184 GLU n 1 185 ILE n 1 186 ILE n 1 187 HIS n 1 188 HIS n 1 189 VAL n 1 190 THR n 1 191 GLY n 1 192 SER n 1 193 SER n 1 194 ASP n 1 195 PRO n 1 196 SER n 1 197 GLY n 1 198 ASP n 1 199 SER n 1 200 ASN n 1 201 ILE n 1 202 GLU n 1 203 LEU n 1 204 GLY n 1 205 PRO n 1 206 THR n 1 207 GLU n 1 208 ILE n 1 209 LEU n 1 210 ALA n 1 211 ARG n 1 212 ARG n 1 213 VAL n 1 214 ALA n 1 215 GLN n 1 216 GLU n 1 217 LEU n 1 218 GLY n 1 219 TRP n 1 220 SER n 1 221 VAL n 1 222 PRO n 1 223 ASP n 1 224 PHE n 1 225 LYS n 1 226 GLY n 1 227 TYR n 1 228 ALA n 1 229 GLU n 1 230 PRO n 1 231 GLU n 1 232 ARG n 1 233 GLU n 1 234 ALA n 1 235 HIS n 1 236 LEU n 1 237 ARG n 1 238 LEU n 1 239 ARG n 1 240 ASN n 1 241 LEU n 1 242 ASN n 1 243 ALA n 1 244 LEU n 1 245 ARG n 1 246 GLN n 1 247 ALA n 1 248 ALA n 1 249 MET n 1 250 ARG n 1 251 HIS n 1 252 GLU n 1 253 GLU n 1 254 ASN n 1 255 GLU n 1 256 ARG n 1 257 ALA n 1 258 PHE n 1 259 PHE n 1 260 GLU n 1 261 ARG n 1 262 LEU n 1 263 GLY n 1 264 THR n 1 265 ILE n 1 266 SER n 1 267 ASP n 1 268 ARG n 1 269 TYR n 1 270 GLU n 1 271 ALA n 1 272 SER n 1 273 PRO n 1 274 ASP n 1 275 PHE n 1 276 THR n 1 277 GLU n 1 278 TYR n 1 279 SER n 1 280 ALA n 1 281 VAL n 1 282 SER n 1 283 ASN n 1 284 ILE n 1 285 GLY n 1 286 TYR n 1 287 GLY n 1 288 PHE n 1 289 ILE n 1 290 GLN n 1 291 GLN n 1 292 HIS n 1 293 ASP n 1 294 PHE n 1 295 PRO n 1 296 GLY n 1 297 LEU n 1 298 ALA n 1 299 ILE n 1 300 ASN n 1 301 ASP n 1 302 ASN n 1 303 LEU n 1 304 GLN n 1 305 ASP n 1 306 ALA n 1 307 ASN n 1 308 GLN n 1 309 ILE n 1 310 GLN n 1 311 LEU n 1 312 TYR n 1 313 HIS n 1 314 GLY n 1 315 ALA n 1 316 PRO n 1 317 TYR n 1 318 ILE n 1 319 PHE n 1 320 THR n 1 321 PHE n 1 322 GLY n 1 323 ASP n 1 324 VAL n 1 325 ASP n 1 326 LYS n 1 327 HIS n 1 328 ASN n 1 329 GLN n 1 330 GLN n 1 331 PRO n 1 332 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene S1M_1031 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain Sakai _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 386585 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code U1C6A4_ECOLX _struct_ref.pdbx_db_accession U1C6A4 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKIPSLQSNFNFSAPAGYSAPIAPNRAENAYADYVLDIGKRIPLSAADLSNVYESVIRAVHDSRSRLIDQHTVDMIGNTV LDALSRSQTFRDAVSYGIHNEKVHIGCIKYRNEYELNEESSVKIDDIQSLTCNELYEYDVGQEPIFPICEAGENDNEEPY VSFSVAPDTDSYEMPSWQEGLIHEIIHHVTGSSDPSGDSNIELGPTEILARRVAQELGWSVPDFKGYAEPEREAHLRLRN LNALRQAAMRHEENERAFFERLGTISDRYEASPDFTEYSAVSNIGYGFIQQHDFPGLAINDNLQDANQIQLYHGAPYIFT FGDVDKHNQQ ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4Q3J _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 330 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession U1C6A4 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 330 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 330 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4Q3J PRO A 331 ? UNP U1C6A4 ? ? 'EXPRESSION TAG' 331 1 1 4Q3J GLY A 332 ? UNP U1C6A4 ? ? 'EXPRESSION TAG' 332 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MG non-polymer . 'MAGNESIUM ION' ? 'Mg 2' 24.305 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.entry_id 4Q3J _exptl.method 'X-RAY DIFFRACTION' _exptl.crystals_number 1 # _exptl_crystal.id 1 _exptl_crystal.density_meas ? _exptl_crystal.density_Matthews 1.67 _exptl_crystal.density_percent_sol 26.18 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.preparation ? # _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.temp 289 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.pH 6.0 _exptl_crystal_grow.pdbx_details '10% PEG-3350, 50 mM Mg(CHO2)2, 0.1 M MES pH 6.0, VAPOR DIFFUSION, SITTING DROP, temperature 289K' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.id 1 _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.crystal_id 1 # _diffrn_detector.diffrn_id 1 _diffrn_detector.detector CCD _diffrn_detector.type 'ADSC QUANTUM 4' _diffrn_detector.pdbx_collection_date 2011-10-06 _diffrn_detector.details ? # _diffrn_radiation.diffrn_id 1 _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.monochromator crystal _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 1.2574 1.0 2 1.2831 1.0 3 1.2835 1.0 # _diffrn_source.diffrn_id 1 _diffrn_source.source SYNCHROTRON _diffrn_source.type 'ALS BEAMLINE 8.2.1' _diffrn_source.pdbx_synchrotron_site ALS _diffrn_source.pdbx_synchrotron_beamline 8.2.1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_wavelength_list 1.2574,1.2831,1.2835 # _reflns.entry_id 4Q3J _reflns.observed_criterion_sigma_I 0 _reflns.observed_criterion_sigma_F 0 _reflns.d_resolution_low 50.0 _reflns.d_resolution_high 1.862 _reflns.number_obs 19840 _reflns.number_all 21559 _reflns.percent_possible_obs 96.