data_4TKQ # _entry.id 4TKQ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4TKQ pdb_00004tkq 10.2210/pdb4tkq/pdb WWPDB D_1000201674 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-06-18 2 'Structure model' 1 1 2014-10-08 3 'Structure model' 1 2 2014-10-22 4 'Structure model' 1 3 2017-09-06 5 'Structure model' 1 4 2019-12-25 6 'Structure model' 1 5 2023-12-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Author supporting evidence' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other 6 4 'Structure model' 'Source and taxonomy' 7 5 'Structure model' 'Author supporting evidence' 8 6 'Structure model' 'Data collection' 9 6 'Structure model' 'Database references' 10 6 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' entity_src_gen 2 4 'Structure model' pdbx_audit_support 3 4 'Structure model' pdbx_database_status 4 4 'Structure model' pdbx_struct_assembly 5 4 'Structure model' pdbx_struct_assembly_prop 6 4 'Structure model' pdbx_struct_oper_list 7 5 'Structure model' pdbx_audit_support 8 6 'Structure model' chem_comp_atom 9 6 'Structure model' chem_comp_bond 10 6 'Structure model' database_2 11 6 'Structure model' refine_hist # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 2 4 'Structure model' '_pdbx_audit_support.funding_organization' 3 4 'Structure model' '_pdbx_database_status.pdb_format_compatible' 4 4 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 5 4 'Structure model' '_pdbx_struct_assembly_prop.type' 6 4 'Structure model' '_pdbx_struct_assembly_prop.value' 7 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 8 5 'Structure model' '_pdbx_audit_support.funding_organization' 9 6 'Structure model' '_database_2.pdbx_DOI' 10 6 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4TKQ _pdbx_database_status.recvd_initial_deposition_date 2014-05-27 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Liu, Q.' 1 'Chang, Y.' 2 'Hendrickson, W.A.' 3 'New York Consortium on Membrane Protein Structure (NYCOMPS)' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Acta Crystallogr.,Sect.D' _citation.journal_id_ASTM ABCRE6 _citation.journal_id_CSD ? _citation.journal_id_ISSN 1399-0047 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 70 _citation.language ? _citation.page_first 2544 _citation.page_last 2557 _citation.title 'Multi-crystal native SAD analysis at 6 keV.' _citation.year 2014 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1107/S1399004714013376 _citation.pdbx_database_id_PubMed 25286840 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Liu, Q.' 1 ? primary 'Guo, Y.' 2 ? primary 'Chang, Y.' 3 ? primary 'Cai, Z.' 4 ? primary 'Assur, Z.' 5 ? primary 'Mancia, F.' 6 ? primary 'Greene, M.I.' 7 ? primary 'Hendrickson, W.A.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Uncharacterized protein YetJ' 24116.812 1 ? ? ? ? 2 non-polymer syn 'CALCIUM ION' 40.078 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 3 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;SNAMQATVHESKQSIMQRILTVFVFTLLIATVGLFIGQFVPVALMLPLSILEVAMIILAFWMRRRKAVGYAFVYTFAFVS GITLFPIVSHYASIAGAYVVLEAFGSTFVIFAVLGTIGAKMKKDLSFLWSFLLVAVLALAVVGIFNIFSPLNSAAMMAYS VIGTIVFSLYILYDLNQIKHRHITEDLIPVMALSLYLDFINLFINLLRFFGILSSDD ; _entity_poly.pdbx_seq_one_letter_code_can ;SNAMQATVHESKQSIMQRILTVFVFTLLIATVGLFIGQFVPVALMLPLSILEVAMIILAFWMRRRKAVGYAFVYTFAFVS GITLFPIVSHYASIAGAYVVLEAFGSTFVIFAVLGTIGAKMKKDLSFLWSFLLVAVLALAVVGIFNIFSPLNSAAMMAYS VIGTIVFSLYILYDLNQIKHRHITEDLIPVMALSLYLDFINLFINLLRFFGILSSDD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'CALCIUM ION' CA 3 'CHLORIDE ION' CL # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 SER n 1 2 ASN n 1 3 ALA n 1 4 MET n 1 5 GLN n 1 6 ALA n 1 7 THR n 1 8 VAL n 1 9 HIS n 1 10 GLU n 1 11 SER n 1 12 LYS n 1 13 GLN n 1 14 SER n 1 15 ILE n 1 16 MET n 1 17 GLN n 1 18 ARG n 1 19 ILE n 1 20 LEU n 1 21 THR n 1 22 VAL n 1 23 PHE n 1 24 VAL n 1 25 PHE n 1 26 THR n 1 27 LEU n 1 28 LEU n 1 29 ILE n 1 30 ALA n 1 31 THR n 1 32 VAL n 1 33 GLY n 1 34 LEU n 1 35 PHE n 1 36 ILE n 1 37 GLY n 1 38 GLN n 1 39 PHE n 1 40 VAL n 1 41 PRO n 1 42 VAL n 1 43 ALA n 1 44 LEU n 1 45 MET n 1 46 LEU n 1 47 PRO n 1 48 LEU n 1 49 SER n 1 50 ILE n 1 51 LEU n 1 52 GLU n 1 53 VAL n 1 54 ALA n 1 55 MET n 1 56 ILE n 1 57 ILE n 1 58 LEU n 1 59 ALA n 1 60 PHE n 1 61 TRP n 1 62 MET n 1 63 ARG n 1 64 ARG n 1 65 ARG n 1 66 LYS n 1 67 ALA n 1 68 VAL n 1 69 GLY n 1 70 TYR n 1 71 ALA n 1 72 PHE n 1 73 VAL n 1 74 TYR n 1 75 THR n 1 76 PHE n 1 77 ALA n 1 78 PHE n 1 79 VAL n 1 80 SER n 1 81 GLY n 1 82 ILE n 1 83 THR n 1 84 LEU n 1 85 PHE n 1 86 PRO n 1 87 ILE n 1 88 VAL n 1 89 