data_4TRL # _entry.id 4TRL # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.398 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4TRL pdb_00004trl 10.2210/pdb4trl/pdb WWPDB D_1000202167 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2014-07-02 2 'Structure model' 1 1 2017-11-22 3 'Structure model' 1 2 2023-12-27 4 'Structure model' 1 3 2024-11-06 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' 4 2 'Structure model' Other 5 2 'Structure model' 'Refinement description' 6 2 'Structure model' 'Source and taxonomy' 7 2 'Structure model' 'Structure summary' 8 3 'Structure model' 'Data collection' 9 3 'Structure model' 'Database references' 10 3 'Structure model' 'Refinement description' 11 4 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' citation 2 2 'Structure model' diffrn_source 3 2 'Structure model' entity_src_gen 4 2 'Structure model' pdbx_database_status 5 2 'Structure model' pdbx_struct_assembly 6 2 'Structure model' pdbx_struct_assembly_prop 7 2 'Structure model' pdbx_struct_oper_list 8 2 'Structure model' software 9 2 'Structure model' struct_keywords 10 3 'Structure model' chem_comp_atom 11 3 'Structure model' chem_comp_bond 12 3 'Structure model' database_2 13 3 'Structure model' refine_hist 14 4 'Structure model' pdbx_entry_details 15 4 'Structure model' pdbx_modification_feature # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_citation.journal_id_CSD' 2 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 3 2 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 4 2 'Structure model' '_pdbx_database_status.pdb_format_compatible' 5 2 'Structure model' '_pdbx_struct_assembly.oligomeric_details' 6 2 'Structure model' '_pdbx_struct_assembly_prop.type' 7 2 'Structure model' '_pdbx_struct_assembly_prop.value' 8 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 9 2 'Structure model' '_struct_keywords.text' 10 3 'Structure model' '_database_2.pdbx_DOI' 11 3 'Structure model' '_database_2.pdbx_database_accession' 12 3 'Structure model' '_refine_hist.pdbx_number_atoms_nucleic_acid' 13 3 'Structure model' '_refine_hist.pdbx_number_atoms_protein' # _pdbx_database_PDB_obs_spr.id SPRSDE _pdbx_database_PDB_obs_spr.date 2014-07-02 _pdbx_database_PDB_obs_spr.pdb_id 4TRL _pdbx_database_PDB_obs_spr.replace_pdb_id 4P2W _pdbx_database_PDB_obs_spr.details ? # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4TRL _pdbx_database_status.recvd_initial_deposition_date 2014-06-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Wei, Q.' 1 'Wang, N.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structure of Ephrin type-A receptor 2' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Wei, Q.' 1 ? primary 'Wang, N.' 2 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Ephrin type-A receptor 2' 34107.156 1 2.7.10.1 ? 'UNP residues 590-876' ? 2 water nat water 18.015 43 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Epithelial cell kinase,Tyrosine-protein kinase receptor ECK' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;MGSSHHHHHHSQDPHTYEDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQR VDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVH RDLAARNILVNSNLVCKVSDFGLSRVLEDDPEAT(PTR)TTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTY GERPYWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIR ; _entity_poly.pdbx_seq_one_letter_code_can ;MGSSHHHHHHSQDPHTYEDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQR VDFLGEAGIMGQFSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVH RDLAARNILVNSNLVCKVSDFGLSRVLEDDPEATYTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERP YWELSNHEVMKAINDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIR ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 GLY n 1 3 SER n 1 4 SER n 1 5 HIS n 1 6 HIS n 1 7 HIS n 1 8 HIS n 1 9 HIS n 1 10 HIS n 1 11 SER n 1 12 GLN n 1 13 ASP n 1 14 PRO n 1 15 HIS n 1 16 THR n 1 17 TYR n 1 18 GLU n 1 19 ASP n 1 20 PRO n 1 21 ASN n 1 22 GLN n 1 23 ALA n 1 24 VAL n 1 25 LEU n 1 26 LYS n 1 27 PHE n 1 28 THR n 1 29 THR n 1 30 GLU n 1 31 ILE n 1 32 HIS n 1 33 PRO n 1 34 SER n 1 35 CYS n 1 36 VAL n 1 37 THR n 1 38 ARG n 1 39 GLN n 1 40 LYS n 1 41 VAL n 1 42 ILE n 1 43 GLY n 1 44 ALA n 1 45 GLY n 1 46 GLU n 1 47 PHE n 1 48 GLY n 1 49 GLU n 1 50 VAL n 1 51 TYR n 1 52 LYS n 1 53 GLY n 1 54 MET n 1 55 LEU n 1 56 LYS n 1 57 THR n 1 58 SER n 1 59 SER n 1 60 GLY n 