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_sigmaI ? _reflns.B_iso_Wilson_estimate ? _reflns.pdbx_redundancy ? _reflns.R_free_details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_ordinal 1 _reflns.pdbx_diffrn_id 1 # _refine.entry_id 4Q3J _refine.ls_number_reflns_obs 19840 _refine.ls_number_reflns_all 21559 _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 34.942 _refine.ls_d_res_high 1.862 _refine.ls_percent_reflns_obs 91.98 _refine.ls_R_factor_obs 0.1833 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1795 _refine.ls_R_factor_R_free 0.2181 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 9.60 _refine.ls_number_reflns_R_free 1905 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] -0.9042 _refine.aniso_B[2][2] -5.6521 _refine.aniso_B[3][3] 6.5563 _refine.aniso_B[1][2] -0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][3] -0.0000 _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol 0.364 _refine.solvent_model_param_bsol 30.619 _refine.pdbx_solvent_vdw_probe_radii 1.10 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.83 _refine.pdbx_ls_cross_valid_method ? _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct MAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values MLHL _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details Random _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.45 _refine.pdbx_overall_phase_error 22.18 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.ls_redundancy_reflns_obs ? _refine.B_iso_min ? _refine.B_iso_max ? _refine.overall_SU_R_free ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_diffrn_id 1 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2067 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 2 _refine_hist.number_atoms_solvent 186 _refine_hist.number_atoms_total 2255 _refine_hist.d_res_high 1.862 _refine_hist.d_res_low 34.942 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_restraint_function _refine_ls_restr.pdbx_refine_id f_bond_d 0.014 ? ? 2116 ? 'X-RAY DIFFRACTION' f_angle_d 0.993 ? ? 2877 ? 'X-RAY DIFFRACTION' f_dihedral_angle_d 13.103 ? ? 786 ? 'X-RAY DIFFRACTION' f_chiral_restr 0.070 ? ? 307 ? 'X-RAY DIFFRACTION' f_plane_restr 0.003 ? ? 388 ? 'X-RAY DIFFRACTION' # loop_ _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.pdbx_refine_id . 1.8619 1.9085 1051 0.3201 77.00 0.4117 . . 109 . . . . 'X-RAY DIFFRACTION' . 1.9085 1.9600 1173 0.2540 85.00 0.3128 . . 119 . . . . 'X-RAY DIFFRACTION' . 1.9600 2.0177 1254 0.2149 92.00 0.2749 . . 133 . . . . 'X-RAY DIFFRACTION' . 2.0177 2.0828 1273 0.2208 92.00 0.2832 . . 137 . . . . 'X-RAY DIFFRACTION' . 2.0828 2.1573 1316 0.1856 96.00 0.2334 . . 143 . . . . 'X-RAY DIFFRACTION' . 2.1573 2.2436 1275 0.2107 93.00 0.2717 . . 135 . . . . 'X-RAY DIFFRACTION' . 2.2436 2.3457 1295 0.1836 94.00 0.2509 . . 137 . . . . 'X-RAY DIFFRACTION' . 2.3457 2.4694 1328 0.1813 96.00 0.2529 . . 141 . . . . 'X-RAY DIFFRACTION' . 2.4694 2.6240 1342 0.1654 96.00 0.2019 . . 144 . . . . 'X-RAY DIFFRACTION' . 2.6240 2.8265 1346 0.1688 96.00 0.1935 . . 141 . . . . 'X-RAY DIFFRACTION' . 2.8265 3.1108 1309 0.1740 95.00 0.2058 . . 141 . . . . 'X-RAY DIFFRACTION' . 3.1108 3.5606 1323 0.1670 94.00 0.2224 . . 142 . . . . 'X-RAY DIFFRACTION' . 3.5606 4.4845 1317 0.1473 92.00 0.1902 . . 141 . . . . 'X-RAY DIFFRACTION' . 4.4845 34.9480 1333 0.1634 88.00 0.1495 . . 142 . . . . 'X-RAY DIFFRACTION' # _struct.entry_id 4Q3J _struct.title 'Crystal structure of NFkB-p65-degrading zinc protease family protein' _struct.pdbx_descriptor 'NFkB-p65-degrading zinc protease family protein' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4Q3J _struct_keywords.pdbx_keywords HYDROLASE _struct_keywords.text 'hydrolase, alpha beta, cytosol' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_biol.id 1 _struct_biol.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 1 ASN A 29 ? LYS A 40 ? ASN A 29 LYS A 40 1 ? 12 HELX_P HELX_P2 2 SER A 45 ? ASP A 62 ? SER A 45 ASP A 62 1 ? 18 HELX_P HELX_P3 3 SER A 63 ? LEU A 67 ? SER A 63 LEU A 67 5 ? 5 HELX_P HELX_P4 4 ASP A 69 ? SER A 87 ? ASP A 69 SER A 87 1 ? 19 HELX_P HELX_P5 5 SER A 87 ? ASN A 100 ? SER A 87 ASN A 100 1 ? 14 HELX_P HELX_P6 6 HIS A 104 ? ILE A 108 ? HIS A 104 ILE A 108 5 ? 5 HELX_P HELX_P7 7 ASP A 126 ? LEU A 130 ? ASP A 126 LEU A 130 5 ? 5 HELX_P HELX_P8 8 THR A 131 ? GLU A 137 ? THR A 131 GLU A 137 1 ? 7 HELX_P HELX_P9 9 GLU A 173 ? GLY A 191 ? GLU A 173 GLY A 191 1 ? 19 HELX_P HELX_P10 10 GLY A 204 ? GLY A 218 ? GLY A 204 GLY A 218 1 ? 15 HELX_P HELX_P11 11 GLU A 229 ? HIS A 251 ? GLU A 229 HIS A 251 1 ? 