SER n 1 90 HIS n 1 91 TYR n 1 92 ALA n 1 93 SER n 1 94 ILE n 1 95 ALA n 1 96 GLY n 1 97 ALA n 1 98 TYR n 1 99 VAL n 1 100 VAL n 1 101 LEU n 1 102 GLU n 1 103 ALA n 1 104 PHE n 1 105 GLY n 1 106 SER n 1 107 THR n 1 108 PHE n 1 109 VAL n 1 110 ILE n 1 111 PHE n 1 112 ALA n 1 113 VAL n 1 114 LEU n 1 115 GLY n 1 116 THR n 1 117 ILE n 1 118 GLY n 1 119 ALA n 1 120 LYS n 1 121 MET n 1 122 LYS n 1 123 LYS n 1 124 ASP n 1 125 LEU n 1 126 SER n 1 127 PHE n 1 128 LEU n 1 129 TRP n 1 130 SER n 1 131 PHE n 1 132 LEU n 1 133 LEU n 1 134 VAL n 1 135 ALA n 1 136 VAL n 1 137 LEU n 1 138 ALA n 1 139 LEU n 1 140 ALA n 1 141 VAL n 1 142 VAL n 1 143 GLY n 1 144 ILE n 1 145 PHE n 1 146 ASN n 1 147 ILE n 1 148 PHE n 1 149 SER n 1 150 PRO n 1 151 LEU n 1 152 ASN n 1 153 SER n 1 154 ALA n 1 155 ALA n 1 156 MET n 1 157 MET n 1 158 ALA n 1 159 TYR n 1 160 SER n 1 161 VAL n 1 162 ILE n 1 163 GLY n 1 164 THR n 1 165 ILE n 1 166 VAL n 1 167 PHE n 1 168 SER n 1 169 LEU n 1 170 TYR n 1 171 ILE n 1 172 LEU n 1 173 TYR n 1 174 ASP n 1 175 LEU n 1 176 ASN n 1 177 GLN n 1 178 ILE n 1 179 LYS n 1 180 HIS n 1 181 ARG n 1 182 HIS n 1 183 ILE n 1 184 THR n 1 185 GLU n 1 186 ASP n 1 187 LEU n 1 188 ILE n 1 189 PRO n 1 190 VAL n 1 191 MET n 1 192 ALA n 1 193 LEU n 1 194 SER n 1 195 LEU n 1 196 TYR n 1 197 LEU n 1 198 ASP n 1 199 PHE n 1 200 ILE n 1 201 ASN n 1 202 LEU n 1 203 PHE n 1 204 ILE n 1 205 ASN n 1 206 LEU n 1 207 LEU n 1 208 ARG n 1 209 PHE n 1 210 PHE n 1 211 GLY n 1 212 ILE n 1 213 LEU n 1 214 SER n 1 215 SER n 1 216 ASP n 1 217 ASP n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 217 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'yetJ, BSU07200' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 168 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Bacillus subtilis' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 224308 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CA non-polymer . 'CALCIUM ION' ? 'Ca 2' 40.078 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 SER 1 -2 ? ? ? A . n A 1 2 ASN 2 -1 ? ? ? A . n A 1 3 ALA 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 GLN 5 2 ? ? ? A . n A 1 6 ALA 6 3 ? ? ? A . n A 1 7 THR 7 4 ? ? ? A . n A 1 8 VAL 8 5 ? ? ? A . n A 1 9 HIS 9 6 6 HIS HIS A . n A 1 10 GLU 10 7 7 GLU GLU A . n A 1 11 SER 11 8 8 SER SER A . n A 1 12 LYS 12 9 9 LYS LYS A . n A 1 13 GLN 13 10 10 GLN GLN A . n A 1 14 SER 14 11 11 SER SER A . n A 1 15 ILE 15 12 12 ILE ILE A . n A 1 16 MET 16 13 13 MET MET A . n A 1 17 GLN 17 14 14 GLN GLN A . n A 1 18 ARG 18 15 15 ARG ARG A . n A 1 19 ILE 19 16 16 ILE ILE A . n A 1 20 LEU 20 17 17 LEU LEU A . n A 1 21 THR 21 18 18 THR THR A . n A 1 22 VAL 22 19 19 VAL VAL A . n A 1 23 PHE 23 20 20 PHE PHE A . n A 1 24 VAL 24 21 21 VAL VAL A . n A 1 25 PHE 25 22 22 PHE PHE A . n A 1 26 THR 26 23 23 THR THR A . n A 1 27 LEU 27 24 24 LEU LEU A . n A 1 28 LEU 28 25 25 LEU LEU A . n A 1 29 ILE 29 26 26 ILE ILE A . n A 1 30 ALA 30 27 27 ALA ALA A . n A 1 31 THR 31 28 28 THR THR A . n A 1 32 VAL 32 29 29 VAL VAL A . n A 1 33 GLY 33 30 30 GLY GLY A . n A 1 34 LEU 34 31 31 LEU LEU A . n A 1 35 PHE 35 32 32 PHE PHE A . n A 1 36 ILE 36 33 33 ILE ILE A . n A 1 37 GLY 37 34 34 GLY GLY A . n A 1 38 GLN 38 35 35 GLN GLN A . n A 1 39 PHE 39 36 36 PHE PHE A . n A 1 40 VAL 40 37 37 VAL VAL A . n A 1 41 PRO 41 38 38 PRO PRO A . n A 1 42 VAL 42 39 39 VAL VAL A . n A 1 43 ALA 43 40 40 ALA ALA A . n A 1 44 LEU 44 41 41 LEU LEU A . n A 1 45 MET 45 42 42 MET MET A . n A 1 46 LEU 46 43 43 LEU LEU A . n A 1 47 PRO 47 44 44 PRO PRO A . n A 1 48 LEU 48 45 45 LEU LEU A . n A 1 49 SER 49 46 46 SER SER A . n A 1 50 ILE 50 47 47 ILE ILE A . n A 1 51 LEU 51 48 48 LEU LEU A . n A 1 52 GLU 52 49 49 GLU GLU A . n A 1 53 VAL 53 50 50 VAL VAL A . n A 1 54 ALA 54 51 51 ALA ALA A . n A 1 55 MET 55 52 52 MET MET A . n A 1 56 ILE 56 53 53 ILE ILE A . n A 1 57 ILE 57 54 54 ILE ILE A . n A 1 58 LEU 58 55 55 LEU LEU A . n A 1 59 ALA 59 56 56 ALA ALA A . n A 1 60 PHE 60 57 57 PHE PHE A . n A 1 61 TRP 61 58 58 TRP TRP A . n A 1 62 MET 62 59 59 MET MET A . n A 1 63 ARG 63 60 60 ARG ARG A . n A 1 64 ARG 64 61 61 ARG ARG A . n A 1 65 ARG 65 62 62 ARG ARG A . n A 1 66 LYS 66 63 63 LYS LYS A . n A 1 67 ALA 67 64 64 ALA ALA A . n A 1 68 VAL 68 65 65 VAL VAL A . n A 1 69 GLY 69 66 66 GLY GLY A . n A 1 70 TYR 70 67 67 TYR TYR A . n A 1 71 ALA 71 68 68 ALA ALA A . n A 1 72 PHE 72 69 69 PHE PHE A . n A 1 73 VAL 73 70 70 VAL VAL A . n A 1 74 TYR 74 71 71 TYR TYR A . n A 1 75 THR 75 72 72 THR THR A . n A 1 76 PHE 76 73 73 PHE PHE A . n A 1 77 ALA 77 74 74 ALA ALA A . n A 1 78 PHE 78 