1 61 LYS n 1 62 LYS n 1 63 GLU n 1 64 VAL n 1 65 PRO n 1 66 VAL n 1 67 ALA n 1 68 ILE n 1 69 LYS n 1 70 THR n 1 71 LEU n 1 72 LYS n 1 73 ALA n 1 74 GLY n 1 75 TYR n 1 76 THR n 1 77 GLU n 1 78 LYS n 1 79 GLN n 1 80 ARG n 1 81 VAL n 1 82 ASP n 1 83 PHE n 1 84 LEU n 1 85 GLY n 1 86 GLU n 1 87 ALA n 1 88 GLY n 1 89 ILE n 1 90 MET n 1 91 GLY n 1 92 GLN n 1 93 PHE n 1 94 SER n 1 95 HIS n 1 96 HIS n 1 97 ASN n 1 98 ILE n 1 99 ILE n 1 100 ARG n 1 101 LEU n 1 102 GLU n 1 103 GLY n 1 104 VAL n 1 105 ILE n 1 106 SER n 1 107 LYS n 1 108 TYR n 1 109 LYS n 1 110 PRO n 1 111 MET n 1 112 MET n 1 113 ILE n 1 114 ILE n 1 115 THR n 1 116 GLU n 1 117 TYR n 1 118 MET n 1 119 GLU n 1 120 ASN n 1 121 GLY n 1 122 ALA n 1 123 LEU n 1 124 ASP n 1 125 LYS n 1 126 PHE n 1 127 LEU n 1 128 ARG n 1 129 GLU n 1 130 LYS n 1 131 ASP n 1 132 GLY n 1 133 GLU n 1 134 PHE n 1 135 SER n 1 136 VAL n 1 137 LEU n 1 138 GLN n 1 139 LEU n 1 140 VAL n 1 141 GLY n 1 142 MET n 1 143 LEU n 1 144 ARG n 1 145 GLY n 1 146 ILE n 1 147 ALA n 1 148 ALA n 1 149 GLY n 1 150 MET n 1 151 LYS n 1 152 TYR n 1 153 LEU n 1 154 ALA n 1 155 ASN n 1 156 MET n 1 157 ASN n 1 158 TYR n 1 159 VAL n 1 160 HIS n 1 161 ARG n 1 162 ASP n 1 163 LEU n 1 164 ALA n 1 165 ALA n 1 166 ARG n 1 167 ASN n 1 168 ILE n 1 169 LEU n 1 170 VAL n 1 171 ASN n 1 172 SER n 1 173 ASN n 1 174 LEU n 1 175 VAL n 1 176 CYS n 1 177 LYS n 1 178 VAL n 1 179 SER n 1 180 ASP n 1 181 PHE n 1 182 GLY n 1 183 LEU n 1 184 SER n 1 185 ARG n 1 186 VAL n 1 187 LEU n 1 188 GLU n 1 189 ASP n 1 190 ASP n 1 191 PRO n 1 192 GLU n 1 193 ALA n 1 194 THR n 1 195 PTR n 1 196 THR n 1 197 THR n 1 198 SER n 1 199 GLY n 1 200 GLY n 1 201 LYS n 1 202 ILE n 1 203 PRO n 1 204 ILE n 1 205 ARG n 1 206 TRP n 1 207 THR n 1 208 ALA n 1 209 PRO n 1 210 GLU n 1 211 ALA n 1 212 ILE n 1 213 SER n 1 214 TYR n 1 215 ARG n 1 216 LYS n 1 217 PHE n 1 218 THR n 1 219 SER n 1 220 ALA n 1 221 SER n 1 222 ASP n 1 223 VAL n 1 224 TRP n 1 225 SER n 1 226 PHE n 1 227 GLY n 1 228 ILE n 1 229 VAL n 1 230 MET n 1 231 TRP n 1 232 GLU n 1 233 VAL n 1 234 MET n 1 235 THR n 1 236 TYR n 1 237 GLY n 1 238 GLU n 1 239 ARG n 1 240 PRO n 1 241 TYR n 1 242 TRP n 1 243 GLU n 1 244 LEU n 1 245 SER n 1 246 ASN n 1 247 HIS n 1 248 GLU n 1 249 VAL n 1 250 MET n 1 251 LYS n 1 252 ALA n 1 253 ILE n 1 254 ASN n 1 255 ASP n 1 256 GLY n 1 257 PHE n 1 258 ARG n 1 259 LEU n 1 260 PRO n 1 261 THR n 1 262 PRO n 1 263 MET n 1 264 ASP n 1 265 CYS n 1 266 PRO n 1 267 SER n 1 268 ALA n 1 269 ILE n 1 270 TYR n 1 271 GLN n 1 272 LEU n 1 273 MET n 1 274 MET n 1 275 GLN n 1 276 CYS n 1 277 TRP n 1 278 GLN n 1 279 GLN n 1 280 GLU n 1 281 ARG n 1 282 ALA n 1 283 ARG n 1 284 ARG n 1 285 PRO n 1 286 LYS n 1 287 PHE n 1 288 ALA n 1 289 ASP n 1 290 ILE n 1 291 VAL n 1 292 SER n 1 293 ILE n 1 294 LEU n 1 295 ASP n 1 296 LYS n 1 297 LEU n 1 298 ILE n 1 299 ARG n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 299 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'EPHA2, ECK' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ArcticExpress _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 PTR 'L-peptide linking' n O-PHOSPHOTYROSINE PHOSPHONOTYROSINE 'C9 H12 N O6 P' 261.168 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 578 ? ? ? A . n A 1 2 GLY 2 579 ? ? ? A . n A 1 3 SER 3 580 ? ? ? A . n A 1 4 SER 4 581 ? ? ? A . n A 1 5 HIS 5 582 ? ? ? A . n A 1 6 HIS 6 583 ? ? ? A . n A 1 7 HIS 7 584 ? ? ? A . n A 1 8 HIS 8 585 ? ? ? A . n A 1 9 HIS 9 586 ? ? ? A . n A 1 10 HIS 10 587 ? ? ? A . n A 1 11 SER 11 588 ? ? ? A . n A 1 12 GLN 12 589 ? ? ? A . n A 1 13 ASP 13 590 ? ? ? A . n A 1 14 PRO 14 591 ? ? ? A . n A 1 15 HIS 15 592 ? ? ? A . n A 1 16 THR 16 593 ? ? ? A . n A 1 17 TYR 17 594 ? ? ? A . n A 1 18 GLU 18 595 ? ? ? A . n A 1 19 ASP 19 596 ? ? ? A . n A 1 20 PRO 20 597 ? ? ? A . n A 1 21 ASN 21 598 ? ? ? A . n A 1 22 GLN 22 599 599 GLN GLN A . n A 1 23 ALA 23 600 600 ALA ALA A . n A 1 24 VAL 24 601 601 VAL VAL A . n A 1 25 LEU 25 602 602 LEU LEU A . n A 1 26 LYS 26 603 603 LYS LYS A . n A 1 27 PHE 27 604 604 PHE PHE A . n A 1 28 THR 28 605 605 THR THR A . n A 1 29 THR 29 606 606 THR THR A . n A 1 30 GLU 30 607 607 GLU GLU A . n A 1 31 ILE 31 608 608 ILE ILE A . n A 1 32 HIS 32 609 609 HIS HIS A . n A 1 33 PRO 33 610 610 PRO PRO A . n A 1 34 SER 34 611 611 SER SER A . n A 1 35 CYS 35 612 612 CYS CYS A . n A 1 36 VAL 36 613 613 VAL VAL A . n A 