23 HELX_P HELX_P12 12 ASN A 254 ? ASP A 267 ? ASN A 254 ASP A 267 1 ? 14 HELX_P HELX_P13 13 PHE A 275 ? SER A 279 ? PHE A 275 SER A 279 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order metalc1 metalc ? ? A HIS 183 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 183 A ZN 401 1_555 ? ? ? ? ? ? ? 2.017 ? metalc2 metalc ? ? A ASP 194 OD2 ? ? ? 1_555 B ZN . ZN ? ? A ASP 194 A ZN 401 1_555 ? ? ? ? ? ? ? 2.051 ? metalc3 metalc ? ? A HIS 187 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 187 A ZN 401 1_555 ? ? ? ? ? ? ? 2.117 ? metalc4 metalc ? ? A TYR 227 OH ? ? ? 1_555 B ZN . ZN ? ? A TYR 227 A ZN 401 1_555 ? ? ? ? ? ? ? 2.289 ? metalc5 metalc ? ? A ASP 194 OD1 ? ? ? 1_555 B ZN . ZN ? ? A ASP 194 A ZN 401 1_555 ? ? ? ? ? ? ? 2.361 ? metalc6 metalc ? ? B ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 401 A HOH 529 1_555 ? ? ? ? ? ? ? 2.364 ? metalc7 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 402 A HOH 626 1_555 ? ? ? ? ? ? ? 2.553 ? metalc8 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 402 A HOH 625 1_555 ? ? ? ? ? ? ? 2.571 ? metalc9 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 402 A HOH 628 1_555 ? ? ? ? ? ? ? 2.582 ? metalc10 metalc ? ? C MG . MG ? ? ? 1_555 D HOH . O ? ? A MG 402 A HOH 629 1_555 ? ? ? ? ? ? ? 2.723 ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details A ? 3 ? B ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense A 1 2 ? parallel A 2 3 ? anti-parallel B 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id A 1 LYS A 109 ? ARG A 111 ? LYS A 109 ARG A 111 A 2 PRO A 159 ? SER A 162 ? PRO A 159 SER A 162 A 3 GLU A 150 ? GLU A 153 ? GLU A 150 GLU A 153 B 1 TYR A 114 ? LEU A 116 ? TYR A 114 LEU A 116 B 2 ILE A 145 ? PRO A 147 ? ILE A 145 PRO A 147 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id A 1 2 N ARG A 111 ? N ARG A 111 O VAL A 161 ? O VAL A 161 A 2 3 O TYR A 160 ? O TYR A 160 N GLY A 152 ? N GLY A 152 B 1 2 N GLU A 115 ? N GLU A 115 O PHE A 146 ? O PHE A 146 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software ? ? ? ? 5 'BINDING SITE FOR RESIDUE ZN A 401' AC2 Software ? ? ? ? 4 'BINDING SITE FOR RESIDUE MG A 402' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 5 HIS A 183 ? HIS A 183 . ? 1_555 ? 2 AC1 5 HIS A 187 ? HIS A 187 . ? 1_555 ? 3 AC1 5 ASP A 194 ? ASP A 194 . ? 1_555 ? 4 AC1 5 TYR A 227 ? TYR A 227 . ? 1_555 ? 5 AC1 5 HOH D . ? HOH A 529 . ? 1_555 ? 6 AC2 4 HOH D . ? HOH A 625 . ? 1_555 ? 7 AC2 4 HOH D . ? HOH A 626 . ? 1_555 ? 8 AC2 4 HOH D . ? HOH A 628 . ? 1_555 ? 9 AC2 4 HOH D . ? HOH A 629 . ? 1_555 ? # _database_PDB_matrix.entry_id 4Q3J _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4Q3J _atom_sites.fract_transf_matrix[1][1] 0.022121 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014819 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.012242 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C MG N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 ILE 3 3 ? ? ? A . n A 1 4 PRO 4 4 ? ? ? A . n A 1 5 SER 5 5 ? ? ? A . n A 1 6 LEU 6 6 ? ? ? A . n A 1 7 GLN 7 7 ? ? ? A . n A 1 8 SER 8 8 ? ? ? A . n A 1 9 ASN 9 9 ? ? ? A . n A 1 10 PHE 10 10 ? ? ? A . n A 1 11 ASN 11 11 ? ? ? A . n A 1 12 PHE 12 12 ? ? ? A . n A 1 13 SER 13 13 ? ? ? A . n A 1 14 ALA 14 14 ? ? ? A . n A 1 15 PRO 15 15 ? ? ? A . n A 1 16 ALA 16 16 ? ? ? A . n A 1 17 GLY 17 17 ? ? ? A . n A 1 18 TYR 18 18 ? ? ? A . n A 1 19 SER 19 19 ? ? ? A . n A 1 20 ALA 20 20 ? ? ? A . n A 1 21 PRO 21 21 ? ? ? A . n A 1 22 ILE 22 22 22 ILE ILE A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 PRO 24 24 24 PRO PRO A . n A 1 25 ASN 25 25 25 ASN ASN A . n A 1 26 ARG 26 26 26 ARG ARG A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 GLU 28 28 28 GLU GLU A . n A 1 29 ASN 29 29 29 ASN ASN A . n A 1 30 ALA 30 30 30 ALA ALA A . n A 1 31 TYR 31 31 31 TYR TYR A . n A 1 32 ALA 32 32 32 ALA ALA A . n A 1 33 ASP 33 33 33 ASP ASP A . n A 1 34 TYR 34 34 34 TYR TYR A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 LEU 36 36 36 LEU LEU A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 ILE 38 38 38 ILE ILE A . n A 1 39 GLY 39 39 39 GLY GLY A . n A 1 40 LYS 40 40 40 LYS LYS A . n A 1 41 ARG 41 41 41 ARG ARG A . n A 1 42 ILE 42 42 42 ILE ILE A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 SER 45 45 45 SER SER A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 ALA 47 47 47 ALA ALA A . n A 1 48 ASP 48 48 48 ASP ASP A . n A 1 49 LEU 49 49 49 LEU LEU A . n A 1 50 SER 50 50 50 SER SER A . n A 1 51 ASN 51 51 51 ASN ASN A . n A 1 52 VAL 52 52 52 VAL VAL A . n A 1 53 TYR 53 53 53 TYR TYR A . n A 1 54 GLU 54 54 54 GLU GLU A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 