75 75 PHE PHE A . n A 1 79 VAL 79 76 76 VAL VAL A . n A 1 80 SER 80 77 77 SER SER A . n A 1 81 GLY 81 78 78 GLY GLY A . n A 1 82 ILE 82 79 79 ILE ILE A . n A 1 83 THR 83 80 80 THR THR A . n A 1 84 LEU 84 81 81 LEU LEU A . n A 1 85 PHE 85 82 82 PHE PHE A . n A 1 86 PRO 86 83 83 PRO PRO A . n A 1 87 ILE 87 84 84 ILE ILE A . n A 1 88 VAL 88 85 85 VAL VAL A . n A 1 89 SER 89 86 86 SER SER A . n A 1 90 HIS 90 87 87 HIS HIS A . n A 1 91 TYR 91 88 88 TYR TYR A . n A 1 92 ALA 92 89 89 ALA ALA A . n A 1 93 SER 93 90 90 SER SER A . n A 1 94 ILE 94 91 91 ILE ILE A . n A 1 95 ALA 95 92 92 ALA ALA A . n A 1 96 GLY 96 93 93 GLY GLY A . n A 1 97 ALA 97 94 94 ALA ALA A . n A 1 98 TYR 98 95 95 TYR TYR A . n A 1 99 VAL 99 96 96 VAL VAL A . n A 1 100 VAL 100 97 97 VAL VAL A . n A 1 101 LEU 101 98 98 LEU LEU A . n A 1 102 GLU 102 99 99 GLU GLU A . n A 1 103 ALA 103 100 100 ALA ALA A . n A 1 104 PHE 104 101 101 PHE PHE A . n A 1 105 GLY 105 102 102 GLY GLY A . n A 1 106 SER 106 103 103 SER SER A . n A 1 107 THR 107 104 104 THR THR A . n A 1 108 PHE 108 105 105 PHE PHE A . n A 1 109 VAL 109 106 106 VAL VAL A . n A 1 110 ILE 110 107 107 ILE ILE A . n A 1 111 PHE 111 108 108 PHE PHE A . n A 1 112 ALA 112 109 109 ALA ALA A . n A 1 113 VAL 113 110 110 VAL VAL A . n A 1 114 LEU 114 111 111 LEU LEU A . n A 1 115 GLY 115 112 112 GLY GLY A . n A 1 116 THR 116 113 113 THR THR A . n A 1 117 ILE 117 114 114 ILE ILE A . n A 1 118 GLY 118 115 115 GLY GLY A . n A 1 119 ALA 119 116 116 ALA ALA A . n A 1 120 LYS 120 117 117 LYS LYS A . n A 1 121 MET 121 118 118 MET MET A . n A 1 122 LYS 122 119 119 LYS LYS A . n A 1 123 LYS 123 120 120 LYS LYS A . n A 1 124 ASP 124 121 121 ASP ASP A . n A 1 125 LEU 125 122 122 LEU LEU A . n A 1 126 SER 126 123 123 SER SER A . n A 1 127 PHE 127 124 124 PHE PHE A . n A 1 128 LEU 128 125 125 LEU LEU A . n A 1 129 TRP 129 126 126 TRP TRP A . n A 1 130 SER 130 127 127 SER SER A . n A 1 131 PHE 131 128 128 PHE PHE A . n A 1 132 LEU 132 129 129 LEU LEU A . n A 1 133 LEU 133 130 130 LEU LEU A . n A 1 134 VAL 134 131 131 VAL VAL A . n A 1 135 ALA 135 132 132 ALA ALA A . n A 1 136 VAL 136 133 133 VAL VAL A . n A 1 137 LEU 137 134 134 LEU LEU A . n A 1 138 ALA 138 135 135 ALA ALA A . n A 1 139 LEU 139 136 136 LEU LEU A . n A 1 140 ALA 140 137 137 ALA ALA A . n A 1 141 VAL 141 138 138 VAL VAL A . n A 1 142 VAL 142 139 139 VAL VAL A . n A 1 143 GLY 143 140 140 GLY GLY A . n A 1 144 ILE 144 141 141 ILE ILE A . n A 1 145 PHE 145 142 142 PHE PHE A . n A 1 146 ASN 146 143 143 ASN ASN A . n A 1 147 ILE 147 144 144 ILE ILE A . n A 1 148 PHE 148 145 145 PHE PHE A . n A 1 149 SER 149 146 146 SER SER A . n A 1 150 PRO 150 147 147 PRO PRO A . n A 1 151 LEU 151 148 148 LEU LEU A . n A 1 152 ASN 152 149 149 ASN ASN A . n A 1 153 SER 153 150 150 SER SER A . n A 1 154 ALA 154 151 151 ALA ALA A . n A 1 155 ALA 155 152 152 ALA ALA A . n A 1 156 MET 156 153 153 MET MET A . n A 1 157 MET 157 154 154 MET MET A . n A 1 158 ALA 158 155 155 ALA ALA A . n A 1 159 TYR 159 156 156 TYR TYR A . n A 1 160 SER 160 157 157 SER SER A . n A 1 161 VAL 161 158 158 VAL VAL A . n A 1 162 ILE 162 159 159 ILE ILE A . n A 1 163 GLY 163 160 160 GLY GLY A . n A 1 164 THR 164 161 161 THR THR A . n A 1 165 ILE 165 162 162 ILE ILE A . n A 1 166 VAL 166 163 163 VAL VAL A . n A 1 167 PHE 167 164 164 PHE PHE A . n A 1 168 SER 168 165 165 SER SER A . n A 1 169 LEU 169 166 166 LEU LEU A . n A 1 170 TYR 170 167 167 TYR TYR A . n A 1 171 ILE 171 168 168 ILE ILE A . n A 1 172 LEU 172 169 169 LEU LEU A . n A 1 173 TYR 173 170 170 TYR TYR A . n A 1 174 ASP 174 171 171 ASP ASP A . n A 1 175 LEU 175 172 172 LEU LEU A . n A 1 176 ASN 176 173 173 ASN ASN A . n A 1 177 GLN 177 174 174 GLN GLN A . n A 1 178 ILE 178 175 175 ILE ILE A . n A 1 179 LYS 179 176 176 LYS LYS A . n A 1 180 HIS 180 177 177 HIS HIS A . n A 1 181 ARG 181 178 178 ARG ARG A . n A 1 182 HIS 182 179 179 HIS HIS A . n A 1 183 ILE 183 180 180 ILE ILE A . n A 1 184 THR 184 181 181 THR THR A . n A 1 185 GLU 185 182 182 GLU GLU A . n A 1 186 ASP 186 183 183 ASP ASP A . n A 1 187 LEU 187 184 184 LEU LEU A . n A 1 188 ILE 188 185 185 ILE ILE A . n A 1 189 PRO 189 186 186 PRO PRO A . n A 1 190 VAL 190 187 187 VAL VAL A . n A 1 191 MET 191 188 188 MET MET A . n A 1 192 ALA 192 189 189 ALA ALA A . n A 1 193 LEU 193 190 190 LEU LEU A . n A 1 194 SER 194 191 191 SER SER A . n A 1 195 LEU 195 192 192 LEU LEU A . n A 1 196 TYR 196 193 193 TYR TYR A . n A 1 197 LEU 197 194 194 LEU LEU A . n A 1 198 ASP 198 195 195 ASP ASP A . n A 1 199 PHE 199 196 196 PHE PHE A . n A 1 200 ILE 200 197 197 ILE ILE