1 37 THR 37 614 614 THR THR A . n A 1 38 ARG 38 615 615 ARG ARG A . n A 1 39 GLN 39 616 616 GLN GLN A . n A 1 40 LYS 40 617 617 LYS LYS A . n A 1 41 VAL 41 618 618 VAL VAL A . n A 1 42 ILE 42 619 619 ILE ILE A . n A 1 43 GLY 43 620 620 GLY GLY A . n A 1 44 ALA 44 621 621 ALA ALA A . n A 1 45 GLY 45 622 622 GLY GLY A . n A 1 46 GLU 46 623 623 GLU GLU A . n A 1 47 PHE 47 624 624 PHE PHE A . n A 1 48 GLY 48 625 625 GLY GLY A . n A 1 49 GLU 49 626 626 GLU GLU A . n A 1 50 VAL 50 627 627 VAL VAL A . n A 1 51 TYR 51 628 628 TYR TYR A . n A 1 52 LYS 52 629 629 LYS LYS A . n A 1 53 GLY 53 630 630 GLY GLY A . n A 1 54 MET 54 631 631 MET MET A . n A 1 55 LEU 55 632 632 LEU LEU A . n A 1 56 LYS 56 633 633 LYS LYS A . n A 1 57 THR 57 634 634 THR THR A . n A 1 58 SER 58 635 ? ? ? A . n A 1 59 SER 59 636 ? ? ? A . n A 1 60 GLY 60 637 ? ? ? A . n A 1 61 LYS 61 638 ? ? ? A . n A 1 62 LYS 62 639 ? ? ? A . n A 1 63 GLU 63 640 640 GLU GLU A . n A 1 64 VAL 64 641 641 VAL VAL A . n A 1 65 PRO 65 642 642 PRO PRO A . n A 1 66 VAL 66 643 643 VAL VAL A . n A 1 67 ALA 67 644 644 ALA ALA A . n A 1 68 ILE 68 645 645 ILE ILE A . n A 1 69 LYS 69 646 646 LYS LYS A . n A 1 70 THR 70 647 647 THR THR A . n A 1 71 LEU 71 648 648 LEU LEU A . n A 1 72 LYS 72 649 649 LYS LYS A . n A 1 73 ALA 73 650 ? ? ? A . n A 1 74 GLY 74 651 651 GLY GLY A . n A 1 75 TYR 75 652 652 TYR TYR A . n A 1 76 THR 76 653 653 THR THR A . n A 1 77 GLU 77 654 ? ? ? A . n A 1 78 LYS 78 655 655 LYS LYS A . n A 1 79 GLN 79 656 656 GLN GLN A . n A 1 80 ARG 80 657 657 ARG ARG A . n A 1 81 VAL 81 658 658 VAL VAL A . n A 1 82 ASP 82 659 659 ASP ASP A . n A 1 83 PHE 83 660 660 PHE PHE A . n A 1 84 LEU 84 661 661 LEU LEU A . n A 1 85 GLY 85 662 662 GLY GLY A . n A 1 86 GLU 86 663 663 GLU GLU A . n A 1 87 ALA 87 664 664 ALA ALA A . n A 1 88 GLY 88 665 665 GLY GLY A . n A 1 89 ILE 89 666 666 ILE ILE A . n A 1 90 MET 90 667 667 MET MET A . n A 1 91 GLY 91 668 668 GLY GLY A . n A 1 92 GLN 92 669 669 GLN GLN A . n A 1 93 PHE 93 670 670 PHE PHE A . n A 1 94 SER 94 671 671 SER SER A . n A 1 95 HIS 95 672 672 HIS HIS A . n A 1 96 HIS 96 673 673 HIS HIS A . n A 1 97 ASN 97 674 674 ASN ASN A . n A 1 98 ILE 98 675 675 ILE ILE A . n A 1 99 ILE 99 676 676 ILE ILE A . n A 1 100 ARG 100 677 677 ARG ARG A . n A 1 101 LEU 101 678 678 LEU LEU A . n A 1 102 GLU 102 679 679 GLU GLU A . n A 1 103 GLY 103 680 680 GLY GLY A . n A 1 104 VAL 104 681 681 VAL VAL A . n A 1 105 ILE 105 682 682 ILE ILE A . n A 1 106 SER 106 683 683 SER SER A . n A 1 107 LYS 107 684 684 LYS LYS A . n A 1 108 TYR 108 685 685 TYR TYR A . n A 1 109 LYS 109 686 686 LYS LYS A . n A 1 110 PRO 110 687 687 PRO PRO A . n A 1 111 MET 111 688 688 MET MET A . n A 1 112 MET 112 689 689 MET MET A . n A 1 113 ILE 113 690 690 ILE ILE A . n A 1 114 ILE 114 691 691 ILE ILE A . n A 1 115 THR 115 692 692 THR THR A . n A 1 116 GLU 116 693 693 GLU GLU A . n A 1 117 TYR 117 694 694 TYR TYR A . n A 1 118 MET 118 695 695 MET MET A . n A 1 119 GLU 119 696 696 GLU GLU A . n A 1 120 ASN 120 697 697 ASN ASN A . n A 1 121 GLY 121 698 698 GLY GLY A . n A 1 122 ALA 122 699 699 ALA ALA A . n A 1 123 LEU 123 700 700 LEU LEU A . n A 1 124 ASP 124 701 701 ASP ASP A . n A 1 125 LYS 125 702 702 LYS LYS A . n A 1 126 PHE 126 703 703 PHE PHE A . n A 1 127 LEU 127 704 704 LEU LEU A . n A 1 128 ARG 128 705 705 ARG ARG A . n A 1 129 GLU 129 706 706 GLU GLU A . n A 1 130 LYS 130 707 707 LYS LYS A . n A 1 131 ASP 131 708 708 ASP ASP A . n A 1 132 GLY 132 709 709 GLY GLY A . n A 1 133 GLU 133 710 710 GLU GLU A . n A 1 134 PHE 134 711 711 PHE PHE A . n A 1 135 SER 135 712 712 SER SER A . n A 1 136 VAL 136 713 713 VAL VAL A . n A 1 137 LEU 137 714 714 LEU LEU A . n A 1 138 GLN 138 715 715 GLN GLN A . n A 1 139 LEU 139 716 716 LEU LEU A . n A 1 140 VAL 140 717 717 VAL VAL A . n A 1 141 GLY 141 718 718 GLY GLY A . n A 1 142 MET 142 719 719 MET MET A . n A 1 143 LEU 143 720 720 LEU LEU A . n A 1 144 ARG 144 721 721 ARG ARG A . n A 1 145 GLY 145 722 722 GLY GLY A . n A 1 146 ILE 146 723 723 ILE ILE A . n A 1 147 ALA 147 724 724 ALA ALA A . n A 1 148 ALA 148 725 725 ALA ALA A . n A 1 149 GLY 149 726 726 GLY GLY A . n A 1 150 MET 150 727 727 MET MET A . n A 1 151 LYS 151 728 728 LYS LYS A . n A 1 152 TYR 152 729 729 TYR TYR A . n A 1 153 LEU 153 730 730 LEU LEU A . n A 1 154 ALA 154 731 731 ALA ALA A . n A 1 155 ASN 155 732 732 ASN ASN A . n A 1 