VAL 56 56 56 VAL VAL A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 ARG 58 58 58 ARG ARG A . n A 1 59 ALA 59 59 59 ALA ALA A . n A 1 60 VAL 60 60 60 VAL VAL A . n A 1 61 HIS 61 61 61 HIS HIS A . n A 1 62 ASP 62 62 62 ASP ASP A . n A 1 63 SER 63 63 63 SER SER A . n A 1 64 ARG 64 64 64 ARG ARG A . n A 1 65 SER 65 65 65 SER SER A . n A 1 66 ARG 66 66 66 ARG ARG A . n A 1 67 LEU 67 67 67 LEU LEU A . n A 1 68 ILE 68 68 68 ILE ILE A . n A 1 69 ASP 69 69 69 ASP ASP A . n A 1 70 GLN 70 70 70 GLN GLN A . n A 1 71 HIS 71 71 71 HIS HIS A . n A 1 72 THR 72 72 72 THR THR A . n A 1 73 VAL 73 73 73 VAL VAL A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 MET 75 75 75 MET MET A . n A 1 76 ILE 76 76 76 ILE ILE A . n A 1 77 GLY 77 77 77 GLY GLY A . n A 1 78 ASN 78 78 78 ASN ASN A . n A 1 79 THR 79 79 79 THR THR A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 LEU 81 81 81 LEU LEU A . n A 1 82 ASP 82 82 82 ASP ASP A . n A 1 83 ALA 83 83 83 ALA ALA A . n A 1 84 LEU 84 84 84 LEU LEU A . n A 1 85 SER 85 85 85 SER SER A . n A 1 86 ARG 86 86 86 ARG ARG A . n A 1 87 SER 87 87 87 SER SER A . n A 1 88 GLN 88 88 88 GLN GLN A . n A 1 89 THR 89 89 89 THR THR A . n A 1 90 PHE 90 90 90 PHE PHE A . n A 1 91 ARG 91 91 91 ARG ARG A . n A 1 92 ASP 92 92 92 ASP ASP A . n A 1 93 ALA 93 93 93 ALA ALA A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 SER 95 95 95 SER SER A . n A 1 96 TYR 96 96 96 TYR TYR A . n A 1 97 GLY 97 97 97 GLY GLY A . n A 1 98 ILE 98 98 98 ILE ILE A . n A 1 99 HIS 99 99 99 HIS HIS A . n A 1 100 ASN 100 100 100 ASN ASN A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 VAL 103 103 103 VAL VAL A . n A 1 104 HIS 104 104 104 HIS HIS A . n A 1 105 ILE 105 105 105 ILE ILE A . n A 1 106 GLY 106 106 106 GLY GLY A . n A 1 107 CYS 107 107 107 CYS CYS A . n A 1 108 ILE 108 108 108 ILE ILE A . n A 1 109 LYS 109 109 109 LYS LYS A . n A 1 110 TYR 110 110 110 TYR TYR A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 ASN 112 112 112 ASN ASN A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 TYR 114 114 114 TYR TYR A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLU 118 118 118 GLU GLU A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 SER 120 120 120 SER SER A . n A 1 121 SER 121 121 121 SER SER A . n A 1 122 VAL 122 122 122 VAL VAL A . n A 1 123 LYS 123 123 123 LYS LYS A . n A 1 124 ILE 124 124 124 ILE ILE A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 ASP 126 126 126 ASP ASP A . n A 1 127 ILE 127 127 127 ILE ILE A . n A 1 128 GLN 128 128 128 GLN GLN A . n A 1 129 SER 129 129 129 SER SER A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 CYS 132 132 132 CYS CYS A . n A 1 133 ASN 133 133 133 ASN ASN A . n A 1 134 GLU 134 134 134 GLU GLU A . n A 1 135 LEU 135 135 135 LEU LEU A . n A 1 136 TYR 136 136 136 TYR TYR A . n A 1 137 GLU 137 137 137 GLU GLU A . n A 1 138 TYR 138 138 138 TYR TYR A . n A 1 139 ASP 139 139 139 ASP ASP A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 GLY 141 141 141 GLY GLY A . n A 1 142 GLN 142 142 142 GLN GLN A . n A 1 143 GLU 143 143 143 GLU GLU A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 PHE 146 146 146 PHE PHE A . n A 1 147 PRO 147 147 147 PRO PRO A . n A 1 148 ILE 148 148 148 ILE ILE A . n A 1 149 CYS 149 149 149 CYS CYS A . n A 1 150 GLU 150 150 150 GLU GLU A . n A 1 151 ALA 151 151 151 ALA ALA A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 GLU 153 153 153 GLU GLU A . n A 1 154 ASN 154 154 154 ASN ASN A . n A 1 155 ASP 155 155 155 ASP ASP A . n A 1 156 ASN 156 156 156 ASN ASN A . n A 1 157 GLU 157 157 157 GLU GLU A . n A 1 158 GLU 158 158 158 GLU GLU A . n A 1 159 PRO 159 159 159 PRO PRO A . n A 1 160 TYR 160 160 160 TYR TYR A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 SER 162 162 162 SER SER A . n A 1 163 PHE 163 163 163 PHE PHE A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 VAL 165 165 165 VAL VAL A . n A 1 166 ALA 166 166 166 ALA ALA A . n A 1 167 PRO 167 167 167 PRO PRO A . n A 1 168 ASP 168 168 168 ASP ASP A . n A 1 169 THR 169 169 169 THR THR A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 SER 171 171 171 SER SER A . n A 1 172 TYR 172 172 172 TYR TYR A . n A 1 173 GLU 173 173 173 GLU GLU A . n A 1 174 MET 174 174 174 MET MET A . n A 1 175 PRO 175 175 175 PRO PRO A . n A 1 176 SER 176 176 176 SER SER A . n A 1 177 TRP 177 177 177 TRP TRP A . n A 1 178 GLN 178 178 178 GLN GLN A . n A 1 179 GLU 179 179 179 GLU GLU A . n A 1 180 GLY 180 180 180 GLY GLY A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 ILE 182 182 182 ILE ILE A . n A 1 183 HIS 183 183 183 HIS HIS A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 