A . n A 1 201 ASN 201 198 198 ASN ASN A . n A 1 202 LEU 202 199 199 LEU LEU A . n A 1 203 PHE 203 200 200 PHE PHE A . n A 1 204 ILE 204 201 201 ILE ILE A . n A 1 205 ASN 205 202 202 ASN ASN A . n A 1 206 LEU 206 203 203 LEU LEU A . n A 1 207 LEU 207 204 204 LEU LEU A . n A 1 208 ARG 208 205 205 ARG ARG A . n A 1 209 PHE 209 206 206 PHE PHE A . n A 1 210 PHE 210 207 207 PHE PHE A . n A 1 211 GLY 211 208 208 GLY GLY A . n A 1 212 ILE 212 209 209 ILE ILE A . n A 1 213 LEU 213 210 210 LEU LEU A . n A 1 214 SER 214 211 211 SER SER A . n A 1 215 SER 215 212 212 SER SER A . n A 1 216 ASP 216 213 ? ? ? A . n A 1 217 ASP 217 214 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 CA 1 301 301 CA CA A . C 3 CL 1 302 302 CL CL A . D 3 CL 1 303 303 CL CL A . E 3 CL 1 304 304 CL CL A . # _software.citation_id ? _software.classification refinement _software.compiler_name ? _software.compiler_version ? _software.contact_author ? _software.contact_author_email ? _software.date ? _software.description ? _software.dependencies ? _software.hardware ? _software.language ? _software.location ? _software.mods ? _software.name PHENIX _software.os ? _software.os_version ? _software.type ? _software.version '(phenix.refine: 1.8_1069)' _software.pdbx_ordinal 1 # _cell.entry_id 4TKQ _cell.length_a 61.869 _cell.length_b 61.869 _cell.length_c 288.401 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4TKQ _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4TKQ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.30 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 62.77 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 8.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '30% PEG 600, 100 mM CaCl2, 100 mM Tris-HCl, pH 8.0' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 4r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-11-09 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 2.07 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSLS BEAMLINE X4A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 2.07 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline X4A _diffrn_source.pdbx_synchrotron_site NSLS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4TKQ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.0 _reflns.d_resolution_low 40.0 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8784 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 535.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 56.8 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4TKQ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.8025 _refine.ls_d_res_low 39.257 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 15009 _refine.ls_number_reflns_R_free 757 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 98.94 _refine.ls_percent_reflns_R_free 5.04 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2225 _refine.ls_R_factor_R_free 0.2598 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2205 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.79 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.20 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.70 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.96 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.31 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1632 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 4 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1636 _refine_hist.d_res_high 2.8025 _refine_hist.d_res_low 39.257 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1673 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.604 ? 2274 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 11.186 ? 571 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.044 ? 279 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 269 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error 'X-RAY DIFFRACTION' 2.8025 3.0188 . . 160 2713 95.00 . . . 0.3149 . 0.2716 . . . . . . . . 'X-RAY DIFFRACTION' 3.0188 3.3225 . . 151 2868 100.00 . . . 0.3275 . 0.2590 . . . . . . . . 'X-RAY DIFFRACTION' 3.3225 3.8029 . . 154 2888 100.00 . . . 0.2846 . 0.2303 . . . . . . . . 'X-RAY DIFFRACTION' 3.8029 4.7899 . . 167 2874 100.00 . . . 0.2304 . 0.2008 . . . . . . . . 'X-RAY DIFFRACTION' 4.7899 39.2604 . . 125 2909 100.00 . . . 0.2220 . 