156 MET 156 733 733 MET MET A . n A 1 157 ASN 157 734 734 ASN ASN A . n A 1 158 TYR 158 735 735 TYR TYR A . n A 1 159 VAL 159 736 736 VAL VAL A . n A 1 160 HIS 160 737 737 HIS HIS A . n A 1 161 ARG 161 738 738 ARG ARG A . n A 1 162 ASP 162 739 739 ASP ASP A . n A 1 163 LEU 163 740 740 LEU LEU A . n A 1 164 ALA 164 741 741 ALA ALA A . n A 1 165 ALA 165 742 742 ALA ALA A . n A 1 166 ARG 166 743 743 ARG ARG A . n A 1 167 ASN 167 744 744 ASN ASN A . n A 1 168 ILE 168 745 745 ILE ILE A . n A 1 169 LEU 169 746 746 LEU LEU A . n A 1 170 VAL 170 747 747 VAL VAL A . n A 1 171 ASN 171 748 748 ASN ASN A . n A 1 172 SER 172 749 749 SER SER A . n A 1 173 ASN 173 750 750 ASN ASN A . n A 1 174 LEU 174 751 751 LEU LEU A . n A 1 175 VAL 175 752 752 VAL VAL A . n A 1 176 CYS 176 753 753 CYS CYS A . n A 1 177 LYS 177 754 754 LYS LYS A . n A 1 178 VAL 178 755 755 VAL VAL A . n A 1 179 SER 179 756 756 SER SER A . n A 1 180 ASP 180 757 757 ASP ASP A . n A 1 181 PHE 181 758 758 PHE PHE A . n A 1 182 GLY 182 759 759 GLY GLY A . n A 1 183 LEU 183 760 760 LEU LEU A . n A 1 184 SER 184 761 761 SER SER A . n A 1 185 ARG 185 762 762 ARG ARG A . n A 1 186 VAL 186 763 763 VAL VAL A . n A 1 187 LEU 187 764 764 LEU LEU A . n A 1 188 GLU 188 765 765 GLU GLU A . n A 1 189 ASP 189 766 ? ? ? A . n A 1 190 ASP 190 767 767 ASP ASP A . n A 1 191 PRO 191 768 768 PRO PRO A . n A 1 192 GLU 192 769 769 GLU GLU A . n A 1 193 ALA 193 770 770 ALA ALA A . n A 1 194 THR 194 771 771 THR THR A . n A 1 195 PTR 195 772 772 PTR PTR A . n A 1 196 THR 196 773 773 THR THR A . n A 1 197 THR 197 774 774 THR THR A . n A 1 198 SER 198 775 775 SER SER A . n A 1 199 GLY 199 776 776 GLY GLY A . n A 1 200 GLY 200 777 777 GLY GLY A . n A 1 201 LYS 201 778 778 LYS LYS A . n A 1 202 ILE 202 779 779 ILE ILE A . n A 1 203 PRO 203 780 780 PRO PRO A . n A 1 204 ILE 204 781 781 ILE ILE A . n A 1 205 ARG 205 782 782 ARG ARG A . n A 1 206 TRP 206 783 783 TRP TRP A . n A 1 207 THR 207 784 784 THR THR A . n A 1 208 ALA 208 785 785 ALA ALA A . n A 1 209 PRO 209 786 786 PRO PRO A . n A 1 210 GLU 210 787 787 GLU GLU A . n A 1 211 ALA 211 788 788 ALA ALA A . n A 1 212 ILE 212 789 789 ILE ILE A . n A 1 213 SER 213 790 790 SER SER A . n A 1 214 TYR 214 791 791 TYR TYR A . n A 1 215 ARG 215 792 792 ARG ARG A . n A 1 216 LYS 216 793 793 LYS LYS A . n A 1 217 PHE 217 794 794 PHE PHE A . n A 1 218 THR 218 795 795 THR THR A . n A 1 219 SER 219 796 796 SER SER A . n A 1 220 ALA 220 797 797 ALA ALA A . n A 1 221 SER 221 798 798 SER SER A . n A 1 222 ASP 222 799 799 ASP ASP A . n A 1 223 VAL 223 800 800 VAL VAL A . n A 1 224 TRP 224 801 801 TRP TRP A . n A 1 225 SER 225 802 802 SER SER A . n A 1 226 PHE 226 803 803 PHE PHE A . n A 1 227 GLY 227 804 804 GLY GLY A . n A 1 228 ILE 228 805 805 ILE ILE A . n A 1 229 VAL 229 806 806 VAL VAL A . n A 1 230 MET 230 807 807 MET MET A . n A 1 231 TRP 231 808 808 TRP TRP A . n A 1 232 GLU 232 809 809 GLU GLU A . n A 1 233 VAL 233 810 810 VAL VAL A . n A 1 234 MET 234 811 811 MET MET A . n A 1 235 THR 235 812 812 THR THR A . n A 1 236 TYR 236 813 813 TYR TYR A . n A 1 237 GLY 237 814 814 GLY GLY A . n A 1 238 GLU 238 815 815 GLU GLU A . n A 1 239 ARG 239 816 816 ARG ARG A . n A 1 240 PRO 240 817 817 PRO PRO A . n A 1 241 TYR 241 818 818 TYR TYR A . n A 1 242 TRP 242 819 819 TRP TRP A . n A 1 243 GLU 243 820 820 GLU GLU A . n A 1 244 LEU 244 821 821 LEU LEU A . n A 1 245 SER 245 822 822 SER SER A . n A 1 246 ASN 246 823 823 ASN ASN A . n A 1 247 HIS 247 824 824 HIS HIS A . n A 1 248 GLU 248 825 825 GLU GLU A . n A 1 249 VAL 249 826 826 VAL VAL A . n A 1 250 MET 250 827 827 MET MET A . n A 1 251 LYS 251 828 828 LYS LYS A . n A 1 252 ALA 252 829 829 ALA ALA A . n A 1 253 ILE 253 830 830 ILE ILE A . n A 1 254 ASN 254 831 831 ASN ASN A . n A 1 255 ASP 255 832 832 ASP ASP A . n A 1 256 GLY 256 833 833 GLY GLY A . n A 1 257 PHE 257 834 834 PHE PHE A . n A 1 258 ARG 258 835 835 ARG ARG A . n A 1 259 LEU 259 836 836 LEU LEU A . n A 1 260 PRO 260 837 837 PRO PRO A . n A 1 261 THR 261 838 838 THR THR A . n A 1 262 PRO 262 839 839 PRO PRO A . n A 1 263 MET 263 840 840 MET MET A . n A 1 264 ASP 264 841 841 ASP ASP A . n A 1 265 CYS 265 842 842 CYS CYS A . n A 1 266 PRO 266 843 843 PRO PRO A . n A 1 267 SER 267 844 844 SER SER A . n A 1 268 ALA 268 845 845 ALA ALA A . n A 1 269 ILE 269 846 846 ILE ILE A . n A 1 270 TYR 270 847 847 TYR TYR