ILE 185 185 185 ILE ILE A . n A 1 186 ILE 186 186 186 ILE ILE A . n A 1 187 HIS 187 187 187 HIS HIS A . n A 1 188 HIS 188 188 188 HIS HIS A . n A 1 189 VAL 189 189 189 VAL VAL A . n A 1 190 THR 190 190 190 THR THR A . n A 1 191 GLY 191 191 191 GLY GLY A . n A 1 192 SER 192 192 192 SER SER A . n A 1 193 SER 193 193 193 SER SER A . n A 1 194 ASP 194 194 194 ASP ASP A . n A 1 195 PRO 195 195 195 PRO PRO A . n A 1 196 SER 196 196 196 SER SER A . n A 1 197 GLY 197 197 197 GLY GLY A . n A 1 198 ASP 198 198 198 ASP ASP A . n A 1 199 SER 199 199 199 SER SER A . n A 1 200 ASN 200 200 200 ASN ASN A . n A 1 201 ILE 201 201 201 ILE ILE A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 LEU 203 203 203 LEU LEU A . n A 1 204 GLY 204 204 204 GLY GLY A . n A 1 205 PRO 205 205 205 PRO PRO A . n A 1 206 THR 206 206 206 THR THR A . n A 1 207 GLU 207 207 207 GLU GLU A . n A 1 208 ILE 208 208 208 ILE ILE A . n A 1 209 LEU 209 209 209 LEU LEU A . n A 1 210 ALA 210 210 210 ALA ALA A . n A 1 211 ARG 211 211 211 ARG ARG A . n A 1 212 ARG 212 212 212 ARG ARG A . n A 1 213 VAL 213 213 213 VAL VAL A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 GLN 215 215 215 GLN GLN A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 LEU 217 217 217 LEU LEU A . n A 1 218 GLY 218 218 218 GLY GLY A . n A 1 219 TRP 219 219 219 TRP TRP A . n A 1 220 SER 220 220 220 SER SER A . n A 1 221 VAL 221 221 221 VAL VAL A . n A 1 222 PRO 222 222 222 PRO PRO A . n A 1 223 ASP 223 223 223 ASP ASP A . n A 1 224 PHE 224 224 224 PHE PHE A . n A 1 225 LYS 225 225 225 LYS LYS A . n A 1 226 GLY 226 226 226 GLY GLY A . n A 1 227 TYR 227 227 227 TYR TYR A . n A 1 228 ALA 228 228 228 ALA ALA A . n A 1 229 GLU 229 229 229 GLU GLU A . n A 1 230 PRO 230 230 230 PRO PRO A . n A 1 231 GLU 231 231 231 GLU GLU A . n A 1 232 ARG 232 232 232 ARG ARG A . n A 1 233 GLU 233 233 233 GLU GLU A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 HIS 235 235 235 HIS HIS A . n A 1 236 LEU 236 236 236 LEU LEU A . n A 1 237 ARG 237 237 237 ARG ARG A . n A 1 238 LEU 238 238 238 LEU LEU A . n A 1 239 ARG 239 239 239 ARG ARG A . n A 1 240 ASN 240 240 240 ASN ASN A . n A 1 241 LEU 241 241 241 LEU LEU A . n A 1 242 ASN 242 242 242 ASN ASN A . n A 1 243 ALA 243 243 243 ALA ALA A . n A 1 244 LEU 244 244 244 LEU LEU A . n A 1 245 ARG 245 245 245 ARG ARG A . n A 1 246 GLN 246 246 246 GLN GLN A . n A 1 247 ALA 247 247 247 ALA ALA A . n A 1 248 ALA 248 248 248 ALA ALA A . n A 1 249 MET 249 249 249 MET MET A . n A 1 250 ARG 250 250 250 ARG ARG A . n A 1 251 HIS 251 251 251 HIS HIS A . n A 1 252 GLU 252 252 252 GLU GLU A . n A 1 253 GLU 253 253 253 GLU GLU A . n A 1 254 ASN 254 254 254 ASN ASN A . n A 1 255 GLU 255 255 255 GLU GLU A . n A 1 256 ARG 256 256 256 ARG ARG A . n A 1 257 ALA 257 257 257 ALA ALA A . n A 1 258 PHE 258 258 258 PHE PHE A . n A 1 259 PHE 259 259 259 PHE PHE A . n A 1 260 GLU 260 260 260 GLU GLU A . n A 1 261 ARG 261 261 261 ARG ARG A . n A 1 262 LEU 262 262 262 LEU LEU A . n A 1 263 GLY 263 263 263 GLY GLY A . n A 1 264 THR 264 264 264 THR THR A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 SER 266 266 266 SER SER A . n A 1 267 ASP 267 267 267 ASP ASP A . n A 1 268 ARG 268 268 268 ARG ARG A . n A 1 269 TYR 269 269 269 TYR TYR A . n A 1 270 GLU 270 270 270 GLU GLU A . n A 1 271 ALA 271 271 271 ALA ALA A . n A 1 272 SER 272 272 272 SER SER A . n A 1 273 PRO 273 273 273 PRO PRO A . n A 1 274 ASP 274 274 274 ASP ASP A . n A 1 275 PHE 275 275 275 PHE PHE A . n A 1 276 THR 276 276 276 THR THR A . n A 1 277 GLU 277 277 277 GLU GLU A . n A 1 278 TYR 278 278 278 TYR TYR A . n A 1 279 SER 279 279 279 SER SER A . n A 1 280 ALA 280 280 280 ALA ALA A . n A 1 281 VAL 281 281 ? ? ? A . n A 1 282 SER 282 282 ? ? ? A . n A 1 283 ASN 283 283 ? ? ? A . n A 1 284 ILE 284 284 ? ? ? A . n A 1 285 GLY 285 285 ? ? ? A . n A 1 286 TYR 286 286 ? ? ? A . n A 1 287 GLY 287 287 ? ? ? A . n A 1 288 PHE 288 288 ? ? ? A . n A 1 289 ILE 289 289 ? ? ? A . n A 1 290 GLN 290 290 ? ? ? A . n A 1 291 GLN 291 291 ? ? ? A . n A 1 292 HIS 292 292 ? ? ? A . n A 1 293 ASP 293 293 ? ? ? A . n A 1 294 PHE 294 294 ? ? ? A . n A 1 295 PRO 295 295 ? ? ? A . n A 1 296 GLY 296 296 ? ? ? A . n A 1 297 LEU 297 297 ? ? ? A . n A 1 298 ALA 298 298 ? ? ? A . n A 1 299 ILE 299 299 ? ? ? A . n A 1 300 ASN 300 300 ? ? ? A . n A 1 301 ASP 301 301 ? ? ? A . n A 1 302 ASN 302 302 ? ? ? A . n A 1 303 LEU 303 303 ? ? ? A . n A 1 304 GLN 304 304 ? ? ? A . n A 1 305 ASP 305 305 ? ? ? A . n A 1 306 ALA 306 306 ? ? ? A . n A 1 307 ASN 307 307 ? ? ? A . n A 1 308 GLN 308 308 ? ? ? A . n A 1 309 ILE 309 309 ? ? ? A . n A 1 310 GLN 310 310 ? ? ? A . n A 1 