0.2017 . . . . . . . . # _struct.entry_id 4TKQ _struct.title 'Native-SAD phasing for YetJ from Bacillus Subtilis' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4TKQ _struct_keywords.text ;Membrane protein, native-SAD phasing, multiple crystals, low energy, Structural Genomics, PSI-Biology, New York Consortium on Membrane Protein Structure, NYCOMPS ; _struct_keywords.pdbx_keywords 'MEMBRANE PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 3 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code YETJ_BACSU _struct_ref.pdbx_db_accession O31539 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQATVHESKQSIMQRILTVFVFTLLIATVGLFIGQFVPVALMLPLSILEVAMIILAFWMRRRKAVGYAFVYTFAFVSGIT LFPIVSHYASIAGAYVVLEAFGSTFVIFAVLGTIGAKMKKDLSFLWSFLLVAVLALAVVGIFNIFSPLNSAAMMAYSVIG TIVFSLYILYDLNQIKHRHITEDLIPVMALSLYLDFINLFINLLRFFGILSSDD ; _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4TKQ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 217 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O31539 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 214 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 214 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4TKQ SER A 1 ? UNP O31539 ? ? 'expression tag' -2 1 1 4TKQ ASN A 2 ? UNP O31539 ? ? 'expression tag' -1 2 1 4TKQ ALA A 3 ? UNP O31539 ? ? 'expression tag' 0 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 10450 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 11 ? GLN A 38 ? SER A 8 GLN A 35 1 ? 28 HELX_P HELX_P2 AA2 PHE A 39 ? VAL A 40 ? PHE A 36 VAL A 37 5 ? 2 HELX_P HELX_P3 AA3 PRO A 41 ? MET A 45 ? PRO A 38 MET A 42 5 ? 5 HELX_P HELX_P4 AA4 PRO A 47 ? MET A 62 ? PRO A 44 MET A 59 1 ? 16 HELX_P HELX_P5 AA5 GLY A 69 ? LEU A 84 ? GLY A 66 LEU A 81 1 ? 16 HELX_P HELX_P6 AA6 LEU A 84 ? GLY A 96 ? LEU A 81 GLY A 93 1 ? 13 HELX_P HELX_P7 AA7 ALA A 97 ? MET A 121 ? ALA A 94 MET A 118 1 ? 25 HELX_P HELX_P8 AA8 ASP A 124 ? PHE A 127 ? ASP A 121 PHE A 124 5 ? 4 HELX_P HELX_P9 AA9 LEU A 128 ? SER A 149 ? LEU A 125 SER A 146 1 ? 22 HELX_P HELX_P10 AB1 ASN A 152 ? ARG A 181 ? ASN A 149 ARG A 178 1 ? 30 HELX_P HELX_P11 AB2 THR A 184 ? ASP A 186 ? THR A 181 ASP A 183 5 ? 3 HELX_P HELX_P12 AB3 LEU A 187 ? SER A 214 ? LEU A 184 SER A 211 1 ? 28 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id metalc1 _struct_conn.conn_type_id metalc _struct_conn.pdbx_leaving_atom_flag ? _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id A _struct_conn.ptnr1_label_comp_id GLU _struct_conn.ptnr1_label_seq_id 185 _struct_conn.ptnr1_label_atom_id OE1 _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id CA _struct_conn.ptnr2_label_seq_id . _struct_conn.ptnr2_label_atom_id CA _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id A _struct_conn.ptnr1_auth_comp_id GLU _struct_conn.ptnr1_auth_seq_id 182 _struct_conn.ptnr2_auth_asym_id A _struct_conn.ptnr2_auth_comp_id CA _struct_conn.ptnr2_auth_seq_id 301 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 2.959 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A CA 301 ? 1 'binding site for residue CA A 301' AC2 Software A CL 302 ? 3 'binding site for residue CL A 302' AC3 Software A CL 303 ? 3 'binding site for residue CL A 303' AC4 Software A CL 304 ? 2 'binding site for residue CL A 304' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 1 GLU A 185 ? GLU A 182 . ? 1_555 ? 2 AC2 3 HIS A 182 ? HIS A 179 . ? 8_675 ? 3 AC2 3 THR A 184 ? THR A 181 . ? 8_675 ? 4 AC2 3 GLU A 185 ? GLU A 182 . ? 1_555 ? 5 AC3 3 LYS A 12 ? LYS A 9 . ? 1_555 ? 6 AC3 3 ARG A 181 ? ARG A 178 . ? 8_675 ? 7 AC3 3 HIS A 182 ? HIS A 179 . ? 8_675 ? 8 AC4 2 GLY A 69 ? GLY A 66 . ? 1_555 ? 9 AC4 2 TYR A 98 ? TYR A 95 . ? 8_665 ? # _pdbx_SG_project.id 1 _pdbx_SG_project.project_name PSI:Biology _pdbx_SG_project.full_name_of_center 'New York Consortium on Membrane Protein Structure' _pdbx_SG_project.initial_of_center NYCOMPS # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 17.2472 34.2727 -5.2686 0.3403 ? -0.0235 ? -0.0064 ? 0.5938 ? 0.0187 ? 0.3593 ? 3.6578 ? 1.2228 ? -1.0545 ? 1.0229 ? 0.8884 ? 2.7833 ? -0.0149 ? 0.1315 ? 0.2758 ? -0.7868 ? 0.0827 ? -0.4345 ? -0.2271 ? 0.0789 ? 0.0000 ? 2 'X-RAY DIFFRACTION' ? refined 18.3972 17.9883 11.1300 0.5289 ? -0.0309 ? 0.0430 ? 0.6079 ? 0.0637 ? 0.5571 ? 0.2615 ? -0.1241 ? -0.2244 ? 0.1527 ? -0.0118 ? 0.3020 ? -0.2132 ? -0.0475 ? -0.3442 ? -0.1415 ? 0.0784 ? 0.1009 ? 0.2859 ? 0.2632 ? -0.0000 ? 3 'X-RAY DIFFRACTION' ? refined 19.1371 38.8681 11.3972 0.6890 ? -0.0444 ? 0.0807 ? 0.7854 ? -0.0138 ? 0.7083 ? 0.6055 ? -0.3280 ? -0.4158 ? 0.4845 ? 0.3070 ? 0.3065 ? 0.9018 ? -0.8034 ? 1.6199 ? 0.6618 ? 0.1243 ? -0.9986 ? -1.0742 ? 0.3627 ? 0.0174 ? 4 'X-RAY DIFFRACTION' ? refined 13.3650 20.8835 1.3555 0.4265 ? 0.0213 ? -0.0332 ? 0.7200 ? 0.0316 ? 0.4816 ? 1.1967 ? -0.7397 ? 0.1979 ? 0.4509 ? -0.0986 ? 0.2495 ? -0.1679 ? 