A . n A 1 271 GLN 271 848 848 GLN GLN A . n A 1 272 LEU 272 849 849 LEU LEU A . n A 1 273 MET 273 850 850 MET MET A . n A 1 274 MET 274 851 851 MET MET A . n A 1 275 GLN 275 852 852 GLN GLN A . n A 1 276 CYS 276 853 853 CYS CYS A . n A 1 277 TRP 277 854 854 TRP TRP A . n A 1 278 GLN 278 855 855 GLN GLN A . n A 1 279 GLN 279 856 856 GLN GLN A . n A 1 280 GLU 280 857 857 GLU GLU A . n A 1 281 ARG 281 858 858 ARG ARG A . n A 1 282 ALA 282 859 859 ALA ALA A . n A 1 283 ARG 283 860 860 ARG ARG A . n A 1 284 ARG 284 861 861 ARG ARG A . n A 1 285 PRO 285 862 862 PRO PRO A . n A 1 286 LYS 286 863 863 LYS LYS A . n A 1 287 PHE 287 864 864 PHE PHE A . n A 1 288 ALA 288 865 865 ALA ALA A . n A 1 289 ASP 289 866 866 ASP ASP A . n A 1 290 ILE 290 867 867 ILE ILE A . n A 1 291 VAL 291 868 868 VAL VAL A . n A 1 292 SER 292 869 869 SER SER A . n A 1 293 ILE 293 870 870 ILE ILE A . n A 1 294 LEU 294 871 871 LEU LEU A . n A 1 295 ASP 295 872 872 ASP ASP A . n A 1 296 LYS 296 873 873 LYS LYS A . n A 1 297 LEU 297 874 874 LEU LEU A . n A 1 298 ILE 298 875 875 ILE ILE A . n A 1 299 ARG 299 876 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 901 1 HOH HOH A . B 2 HOH 2 902 36 HOH HOH A . B 2 HOH 3 903 13 HOH HOH A . B 2 HOH 4 904 73 HOH HOH A . B 2 HOH 5 905 33 HOH HOH A . B 2 HOH 6 906 3 HOH HOH A . B 2 HOH 7 907 16 HOH HOH A . B 2 HOH 8 908 1 HOH HOH A . B 2 HOH 9 909 2 HOH HOH A . B 2 HOH 10 910 3 HOH HOH A . B 2 HOH 11 911 4 HOH HOH A . B 2 HOH 12 912 6 HOH HOH A . B 2 HOH 13 913 7 HOH HOH A . B 2 HOH 14 914 8 HOH HOH A . B 2 HOH 15 915 9 HOH HOH A . B 2 HOH 16 916 11 HOH HOH A . B 2 HOH 17 917 12 HOH HOH A . B 2 HOH 18 918 15 HOH HOH A . B 2 HOH 19 919 20 HOH HOH A . B 2 HOH 20 920 21 HOH HOH A . B 2 HOH 21 921 22 HOH HOH A . B 2 HOH 22 922 23 HOH HOH A . B 2 HOH 23 923 26 HOH HOH A . B 2 HOH 24 924 27 HOH HOH A . B 2 HOH 25 925 28 HOH HOH A . B 2 HOH 26 926 30 HOH HOH A . B 2 HOH 27 927 35 HOH HOH A . B 2 HOH 28 928 40 HOH HOH A . B 2 HOH 29 929 46 HOH HOH A . B 2 HOH 30 930 51 HOH HOH A . B 2 HOH 31 931 54 HOH HOH A . B 2 HOH 32 932 67 HOH HOH A . B 2 HOH 33 933 2 HOH HOH A . B 2 HOH 34 934 5 HOH HOH A . B 2 HOH 35 935 25 HOH HOH A . B 2 HOH 36 936 88 HOH HOH A . B 2 HOH 37 937 5 HOH HOH A . B 2 HOH 38 938 32 HOH HOH A . B 2 HOH 39 939 26 HOH HOH A . B 2 HOH 40 940 28 HOH HOH A . B 2 HOH 41 941 32 HOH HOH A . B 2 HOH 42 942 83 HOH HOH A . B 2 HOH 43 943 65 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.14 3 # _cell.length_a 74.028 _cell.length_b 74.028 _cell.length_c 101.950 _cell.angle_alpha 90.000 _cell.angle_beta 90.000 _cell.angle_gamma 120.000 _cell.entry_id 4TRL _cell.Z_PDB 6 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4TRL _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4TRL _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.37 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 48.10 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.0 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1M HEPES, 0.2M Li2SO4, 20% (w/v) PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 193 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-11-06 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NW12A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline AR-NW12A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate 48.810 _reflns.entry_id 4TRL _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.450 _reflns.d_resolution_low 30.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 12263 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.800 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.700 _reflns.pdbx_Rmerge_I_obs 0.092 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 29.175 _reflns.pdbx_netI_over_sigmaI 12.300 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 2.212 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 69357 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.450 2.490 ? ? ? ? ? 588 ? 100.000 ? ? ? ? 0.697 ? ? ? ? ? ? ? ? 5.700 ? 1.753 ? ? ? ? 0 1 1 ? ? 2.490 2.540 ? ? ? ? ? 621 ? 100.000 ? ? ? ? 0.703 ? ? ? ? ? ? ? ? 5.800 ? 1.699 ? ? ? ? 0 2 1 ? ? 2.540 2.590 ? ? ? ? ? 580 ? 100.000 ? ? ? ? 0.626 ? ? ? ? ? ? ? ? 5.700 ? 1.734 ? ? ? ? 0 3 1 ? ? 2.590 2.640 ? ? ? ? ? 639 ? 100.000 ? ? ? ? 0.542 ? ? ? ? ? ? ? ? 5.800 ? 1.688 ? ? ? ? 0 4 1 ? ? 2.640 2.700 ? ? ? ? ? 565 ? 100.000 ? ? ? ? 0.409 ? ? ? ? ? ? ? ? 