311 LEU 311 311 ? ? ? A . n A 1 312 TYR 312 312 ? ? ? A . n A 1 313 HIS 313 313 ? ? ? A . n A 1 314 GLY 314 314 ? ? ? A . n A 1 315 ALA 315 315 ? ? ? A . n A 1 316 PRO 316 316 ? ? ? A . n A 1 317 TYR 317 317 ? ? ? A . n A 1 318 ILE 318 318 ? ? ? A . n A 1 319 PHE 319 319 ? ? ? A . n A 1 320 THR 320 320 ? ? ? A . n A 1 321 PHE 321 321 ? ? ? A . n A 1 322 GLY 322 322 ? ? ? A . n A 1 323 ASP 323 323 ? ? ? A . n A 1 324 VAL 324 324 ? ? ? A . n A 1 325 ASP 325 325 ? ? ? A . n A 1 326 LYS 326 326 ? ? ? A . n A 1 327 HIS 327 327 ? ? ? A . n A 1 328 ASN 328 328 ? ? ? A . n A 1 329 GLN 329 329 ? ? ? A . n A 1 330 GLN 330 330 ? ? ? A . n A 1 331 PRO 331 331 ? ? ? A . n A 1 332 GLY 332 332 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 401 1 ZN ZN A . C 3 MG 1 402 1 MG MG A . D 4 HOH 1 501 1 HOH HOH A . D 4 HOH 2 502 2 HOH HOH A . D 4 HOH 3 503 3 HOH HOH A . D 4 HOH 4 504 4 HOH HOH A . D 4 HOH 5 505 5 HOH HOH A . D 4 HOH 6 506 6 HOH HOH A . D 4 HOH 7 507 7 HOH HOH A . D 4 HOH 8 508 8 HOH HOH A . D 4 HOH 9 509 9 HOH HOH A . D 4 HOH 10 510 10 HOH HOH A . D 4 HOH 11 511 11 HOH HOH A . D 4 HOH 12 512 12 HOH HOH A . D 4 HOH 13 513 13 HOH HOH A . D 4 HOH 14 514 14 HOH HOH A . D 4 HOH 15 515 15 HOH HOH A . D 4 HOH 16 516 16 HOH HOH A . D 4 HOH 17 517 17 HOH HOH A . D 4 HOH 18 518 18 HOH HOH A . D 4 HOH 19 519 19 HOH HOH A . D 4 HOH 20 520 20 HOH HOH A . D 4 HOH 21 521 21 HOH HOH A . D 4 HOH 22 522 22 HOH HOH A . D 4 HOH 23 523 23 HOH HOH A . D 4 HOH 24 524 24 HOH HOH A . D 4 HOH 25 525 25 HOH HOH A . D 4 HOH 26 526 26 HOH HOH A . D 4 HOH 27 527 27 HOH HOH A . D 4 HOH 28 528 28 HOH HOH A . D 4 HOH 29 529 29 HOH HOH A . D 4 HOH 30 530 30 HOH HOH A . D 4 HOH 31 531 31 HOH HOH A . D 4 HOH 32 532 32 HOH HOH A . D 4 HOH 33 533 33 HOH HOH A . D 4 HOH 34 534 34 HOH HOH A . D 4 HOH 35 535 35 HOH HOH A . D 4 HOH 36 536 36 HOH HOH A . D 4 HOH 37 537 37 HOH HOH A . D 4 HOH 38 538 38 HOH HOH A . D 4 HOH 39 539 39 HOH HOH A . D 4 HOH 40 540 40 HOH HOH A . D 4 HOH 41 541 41 HOH HOH A . D 4 HOH 42 542 42 HOH HOH A . D 4 HOH 43 543 43 HOH HOH A . D 4 HOH 44 544 44 HOH HOH A . D 4 HOH 45 545 45 HOH HOH A . D 4 HOH 46 546 46 HOH HOH A . D 4 HOH 47 547 47 HOH HOH A . D 4 HOH 48 548 48 HOH HOH A . D 4 HOH 49 549 49 HOH HOH A . D 4 HOH 50 550 50 HOH HOH A . D 4 HOH 51 551 51 HOH HOH A . D 4 HOH 52 552 52 HOH HOH A . D 4 HOH 53 553 53 HOH HOH A . D 4 HOH 54 554 54 HOH HOH A . D 4 HOH 55 555 55 HOH HOH A . D 4 HOH 56 556 56 HOH HOH A . D 4 HOH 57 557 57 HOH HOH A . D 4 HOH 58 558 58 HOH HOH A . D 4 HOH 59 559 59 HOH HOH A . D 4 HOH 60 560 60 HOH HOH A . D 4 HOH 61 561 61 HOH HOH A . D 4 HOH 62 562 62 HOH HOH A . D 4 HOH 63 563 63 HOH HOH A . D 4 HOH 64 564 64 HOH HOH A . D 4 HOH 65 565 65 HOH HOH A . D 4 HOH 66 566 66 HOH HOH A . D 4 HOH 67 567 67 HOH HOH A . D 4 HOH 68 568 68 HOH HOH A . D 4 HOH 69 569 69 HOH HOH A . D 4 HOH 70 570 70 HOH HOH A . D 4 HOH 71 571 71 HOH HOH A . D 4 HOH 72 572 72 HOH HOH A . D 4 HOH 73 573 73 HOH HOH A . D 4 HOH 74 574 74 HOH HOH A . D 4 HOH 75 575 75 HOH HOH A . D 4 HOH 76 576 76 HOH HOH A . D 4 HOH 77 577 77 HOH HOH A . D 4 HOH 78 578 78 HOH HOH A . D 4 HOH 79 579 79 HOH HOH A . D 4 HOH 80 580 80 HOH HOH A . D 4 HOH 81 581 81 HOH HOH A . D 4 HOH 82 582 82 HOH HOH A . D 4 HOH 83 583 83 HOH HOH A . D 4 HOH 84 584 84 HOH HOH A . D 4 HOH 85 585 85 HOH HOH A . D 4 HOH 86 586 86 HOH HOH A . D 4 HOH 87 587 87 HOH HOH A . D 4 HOH 88 588 88 HOH HOH A . D 4 HOH 89 589 89 HOH HOH A . D 4 HOH 90 590 90 HOH HOH A . D 4 HOH 91 591 91 HOH HOH A . D 4 HOH 92 592 92 HOH HOH A . D 4 HOH 93 593 93 HOH HOH A . D 4 HOH 94 594 94 HOH HOH A . D 4 HOH 95 595 95 HOH HOH A . D 4 HOH 96 596 96 HOH HOH A . D 4 HOH 97 597 97 HOH HOH A . D 4 HOH 98 598 98 HOH HOH A . D 4 HOH 99 599 99 HOH HOH A . D 4 HOH 100 600 100 HOH HOH A . D 4 HOH 101 601 101 HOH HOH A . D 4 HOH 102 602 102 HOH HOH A . D 4 HOH 103 603 103 HOH HOH A . D 4 HOH 104 604 104 HOH HOH A . D 4 HOH 105 605 105 HOH HOH A . D 4 HOH 106 606 106 HOH HOH A . D 4 HOH 107 607 107 HOH HOH A . D 4 HOH 108 608 108 HOH HOH A . D 4 HOH 109 609 109 HOH HOH A . D 4 HOH 110 610 110 HOH HOH A . D 4 HOH 111 611 111 HOH HOH A . D 4 HOH 112 612 112 HOH HOH A . D 4 HOH 113 613 113 HOH HOH A . D 4 HOH 114 614 114 HOH HOH A . D 4 HOH 115 615 115 HOH HOH A . D 4 HOH 116 616 116 HOH HOH A . D 4 HOH 117 617 117 HOH HOH A . D 4 HOH 118 618 118 HOH HOH A . D 4 HOH 119 619 119 HOH HOH A . D 4 HOH 120 620 120 HOH HOH A . D 4 HOH 121 621 121 HOH HOH A . D 4 HOH 122 622 122 HOH HOH A . D 4 HOH 123 623 123 HOH HOH A . D 4 HOH 124 624 124 HOH HOH A . D 4 HOH 125 625 125 HOH HOH A . D 4 HOH 126 626 126 HOH HOH A . D 4 HOH 127 627 127 