0.3078 ? -0.1834 ? -0.0241 ? 0.2775 ? 0.1320 ? 0.2543 ? 0.0463 ? -0.0000 ? 5 'X-RAY DIFFRACTION' ? refined 0.9400 41.2959 -1.1573 0.4963 ? 0.0878 ? 0.0333 ? 0.7682 ? 0.1431 ? 0.6642 ? 0.0948 ? 0.0740 ? -0.0142 ? 0.1257 ? 0.0811 ? 0.2159 ? -0.1898 ? -0.5294 ? 0.7314 ? -0.4758 ? 0.7153 ? 0.4346 ? -0.5954 ? -0.0558 ? 0.0085 ? 6 'X-RAY DIFFRACTION' ? refined 6.0827 28.8651 18.1152 0.4334 ? 0.0249 ? 0.0065 ? 0.5784 ? -0.0056 ? 0.4508 ? 1.5352 ? 0.0555 ? 0.4233 ? 0.2128 ? -0.5889 ? 1.8375 ? -0.2254 ? -0.1117 ? -0.1949 ? 0.4232 ? 0.3032 ? 0.2877 ? -0.1581 ? -0.1994 ? -0.0000 ? 7 'X-RAY DIFFRACTION' ? refined 6.6938 36.8550 6.6006 0.3365 ? 0.0391 ? -0.0627 ? 0.6121 ? 0.0581 ? 0.5247 ? 1.4990 ? 0.3268 ? -0.5086 ? 0.7810 ? 0.9805 ? 1.7887 ? 0.0603 ? 0.3295 ? 0.1635 ? 0.1773 ? 0.1262 ? -0.1784 ? -0.1830 ? -0.2089 ? -0.0000 ? 8 'X-RAY DIFFRACTION' ? refined 8.8150 25.7879 4.7913 0.3620 ? 0.0398 ? 0.0103 ? 0.6014 ? 0.0282 ? 0.5117 ? 1.2952 ? -0.6705 ? -0.0587 ? 0.3592 ? -0.0443 ? 1.6466 ? -0.3839 ? 0.3099 ? 0.1368 ? -0.1465 ? 0.5833 ? 0.1847 ? 0.1350 ? -0.1060 ? -0.0000 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? '(chain A and resid 6:35)' 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? '(chain A and resid 36:56)' 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? '(chain A and resid 57:66)' 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? '(chain A and resid 67:107)' 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? '(chain A and resid 108:121)' 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? '(chain A and resid 122:151)' 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? '(chain A and resid 152:184)' 8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? '(chain A and resid 185:212)' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER -2 ? A SER 1 2 1 Y 1 A ASN -1 ? A ASN 2 3 1 Y 1 A ALA 0 ? A ALA 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A GLN 2 ? A GLN 5 6 1 Y 1 A ALA 3 ? A ALA 6 7 1 Y 1 A THR 4 ? A THR 7 8 1 Y 1 A VAL 5 ? A VAL 8 9 1 Y 1 A ASP 213 ? A ASP 216 10 1 Y 1 A ASP 214 ? A ASP 217 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CA CA CA N N 74 CL CL CL N N 75 GLN N N N N 76 GLN CA C N S 77 GLN C C N N 78 GLN O O N N 79 GLN CB C N N 80 GLN CG C N N 81 GLN CD C N N 82 GLN OE1 O N N 83 GLN NE2 N N N 84 GLN OXT O N N 85 GLN H H N N 86 GLN H2 H N N 87 GLN HA H N N 88 GLN HB2 H N N 89 GLN HB3 H N N 90 GLN HG2 H N N 91 GLN HG3 H N N 92 GLN HE21 H N N 93 GLN HE22 H N N 94 GLN HXT H N N 95 GLU N N N N 96 GLU CA C N S 97 GLU C C N N 98 GLU O O N N 99 GLU CB C N N 100 GLU CG C N N 101 GLU CD C N N 102 GLU OE1 O N N 103 GLU OE2 O N N 104 GLU OXT O N N 105 GLU H H N N 106 GLU H2 H N N 107 GLU HA H N N 108 GLU HB2 H N N 109 GLU HB3 H N N 110 GLU HG2 H N N 111 GLU HG3 H N N 112 GLU HE2 H N N 113 GLU HXT H N N 114 GLY N N N N 115 GLY CA C N N 116 GLY C C N N 117 GLY O O N N 118 GLY OXT O N N 119 GLY H H N N 120 GLY H2 H N N 121 GLY HA2 H N N 122 GLY HA3 H N N 123 GLY HXT H N N 124 HIS N N N N 125 HIS CA C N S 126 HIS C C N N 127 HIS O O N N 128 HIS CB C N N 129 HIS CG C Y N 130 HIS ND1 N Y N 131 HIS CD2 C Y N 132 HIS CE1 C Y N 133 HIS NE2 N Y N 134 HIS OXT O N N 135 HIS H H N N 136 HIS H2 H N N 137 HIS HA H N N 138 HIS HB2 H N N 139 HIS HB3 H N N 140 HIS HD1 H N N 141 HIS HD2 H N N 142 HIS HE1 H N N 143 HIS HE2 H N N 144 HIS HXT H N N 145 ILE N N N N 146 ILE CA C N S 147 ILE C C N N 148 ILE O O N N 149 ILE CB C N S 150 ILE CG1 C N N 151 ILE CG2 C N N 152 ILE CD1 C N N 153 ILE OXT O N N 154 ILE H H N N 155 ILE H2 H N N 156 ILE HA H N N 157 ILE HB H N N 158 ILE HG12 H N N 159 ILE HG13 H N N 160 ILE HG21 H N N 161 ILE HG22 H N N 162 ILE HG23 H N N 163 ILE HD11 H N N 164 ILE HD12 H N N 165 ILE HD13 H N N 166 ILE HXT H N N 167 LEU N N N N 168 LEU CA C N S 169 LEU C C N N 170 LEU O O N N 171 LEU CB C N N 172 LEU CG C N N 173 LEU CD1 C N N 174 LEU CD2 C N N 175 LEU OXT O N N 176 LEU H H N N 177 LEU H2 H N N 178 LEU HA H N N 179 LEU HB2 H N N 180 LEU HB3 H N N 181 LEU HG H N N 182 LEU HD11 H N N 183 LEU HD12 H N N 184 LEU HD13 H N N 185 LEU HD21 H N N 186 LEU HD22 H N N 187 LEU HD23 H N N 188 LEU HXT H N N 189 LYS N N N N 190 LYS CA C N S 191 LYS C C N N 192 LYS O O N N 193 LYS CB C N N 194 LYS CG C N N 195 LYS CD C N N 196 LYS CE C N N 197 LYS NZ N N N 198 LYS OXT O N N 199 LYS H H N N 200 LYS H2 H N N 201 LYS HA H N N 202 LYS HB2 H N N 203 LYS HB3 H N N 204 LYS HG2 H N N 205 LYS HG3 H N N 206 LYS HD2 H N N 207 LYS HD3 H N N 208 LYS HE2 H N N 209 LYS HE3 H N N 210 LYS HZ1 H N N 211 LYS HZ2 H N N 212 LYS HZ3 H N N 213 LYS HXT H N N 214 MET N N N N 