5.700 ? 1.733 ? ? ? ? 0 5 1 ? ? 2.700 2.760 ? ? ? ? ? 617 ? 100.000 ? ? ? ? 0.437 ? ? ? ? ? ? ? ? 5.800 ? 1.674 ? ? ? ? 0 6 1 ? ? 2.760 2.830 ? ? ? ? ? 612 ? 100.000 ? ? ? ? 0.316 ? ? ? ? ? ? ? ? 5.800 ? 1.726 ? ? ? ? 0 7 1 ? ? 2.830 2.900 ? ? ? ? ? 596 ? 100.000 ? ? ? ? 0.248 ? ? ? ? ? ? ? ? 5.800 ? 1.731 ? ? ? ? 0 8 1 ? ? 2.900 2.990 ? ? ? ? ? 608 ? 100.000 ? ? ? ? 0.225 ? ? ? ? ? ? ? ? 5.800 ? 1.770 ? ? ? ? 0 9 1 ? ? 2.990 3.090 ? ? ? ? ? 614 ? 100.000 ? ? ? ? 0.175 ? ? ? ? ? ? ? ? 5.700 ? 1.969 ? ? ? ? 0 10 1 ? ? 3.090 3.200 ? ? ? ? ? 605 ? 100.000 ? ? ? ? 0.143 ? ? ? ? ? ? ? ? 5.900 ? 1.952 ? ? ? ? 0 11 1 ? ? 3.200 3.320 ? ? ? ? ? 606 ? 100.000 ? ? ? ? 0.117 ? ? ? ? ? ? ? ? 5.900 ? 2.116 ? ? ? ? 0 12 1 ? ? 3.320 3.480 ? ? ? ? ? 606 ? 100.000 ? ? ? ? 0.098 ? ? ? ? ? ? ? ? 5.800 ? 2.562 ? ? ? ? 0 13 1 ? ? 3.480 3.660 ? ? ? ? ? 617 ? 100.000 ? ? ? ? 0.080 ? ? ? ? ? ? ? ? 5.800 ? 2.612 ? ? ? ? 0 14 1 ? ? 3.660 3.890 ? ? ? ? ? 624 ? 99.800 ? ? ? ? 0.073 ? ? ? ? ? ? ? ? 5.500 ? 3.172 ? ? ? ? 0 15 1 ? ? 3.890 4.190 ? ? ? ? ? 611 ? 100.000 ? ? ? ? 0.059 ? ? ? ? ? ? ? ? 5.400 ? 2.963 ? ? ? ? 0 16 1 ? ? 4.190 4.610 ? ? ? ? ? 629 ? 99.800 ? ? ? ? 0.054 ? ? ? ? ? ? ? ? 5.200 ? 3.358 ? ? ? ? 0 17 1 ? ? 4.610 5.270 ? ? ? ? ? 629 ? 99.400 ? ? ? ? 0.046 ? ? ? ? ? ? ? ? 5.500 ? 2.687 ? ? ? ? 0 18 1 ? ? 5.270 6.630 ? ? ? ? ? 628 ? 99.400 ? ? ? ? 0.052 ? ? ? ? ? ? ? ? 5.600 ? 2.613 ? ? ? ? 0 19 1 ? ? 6.630 30.000 ? ? ? ? ? 668 ? 97.200 ? ? ? ? 0.042 ? ? ? ? ? ? ? ? 5.000 ? 2.951 ? ? ? ? 0 20 1 ? ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 108.190 _refine.B_iso_mean 38.6400 _refine.B_iso_min 15.280 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4TRL _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.4520 _refine.ls_d_res_low 30.0 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 12226 _refine.ls_number_reflns_R_free 584 _refine.ls_number_reflns_R_work 11642 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.3800 _refine.ls_percent_reflns_R_free 4.7800 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2015 _refine.ls_R_factor_R_free 0.2503 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1990 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.350 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 29.5100 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3600 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.7593 # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.4520 _refine_hist.d_res_low 30.0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 43 _refine_hist.number_atoms_total 2189 _refine_hist.pdbx_number_residues_total 269 _refine_hist.pdbx_B_iso_mean_solvent 34.91 _refine_hist.pdbx_number_atoms_protein 2146 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.008 ? 2189 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.190 ? 2949 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.078 ? 324 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 369 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 15.860 ? 818 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error 'X-RAY DIFFRACTION' 2.452 2.6984 2957 . 138 2819 98.0000 . . . 0.3800 . 0.2709 . . . . . . 4 . 'X-RAY DIFFRACTION' 2.6984 3.0885 3044 . 163 2881 100.0000 . . . 0.3047 . 0.2328 . . . . . . 4 . 'X-RAY DIFFRACTION' 3.0885 3.8899 3056 . 149 2907 100.0000 . . . 0.2554 . 0.1909 . . . . . . 4 . 'X-RAY DIFFRACTION' 3.8899 30.0280 3169 . 134 3035 99.0000 . . . 0.2083 . 0.1815 . . . . . . 4 . # _struct.entry_id 4TRL _struct.title 'Structure of Ephrin type-A receptor 2' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4TRL _struct_keywords.text 'active state, phosphorylated, TRANSFERASE' _struct_keywords.pdbx_keywords TRANSFERASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code EPHA2_HUMAN _struct_ref.pdbx_db_accession P29317 _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;DPHTYEDPNQAVLKFTTEIHPSCVTRQKVIGAGEFGEVYKGMLKTSSGKKEVPVAIKTLKAGYTEKQRVDFLGEAGIMGQ FSHHNIIRLEGVISKYKPMMIITEYMENGALDKFLREKDGEFSVLQLVGMLRGIAAGMKYLANMNYVHRDLAARNILVNS NLVCKVSDFGLSRVLEDDPEATYTTSGGKIPIRWTAPEAISYRKFTSASDVWSFGIVMWEVMTYGERPYWELSNHEVMKA INDGFRLPTPMDCPSAIYQLMMQCWQQERARRPKFADIVSILDKLIR ; _struct_ref.pdbx_align_begin 590 _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4TRL _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 13 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 299 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P29317 _struct_ref_seq.db_align_beg 590 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 876 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 590 _struct_ref_seq.pdbx_auth_seq_align_end 876 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4TRL MET A 1 ? UNP P29317 ? ? 