HOH HOH A . D 4 HOH 128 628 128 HOH HOH A . D 4 HOH 129 629 129 HOH HOH A . D 4 HOH 130 630 130 HOH HOH A . D 4 HOH 131 631 131 HOH HOH A . D 4 HOH 132 632 132 HOH HOH A . D 4 HOH 133 633 133 HOH HOH A . D 4 HOH 134 634 134 HOH HOH A . D 4 HOH 135 635 135 HOH HOH A . D 4 HOH 136 636 136 HOH HOH A . D 4 HOH 137 637 137 HOH HOH A . D 4 HOH 138 638 138 HOH HOH A . D 4 HOH 139 639 139 HOH HOH A . D 4 HOH 140 640 140 HOH HOH A . D 4 HOH 141 641 141 HOH HOH A . D 4 HOH 142 642 142 HOH HOH A . D 4 HOH 143 643 143 HOH HOH A . D 4 HOH 144 644 144 HOH HOH A . D 4 HOH 145 645 145 HOH HOH A . D 4 HOH 146 646 146 HOH HOH A . D 4 HOH 147 647 147 HOH HOH A . D 4 HOH 148 648 148 HOH HOH A . D 4 HOH 149 649 149 HOH HOH A . D 4 HOH 150 650 150 HOH HOH A . D 4 HOH 151 651 151 HOH HOH A . D 4 HOH 152 652 152 HOH HOH A . D 4 HOH 153 653 153 HOH HOH A . D 4 HOH 154 654 154 HOH HOH A . D 4 HOH 155 655 155 HOH HOH A . D 4 HOH 156 656 156 HOH HOH A . D 4 HOH 157 657 157 HOH HOH A . D 4 HOH 158 658 158 HOH HOH A . D 4 HOH 159 659 159 HOH HOH A . D 4 HOH 160 660 160 HOH HOH A . D 4 HOH 161 661 161 HOH HOH A . D 4 HOH 162 662 162 HOH HOH A . D 4 HOH 163 663 163 HOH HOH A . D 4 HOH 164 664 164 HOH HOH A . D 4 HOH 165 665 165 HOH HOH A . D 4 HOH 166 666 166 HOH HOH A . D 4 HOH 167 667 167 HOH HOH A . D 4 HOH 168 668 168 HOH HOH A . D 4 HOH 169 669 169 HOH HOH A . D 4 HOH 170 670 170 HOH HOH A . D 4 HOH 171 671 171 HOH HOH A . D 4 HOH 172 672 172 HOH HOH A . D 4 HOH 173 673 173 HOH HOH A . D 4 HOH 174 674 174 HOH HOH A . D 4 HOH 175 675 175 HOH HOH A . D 4 HOH 176 676 176 HOH HOH A . D 4 HOH 177 677 177 HOH HOH A . D 4 HOH 178 678 178 HOH HOH A . D 4 HOH 179 679 179 HOH HOH A . D 4 HOH 180 680 180 HOH HOH A . D 4 HOH 181 681 181 HOH HOH A . D 4 HOH 182 682 182 HOH HOH A . D 4 HOH 183 683 183 HOH HOH A . D 4 HOH 184 684 184 HOH HOH A . D 4 HOH 185 685 185 HOH HOH A . D 4 HOH 186 686 186 HOH HOH A . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 NE2 ? A HIS 183 ? A HIS 183 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OD2 ? A ASP 194 ? A ASP 194 ? 1_555 138.9 ? 2 NE2 ? A HIS 183 ? A HIS 183 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 187 ? A HIS 187 ? 1_555 94.9 ? 3 OD2 ? A ASP 194 ? A ASP 194 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 NE2 ? A HIS 187 ? A HIS 187 ? 1_555 104.8 ? 4 NE2 ? A HIS 183 ? A HIS 183 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OH ? A TYR 227 ? A TYR 227 ? 1_555 79.6 ? 5 OD2 ? A ASP 194 ? A ASP 194 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OH ? A TYR 227 ? A TYR 227 ? 1_555 78.8 ? 6 NE2 ? A HIS 187 ? A HIS 187 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OH ? A TYR 227 ? A TYR 227 ? 1_555 174.4 ? 7 NE2 ? A HIS 183 ? A HIS 183 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OD1 ? A ASP 194 ? A ASP 194 ? 1_555 86.3 ? 8 OD2 ? A ASP 194 ? A ASP 194 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OD1 ? A ASP 194 ? A ASP 194 ? 1_555 57.7 ? 9 NE2 ? A HIS 187 ? A HIS 187 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OD1 ? A ASP 194 ? A ASP 194 ? 1_555 92.2 ? 10 OH ? A TYR 227 ? A TYR 227 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 OD1 ? A ASP 194 ? A ASP 194 ? 1_555 86.0 ? 11 NE2 ? A HIS 183 ? A HIS 183 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 O ? D HOH . ? A HOH 529 ? 1_555 110.2 ? 12 OD2 ? A ASP 194 ? A ASP 194 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 O ? D HOH . ? A HOH 529 ? 1_555 104.5 ? 13 NE2 ? A HIS 187 ? A HIS 187 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 O ? D HOH . ? A HOH 529 ? 1_555 92.8 ? 14 OH ? A TYR 227 ? A TYR 227 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 O ? D HOH . ? A HOH 529 ? 1_555 90.5 ? 15 OD1 ? A ASP 194 ? A ASP 194 ? 1_555 ZN ? B ZN . ? A ZN 401 ? 1_555 O ? D HOH . ? A HOH 529 ? 1_555 162.2 ? 16 O ? D HOH . ? A HOH 626 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 625 ? 1_555 112.2 ? 17 O ? D HOH . ? A HOH 626 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 628 ? 1_555 70.2 ? 18 O ? D HOH . ? A HOH 625 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 628 ? 1_555 69.0 ? 19 O ? D HOH . ? A HOH 626 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 629 ? 1_555 64.2 ? 20 O ? D HOH . ? A HOH 625 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 629 ? 1_555 71.6 ? 21 O ? D HOH . ? A HOH 628 ? 1_555 MG ? C MG . ? A MG 402 ? 1_555 O ? D HOH . ? A HOH 629 ? 