215 MET CA C N S 216 MET C C N N 217 MET O O N N 218 MET CB C N N 219 MET CG C N N 220 MET SD S N N 221 MET CE C N N 222 MET OXT O N N 223 MET H H N N 224 MET H2 H N N 225 MET HA H N N 226 MET HB2 H N N 227 MET HB3 H N N 228 MET HG2 H N N 229 MET HG3 H N N 230 MET HE1 H N N 231 MET HE2 H N N 232 MET HE3 H N N 233 MET HXT H N N 234 PHE N N N N 235 PHE CA C N S 236 PHE C C N N 237 PHE O O N N 238 PHE CB C N N 239 PHE CG C Y N 240 PHE CD1 C Y N 241 PHE CD2 C Y N 242 PHE CE1 C Y N 243 PHE CE2 C Y N 244 PHE CZ C Y N 245 PHE OXT O N N 246 PHE H H N N 247 PHE H2 H N N 248 PHE HA H N N 249 PHE HB2 H N N 250 PHE HB3 H N N 251 PHE HD1 H N N 252 PHE HD2 H N N 253 PHE HE1 H N N 254 PHE HE2 H N N 255 PHE HZ H N N 256 PHE HXT H N N 257 PRO N N N N 258 PRO CA C N S 259 PRO C C N N 260 PRO O O N N 261 PRO CB C N N 262 PRO CG C N N 263 PRO CD C N N 264 PRO OXT O N N 265 PRO H H N N 266 PRO HA H N N 267 PRO HB2 H N N 268 PRO HB3 H N N 269 PRO HG2 H N N 270 PRO HG3 H N N 271 PRO HD2 H N N 272 PRO HD3 H N N 273 PRO HXT H N N 274 SER N N N N 275 SER CA C N S 276 SER C C N N 277 SER O O N N 278 SER CB C N N 279 SER OG O N N 280 SER OXT O N N 281 SER H H N N 282 SER H2 H N N 283 SER HA H N N 284 SER HB2 H N N 285 SER HB3 H N N 286 SER HG H N N 287 SER HXT H N N 288 THR N N N N 289 THR CA C N S 290 THR C C N N 291 THR O O N N 292 THR CB C N R 293 THR OG1 O N N 294 THR CG2 C N N 295 THR OXT O N N 296 THR H H N N 297 THR H2 H N N 298 THR HA H N N 299 THR HB H N N 300 THR HG1 H N N 301 THR HG21 H N N 302 THR HG22 H N N 303 THR HG23 H N N 304 THR HXT H N N 305 TRP N N N N 306 TRP CA C N S 307 TRP C C N N 308 TRP O O N N 309 TRP CB C N N 310 TRP CG C Y N 311 TRP CD1 C Y N 312 TRP CD2 C Y N 313 TRP NE1 N Y N 314 TRP CE2 C Y N 315 TRP CE3 C Y N 316 TRP CZ2 C Y N 317 TRP CZ3 C Y N 318 TRP CH2 C Y N 319 TRP OXT O N N 320 TRP H H N N 321 TRP H2 H N N 322 TRP HA H N N 323 TRP HB2 H N N 324 TRP HB3 H N N 325 TRP HD1 H N N 326 TRP HE1 H N N 327 TRP HE3 H N N 328 TRP HZ2 H N N 329 TRP HZ3 H N N 330 TRP HH2 H N N 331 TRP HXT H N N 332 TYR N N N N 333 TYR CA C N S 334 TYR C C N N 335 TYR O O N N 336 TYR CB C N N 337 TYR CG C Y N 338 TYR CD1 C Y N 339 TYR CD2 C Y N 340 TYR CE1 C Y N 341 TYR CE2 C Y N 342 TYR CZ C Y N 343 TYR OH O N N 344 TYR OXT O N N 345 TYR H H N N 346 TYR H2 H N N 347 TYR HA H N N 348 TYR HB2 H N N 349 TYR HB3 H N N 350 TYR HD1 H N N 351 TYR HD2 H N N 352 TYR HE1 H N N 353 TYR HE2 H N N 354 TYR HH H N N 355 TYR HXT H N N 356 VAL N N N N 357 VAL CA C N S 358 VAL C C N N 359 VAL O O N N 360 VAL CB C N N 361 VAL CG1 C N N 362 VAL CG2 C N N 363 VAL OXT O N N 364 VAL H H N N 365 VAL H2 H N N 366 VAL HA H N N 367 VAL HB H N N 368 VAL HG11 H N N 369 VAL HG12 H N N 370 VAL HG13 H N N 371 VAL HG21 H N N 372 VAL HG22 H N N 373 VAL HG23 H N N 374 VAL HXT H N N 375 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HIS N CA sing N N 116 HIS N H sing N N 117 HIS N H2 sing N N 118 HIS CA C sing N N 119 HIS CA CB sing N N 120 HIS CA HA sing N N 121 HIS C O doub N N 122 HIS C OXT sing N N 123 HIS CB CG sing N N 124 HIS CB HB2 sing N N 125 HIS CB HB3 sing N N 126 HIS CG ND1 sing Y N 127 HIS CG CD2 doub Y N 128 HIS ND1 CE1 doub Y N 129 HIS ND1 HD1 sing N N 130 HIS CD2 NE2 sing Y N 131 HIS CD2 HD2 sing N N 132 HIS CE1 NE2 sing Y N 133 HIS CE1 HE1 sing N N 134 HIS NE2 HE2 sing N N 135 HIS OXT HXT sing N N 136 ILE N CA sing N N 137 ILE N H sing N N 138 ILE N H2 sing N N 139 ILE CA C sing N N 140 ILE CA CB sing N N 141 ILE CA HA sing N N 142 ILE C O doub N N 143 ILE C OXT sing N N 144 ILE CB CG1 sing N N 145 ILE CB CG2 sing N N 146 ILE CB HB sing N N 147 ILE CG1 CD1 sing N N 148 ILE CG1 HG12 sing N N 149 ILE CG1 HG13 sing N N 150 ILE CG2 HG21 sing N N 151 ILE CG2 HG22 sing N N 152 ILE CG2 HG23 sing N N 153 ILE CD1 HD11 sing N N 154 ILE CD1 HD12 sing N N 155 ILE CD1 HD13 sing N N 156 ILE OXT HXT sing N N 157 LEU N CA sing N N 158 LEU N H sing N N 159 LEU N H2 sing N N 160 LEU CA C sing N N 161 LEU CA CB sing N N 162 LEU CA HA sing N N 163 LEU C O doub N N 164 LEU C OXT sing N N 165 LEU CB CG sing N N 166 LEU CB HB2 sing N N 167 LEU CB HB3 sing N N 168 LEU CG CD1 sing N N 169 LEU CG CD2 sing N N 170 LEU CG HG sing N N 171 LEU CD1 HD11 sing N N 172 LEU CD1 HD12 sing N N 173 LEU CD1 HD13 sing N N 174 LEU CD2 HD21 sing N N 175 LEU CD2 HD22 sing N N 176 LEU CD2 HD23 sing N N 177 LEU OXT HXT sing N N 178 LYS N CA sing N N 179 LYS N H sing N N 180 LYS N H2 sing N N 181 LYS CA C sing N N 182 LYS CA CB sing N N 183 LYS CA HA sing N N 184 LYS C O doub N N 185 LYS C OXT sing N N 186 LYS CB CG sing N N 187 LYS CB HB2 sing N N 