'initiating methionine' 578 1 1 4TRL GLY A 2 ? UNP P29317 ? ? 'expression tag' 579 2 1 4TRL SER A 3 ? UNP P29317 ? ? 'expression tag' 580 3 1 4TRL SER A 4 ? UNP P29317 ? ? 'expression tag' 581 4 1 4TRL HIS A 5 ? UNP P29317 ? ? 'expression tag' 582 5 1 4TRL HIS A 6 ? UNP P29317 ? ? 'expression tag' 583 6 1 4TRL HIS A 7 ? UNP P29317 ? ? 'expression tag' 584 7 1 4TRL HIS A 8 ? UNP P29317 ? ? 'expression tag' 585 8 1 4TRL HIS A 9 ? UNP P29317 ? ? 'expression tag' 586 9 1 4TRL HIS A 10 ? UNP P29317 ? ? 'expression tag' 587 10 1 4TRL SER A 11 ? UNP P29317 ? ? 'expression tag' 588 11 1 4TRL GLN A 12 ? UNP P29317 ? ? 'expression tag' 589 12 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 13340 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 HIS A 32 ? SER A 34 ? HIS A 609 SER A 611 5 ? 3 HELX_P HELX_P2 AA2 GLN A 79 ? GLY A 91 ? GLN A 656 GLY A 668 1 ? 13 HELX_P HELX_P3 AA3 ALA A 122 ? LYS A 130 ? ALA A 699 LYS A 707 1 ? 9 HELX_P HELX_P4 AA4 SER A 135 ? MET A 156 ? SER A 712 MET A 733 1 ? 22 HELX_P HELX_P5 AA5 ALA A 164 ? ARG A 166 ? ALA A 741 ARG A 743 5 ? 3 HELX_P HELX_P6 AA6 PRO A 203 ? THR A 207 ? PRO A 780 THR A 784 5 ? 5 HELX_P HELX_P7 AA7 ALA A 208 ? TYR A 214 ? ALA A 785 TYR A 791 1 ? 7 HELX_P HELX_P8 AA8 THR A 218 ? THR A 235 ? THR A 795 THR A 812 1 ? 18 HELX_P HELX_P9 AA9 SER A 245 ? ASN A 254 ? SER A 822 ASN A 831 1 ? 10 HELX_P HELX_P10 AB1 PRO A 266 ? TRP A 277 ? PRO A 843 TRP A 854 1 ? 12 HELX_P HELX_P11 AB2 GLU A 280 ? ARG A 284 ? GLU A 857 ARG A 861 5 ? 5 HELX_P HELX_P12 AB3 LYS A 286 ? ILE A 298 ? LYS A 863 ILE A 875 1 ? 13 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A THR 194 C ? ? ? 1_555 A PTR 195 N ? ? A THR 771 A PTR 772 1_555 ? ? ? ? ? ? ? 1.328 ? ? covale2 covale both ? A PTR 195 C ? ? ? 1_555 A THR 196 N ? ? A PTR 772 A THR 773 1_555 ? ? ? ? ? ? ? 1.330 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _pdbx_modification_feature.ordinal 1 _pdbx_modification_feature.label_comp_id PTR _pdbx_modification_feature.label_asym_id A _pdbx_modification_feature.label_seq_id 195 _pdbx_modification_feature.label_alt_id ? _pdbx_modification_feature.modified_residue_label_comp_id . _pdbx_modification_feature.modified_residue_label_asym_id . _pdbx_modification_feature.modified_residue_label_seq_id . _pdbx_modification_feature.modified_residue_label_alt_id . _pdbx_modification_feature.auth_comp_id PTR _pdbx_modification_feature.auth_asym_id A _pdbx_modification_feature.auth_seq_id 772 _pdbx_modification_feature.PDB_ins_code ? _pdbx_modification_feature.symmetry 1_555 _pdbx_modification_feature.modified_residue_auth_comp_id . _pdbx_modification_feature.modified_residue_auth_asym_id . _pdbx_modification_feature.modified_residue_auth_seq_id . _pdbx_modification_feature.modified_residue_PDB_ins_code . _pdbx_modification_feature.modified_residue_symmetry . _pdbx_modification_feature.comp_id_linking_atom . _pdbx_modification_feature.modified_residue_id_linking_atom . _pdbx_modification_feature.modified_residue_id TYR _pdbx_modification_feature.ref_pcm_id 1 _pdbx_modification_feature.ref_comp_id PTR _pdbx_modification_feature.type Phosphorylation _pdbx_modification_feature.category 'Named protein modification' # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ALA 23 A . ? ALA 600 A VAL 24 A ? VAL 601 A 1 -6.52 2 LYS 26 A . ? LYS 603 A PHE 27 A ? PHE 604 A 1 -1.19 3 LYS 109 A . ? LYS 686 A PRO 110 A ? PRO 687 A 1 -4.47 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 2 ? AA3 ? 2 ? AA4 ? 