1_555 99.0 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-07-30 2 'Structure model' 1 1 2014-09-03 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? # _pdbx_audit_revision_group.ordinal 1 _pdbx_audit_revision_group.revision_ordinal 2 _pdbx_audit_revision_group.data_content_type 'Structure model' _pdbx_audit_revision_group.group 'Database references' # _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.id 1 _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x 8.0022 _pdbx_refine_tls.origin_y 28.7335 _pdbx_refine_tls.origin_z 51.6032 _pdbx_refine_tls.T[1][1] 0.0758 _pdbx_refine_tls.T[2][2] 0.1292 _pdbx_refine_tls.T[3][3] 0.0970 _pdbx_refine_tls.T[1][2] -0.0121 _pdbx_refine_tls.T[1][3] -0.0077 _pdbx_refine_tls.T[2][3] 0.0055 _pdbx_refine_tls.L[1][1] 1.1147 _pdbx_refine_tls.L[2][2] 2.1839 _pdbx_refine_tls.L[3][3] 1.1421 _pdbx_refine_tls.L[1][2] -0.3549 _pdbx_refine_tls.L[1][3] -0.3603 _pdbx_refine_tls.L[2][3] 0.7131 _pdbx_refine_tls.S[1][1] 0.0165 _pdbx_refine_tls.S[1][2] -0.0449 _pdbx_refine_tls.S[1][3] -0.0019 _pdbx_refine_tls.S[2][1] 0.0744 _pdbx_refine_tls.S[2][2] 0.0148 _pdbx_refine_tls.S[2][3] -0.1152 _pdbx_refine_tls.S[3][1] -0.0148 _pdbx_refine_tls.S[3][2] 0.0745 _pdbx_refine_tls.S[3][3] -0.0032 # _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_auth_asym_id ? _pdbx_refine_tls_group.beg_auth_seq_id ? _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id ? _pdbx_refine_tls_group.end_auth_seq_id ? _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details all # loop_ _software.name _software.classification _software.version _software.citation_id _software.pdbx_ordinal HKL-2000 'data collection' . ? 1 PHENIX 'model building' '(phenix.autosol: 1.7.1_743)' ? 2 PHENIX refinement '(phenix.refine: 1.7.1_743)' ? 3 HKL-2000 'data reduction' . ? 4 HKL-2000 'data scaling' . ? 5 PHENIX phasing 1.7.1_743 ? 6 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 525 ? ? O A HOH 604 ? ? 1.93 2 1 O A HOH 590 ? ? O A HOH 664 ? ? 2.05 3 1 O A HOH 641 ? ? O A HOH 642 ? ? 2.07 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 O _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 HOH _pdbx_validate_symm_contact.auth_seq_id_1 502 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 O _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 HOH _pdbx_validate_symm_contact.auth_seq_id_2 532 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 4_456 _pdbx_validate_symm_contact.dist 1.93 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LYS A 102 ? ? -105.47 -153.20 2 1 ASN A 112 ? ? -115.15 68.48 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A ILE 3 ? A ILE 3 4 1 Y 1 A PRO 4 ? A PRO 4 5 1 Y 1 A SER 5 ? A SER 5 6 1 Y 1 A LEU 6 ? A LEU 6 7 1 Y 1 A GLN 7 ? A GLN 7 8 1 Y 1 A SER 8 ? A SER 8 9 1 Y 1 A ASN 9 ? A ASN 9 10 1 Y 1 A PHE 10 ? A PHE 10 11 1 Y 1 A ASN 11 ? A ASN 11 12 1 Y 1 A PHE 12 ? A PHE 12 13 1 Y 1 A SER 13 ? A SER 13 14 1 Y 1 A ALA 14 ? A ALA 14 15 1 Y 1 A PRO 15 ? A PRO 15 16 1 Y 1 A ALA 16 ? A ALA 16 17 1 Y 1 A GLY 17 ? A GLY 17 18 1 Y 1 A TYR 18 ? A TYR 18 19 1 Y 1 A SER 19 ? A SER 19 20 1 Y 1 A ALA 20 ? A ALA 20 21 1 Y 1 A PRO 21 ? A PRO 21 22 1 Y 1 A VAL 281 ? A VAL 281 23 1 Y 1 A SER 282 ? A SER 282 24 1 Y 1 A ASN 283 ? A ASN 283 25 1 Y 1 A ILE 284 ? A ILE 284 26 1 Y 1 A GLY 285 ? A GLY 285 27 1 Y 1 A TYR 286 ? A TYR 286 28 1 Y 1 A GLY 287 ? A GLY 287 29 1 Y 1 A PHE 288 ? A PHE 288 30 1 Y 1 A ILE 289 ? A ILE 289 31 1 Y 1 A GLN 290 ? A GLN 290 32 1 Y 1 A GLN 291 ? A GLN 291 33 1 Y 1 A HIS 292 ? A HIS 292 34 1 Y 1 A ASP 293 ? A ASP 293 35 1 Y 1 A PHE 294 ? A PHE 294 36 1 Y 1 A PRO 295 ? A PRO 295 37 1 Y 1 A GLY 296 ? A GLY 296 38 1 Y 1 A LEU 297 ? A LEU 297 39 1 Y 1 A ALA 298 ? A ALA 298 40 1 Y 1 A ILE 299 ? A ILE 299 41 1 Y 1 A ASN 300 ? A ASN 300 42 1 Y 1 A ASP 301 ? A ASP 301 43 1 Y 1 A ASN 302 ? A ASN 302 44 1 Y 1 A LEU 303 ? A LEU 303 45 1 Y 1 A GLN 304 ? A GLN 304 46 1 Y 1 A ASP 305 ? A ASP 305 47 1 Y 1 A ALA 306 ? A ALA 306 48 1 Y 1 A ASN 307 ? A ASN 307 49 1 Y 1 A GLN 308 ? A GLN 308 50 1 Y 1 A ILE 309 ? A ILE 309 51 1 Y 1 A GLN 310 ? A GLN 310 52 1 Y 1 A LEU 311 ? A LEU 311 53 1 Y 1 A TYR 312 ? A TYR 312 54 1 Y 1 A HIS 313 ? A HIS 313 55 1 Y 1 A GLY 314 ? A GLY 314 56 1 Y 1 A ALA 315 ? A ALA 315 57 1 Y 1 A PRO 316 ? A PRO 316 58 1 Y 1 A TYR 317 ? A TYR 317 59 1 Y 1 A ILE 318 ? A ILE 318 60 1 Y 1 A PHE 319 ? A PHE 319 61 1 Y 1 A THR 320 ? A THR 320 62 1 Y 1 A PHE 321 ? A PHE 321 63 1 Y 1 A GLY 322 ? A GLY 322 64 1 Y 1 A ASP 323 ? A ASP 323 65 1 Y 1 A VAL 324 ? A VAL 324 66 1 Y 1 A ASP 325 ? A ASP 325 67 1 Y 1 A LYS 326 ? A LYS 326 68 1 Y 1 A HIS 327 ? A HIS 327 69 1 Y 1 A ASN 328 ? A ASN 328 70 1 Y 1 A GLN 329 ? A GLN 329 71 1 Y 1 A GLN 330 ? A GLN 330 72 1 Y 1 A PRO 331 ? A PRO 331 73 1 Y 1 A GLY 332 ? A GLY 332 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'MAGNESIUM ION' MG 4 water HOH #