188 LYS CB HB3 sing N N 189 LYS CG CD sing N N 190 LYS CG HG2 sing N N 191 LYS CG HG3 sing N N 192 LYS CD CE sing N N 193 LYS CD HD2 sing N N 194 LYS CD HD3 sing N N 195 LYS CE NZ sing N N 196 LYS CE HE2 sing N N 197 LYS CE HE3 sing N N 198 LYS NZ HZ1 sing N N 199 LYS NZ HZ2 sing N N 200 LYS NZ HZ3 sing N N 201 LYS OXT HXT sing N N 202 MET N CA sing N N 203 MET N H sing N N 204 MET N H2 sing N N 205 MET CA C sing N N 206 MET CA CB sing N N 207 MET CA HA sing N N 208 MET C O doub N N 209 MET C OXT sing N N 210 MET CB CG sing N N 211 MET CB HB2 sing N N 212 MET CB HB3 sing N N 213 MET CG SD sing N N 214 MET CG HG2 sing N N 215 MET CG HG3 sing N N 216 MET SD CE sing N N 217 MET CE HE1 sing N N 218 MET CE HE2 sing N N 219 MET CE HE3 sing N N 220 MET OXT HXT sing N N 221 PHE N CA sing N N 222 PHE N H sing N N 223 PHE N H2 sing N N 224 PHE CA C sing N N 225 PHE CA CB sing N N 226 PHE CA HA sing N N 227 PHE C O doub N N 228 PHE C OXT sing N N 229 PHE CB CG sing N N 230 PHE CB HB2 sing N N 231 PHE CB HB3 sing N N 232 PHE CG CD1 doub Y N 233 PHE CG CD2 sing Y N 234 PHE CD1 CE1 sing Y N 235 PHE CD1 HD1 sing N N 236 PHE CD2 CE2 doub Y N 237 PHE CD2 HD2 sing N N 238 PHE CE1 CZ doub Y N 239 PHE CE1 HE1 sing N N 240 PHE CE2 CZ sing Y N 241 PHE CE2 HE2 sing N N 242 PHE CZ HZ sing N N 243 PHE OXT HXT sing N N 244 PRO N CA sing N N 245 PRO N CD sing N N 246 PRO N H sing N N 247 PRO CA C sing N N 248 PRO CA CB sing N N 249 PRO CA HA sing N N 250 PRO C O doub N N 251 PRO C OXT sing N N 252 PRO CB CG sing N N 253 PRO CB HB2 sing N N 254 PRO CB HB3 sing N N 255 PRO CG CD sing N N 256 PRO CG HG2 sing N N 257 PRO CG HG3 sing N N 258 PRO CD HD2 sing N N 259 PRO CD HD3 sing N N 260 PRO OXT HXT sing N N 261 SER N CA sing N N 262 SER N H sing N N 263 SER N H2 sing N N 264 SER CA C sing N N 265 SER CA CB sing N N 266 SER CA HA sing N N 267 SER C O doub N N 268 SER C OXT sing N N 269 SER CB OG sing N N 270 SER CB HB2 sing N N 271 SER CB HB3 sing N N 272 SER OG HG sing N N 273 SER OXT HXT sing N N 274 THR N CA sing N N 275 THR N H sing N N 276 THR N H2 sing N N 277 THR CA C sing N N 278 THR CA CB sing N N 279 THR CA HA sing N N 280 THR C O doub N N 281 THR C OXT sing N N 282 THR CB OG1 sing N N 283 THR CB CG2 sing N N 284 THR CB HB sing N N 285 THR OG1 HG1 sing N N 286 THR CG2 HG21 sing N N 287 THR CG2 HG22 sing N N 288 THR CG2 HG23 sing N N 289 THR OXT HXT sing N N 290 TRP N CA sing N N 291 TRP N H sing N N 292 TRP N H2 sing N N 293 TRP CA C sing N N 294 TRP CA CB sing N N 295 TRP CA HA sing N N 296 TRP C O doub N N 297 TRP C OXT sing N N 298 TRP CB CG sing N N 299 TRP CB HB2 sing N N 300 TRP CB HB3 sing N N 301 TRP CG CD1 doub Y N 302 TRP CG CD2 sing Y N 303 TRP CD1 NE1 sing Y N 304 TRP CD1 HD1 sing N N 305 TRP CD2 CE2 doub Y N 306 TRP CD2 CE3 sing Y N 307 TRP NE1 CE2 sing Y N 308 TRP NE1 HE1 sing N N 309 TRP CE2 CZ2 sing Y N 310 TRP CE3 CZ3 doub Y N 311 TRP CE3 HE3 sing N N 312 TRP CZ2 CH2 doub Y N 313 TRP CZ2 HZ2 sing N N 314 TRP CZ3 CH2 sing Y N 315 TRP CZ3 HZ3 sing N N 316 TRP CH2 HH2 sing N N 317 TRP OXT HXT sing N N 318 TYR N CA sing N N 319 TYR N H sing N N 320 TYR N H2 sing N N 321 TYR CA C sing N N 322 TYR CA CB sing N N 323 TYR CA HA sing N N 324 TYR C O doub N N 325 TYR C OXT sing N N 326 TYR CB CG sing N N 327 TYR CB HB2 sing N N 328 TYR CB HB3 sing N N 329 TYR CG CD1 doub Y N 330 TYR CG CD2 sing Y N 331 TYR CD1 CE1 sing Y N 332 TYR CD1 HD1 sing N N 333 TYR CD2 CE2 doub Y N 334 TYR CD2 HD2 sing N N 335 TYR CE1 CZ doub Y N 336 TYR CE1 HE1 sing N N 337 TYR CE2 CZ sing Y N 338 TYR CE2 HE2 sing N N 339 TYR CZ OH sing N N 340 TYR OH HH sing N N 341 TYR OXT HXT sing N N 342 VAL N CA sing N N 343 VAL N H sing N N 344 VAL N H2 sing N N 345 VAL CA C sing N N 346 VAL CA CB sing N N 347 VAL CA HA sing N N 348 VAL C O doub N N 349 VAL C OXT sing N N 350 VAL CB CG1 sing N N 351 VAL CB CG2 sing N N 352 VAL CB HB sing N N 353 VAL CG1 HG11 sing N N 354 VAL CG1 HG12 sing N N 355 VAL CG1 HG13 sing N N 356 VAL CG2 HG21 sing N N 357 VAL CG2 HG22 sing N N 358 VAL CG2 HG23 sing N N 359 VAL OXT HXT sing N N 360 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute of General Medical Sciences (NIH/NIGMS)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number GM095315 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 4TKQ _atom_sites.fract_transf_matrix[1][1] 0.016163 _atom_sites.fract_transf_matrix[1][2] 0.009332 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018663 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.003467 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C CA CL N O S # loop_