2 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA4 1 2 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 36 ? ALA A 44 ? VAL A 613 ALA A 621 AA1 2 GLU A 49 ? LEU A 55 ? GLU A 626 LEU A 632 AA1 3 VAL A 64 ? THR A 70 ? VAL A 641 THR A 647 AA1 4 MET A 112 ? GLU A 116 ? MET A 689 GLU A 693 AA1 5 LEU A 101 ? ILE A 105 ? LEU A 678 ILE A 682 AA2 1 TYR A 158 ? VAL A 159 ? TYR A 735 VAL A 736 AA2 2 ARG A 185 ? VAL A 186 ? ARG A 762 VAL A 763 AA3 1 ILE A 168 ? VAL A 170 ? ILE A 745 VAL A 747 AA3 2 CYS A 176 ? VAL A 178 ? CYS A 753 VAL A 755 AA4 1 PTR A 195 ? THR A 196 ? PTR A 772 THR A 773 AA4 2 LYS A 216 ? PHE A 217 ? LYS A 793 PHE A 794 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N ILE A 42 ? N ILE A 619 O VAL A 50 ? O VAL A 627 AA1 2 3 N GLY A 53 ? N GLY A 630 O VAL A 66 ? O VAL A 643 AA1 3 4 N LYS A 69 ? N LYS A 646 O ILE A 113 ? O ILE A 690 AA1 4 5 O ILE A 114 ? O ILE A 691 N GLY A 103 ? N GLY A 680 AA2 1 2 N VAL A 159 ? N VAL A 736 O ARG A 185 ? O ARG A 762 AA3 1 2 N LEU A 169 ? N LEU A 746 O LYS A 177 ? O LYS A 754 AA4 1 2 N PTR A 195 ? N PTR A 772 O PHE A 217 ? O PHE A 794 # _pdbx_entry_details.entry_id 4TRL _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PHE A 604 ? ? -93.57 59.85 2 1 ASP A 739 ? ? -145.19 28.24 3 1 TRP A 819 ? ? 62.75 -123.09 # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id A _pdbx_struct_mod_residue.label_comp_id PTR _pdbx_struct_mod_residue.label_seq_id 195 _pdbx_struct_mod_residue.auth_asym_id A _pdbx_struct_mod_residue.auth_comp_id PTR _pdbx_struct_mod_residue.auth_seq_id 772 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id TYR _pdbx_struct_mod_residue.details 'modified residue' # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 578 ? A MET 1 2 1 Y 1 A GLY 579 ? A GLY 2 3 1 Y 1 A SER 580 ? A SER 3 4 1 Y 1 A SER 581 ? A SER 4 5 1 Y 1 A HIS 582 ? A HIS 5 6 1 Y 1 A HIS 583 ? A HIS 6 7 1 Y 1 A HIS 584 ? A HIS 7 8 1 Y 1 A HIS 585 ? A HIS 8 9 1 Y 1 A HIS 586 ? A HIS 9 10 1 Y 1 A HIS 587 ? A HIS 10 11 1 Y 1 A SER 588 ? A SER 11 12 1 Y 1 A GLN 589 ? A GLN 12 13 1 Y 1 A ASP 590 ? A ASP 13 14 1 Y 1 A PRO 591 ? A PRO 14 15 1 Y 1 A HIS 592 ? A HIS 15 16 1 Y 1 A THR 593 ? A THR 16 17 1 Y 1 A TYR 594 ? A TYR 17 18 1 Y 1 A GLU 595 ? A GLU 18 19 1 Y 1 A ASP 596 ? A ASP 19 20 1 Y 1 A PRO 597 ? A PRO 20 21 1 Y 1 A ASN 598 ? A ASN 21 22 1 Y 1 A SER 635 ? A SER 58 23 1 Y 1 A SER 636 ? A SER 59 24 1 Y 1 A GLY 637 ? A GLY 60 25 1 Y 1 A LYS 638 ? A LYS 61 26 1 Y 1 A LYS 639 ? A LYS 62 27 1 Y 1 A ALA 650 ? A ALA 73 28 1 Y 1 A GLU 654 ? A GLU 77 29 1 Y 1 A ASP 766 ? A ASP 189 30 1 Y 1 A ARG 876 ? A ARG 299 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 PTR N N N N 290 PTR CA C N S 291 PTR C C N N 292 PTR O O N N 293 PTR OXT O N N 294 PTR CB C N N 295 PTR CG C Y N 296 PTR CD1 C Y N 297 PTR CD2 C Y N 298 PTR CE1 C Y N 299 PTR CE2 C Y N 300 PTR CZ C Y N 301 PTR OH O N N 302 PTR P P N N 303 PTR O1P O N N 304 PTR O2P O N N 305 PTR O3P O N N 306 PTR H H N N 307 PTR H2 H N N 308 PTR HA H N N 309 PTR HXT H N N 310 PTR HB2 H N N 311 PTR HB3 H N N 312 PTR HD1 H N N 313 PTR HD2 H N N 314 PTR HE1 H N N 315 PTR HE2 H N N 316 PTR HO2P H N N 317 PTR HO3P H N N 318 SER N N N N 319 SER CA C N S 320 SER C C N N 321 SER O O N N 322 SER CB C N N 323 SER OG O N N 324 SER OXT O N N 325 SER H H N N 326 SER H2 H N N 327 SER HA H N N 328 SER HB2 H N N 329 SER HB3 H N N 330 SER HG H N N 331 SER HXT H N N 332 THR N N N N 333 THR CA C N S 334 THR C C N N 335 THR O O N N 336 THR CB C N R 337 THR OG1 O N N 338 THR CG2 C N N 339 THR OXT O N N 340 THR H H N N 341 THR H2 H N N 342 THR HA H N N 343 THR HB H N N 344 THR HG1 H N N 345 THR HG21 H N N 346 THR HG22 H N N 347 THR HG23 H N N 348 THR HXT H N N 349 TRP N N N N 350 TRP CA C N S 351 TRP C C N N 352 TRP O O N N 353 TRP CB C N N 354 TRP CG C Y N 355 TRP CD1 C Y N 356 TRP CD2 C Y N 357 TRP NE1 N Y N 358 TRP CE2 C Y N 359 TRP CE3 C Y N 360 TRP CZ2 C Y N 361 TRP CZ3 C Y N 362 TRP CH2 C Y N 363 TRP OXT O N N 364 TRP H H N N 365 TRP H2 H N N 366 TRP HA H N N 367 TRP HB2 H N N 368 TRP HB3 H N N 369 TRP HD1 H N N 370 TRP HE1 H N N 371 TRP HE3 H N N 372 TRP HZ2 H N N 373 TRP HZ3 H N N 374 TRP HH2 H N N 375 TRP HXT H N N 376 TYR N N N N 377 TYR CA C N S 378 TYR C C N N 379 TYR O O N N 380 TYR CB C N N 381 TYR CG C Y N 382 TYR CD1 C Y N 383 TYR CD2 C Y N 384 TYR CE1 C Y N 385 TYR CE2 C Y N 386 TYR CZ C Y N 387 TYR OH O N N 388 TYR OXT O N N 389 TYR H H N N 390 TYR H2 H N N 391 TYR HA H N N 392 TYR HB2 H N N 393 TYR HB3 H N N 394 TYR HD1 H N N 395 TYR HD2 H N N 396 TYR HE1 H N N 397 TYR HE2 H N N 398 TYR HH H N N 399 TYR HXT H N N 400 VAL N N N N 401 VAL CA C N S 402 VAL C C N N 403 VAL O O N N 404 VAL CB C N N 405 VAL CG1 C N N 406 VAL CG2 C N N 407 VAL OXT O N N 408 VAL H H N N 409 VAL H2 H N N 410 VAL HA H N N 411 VAL HB H N N 412 VAL HG11 H N N 413 VAL HG12 H N N 414 VAL HG13 H N N 415 VAL HG21 H N N 416 VAL HG22 H N N 417 VAL HG23 H N N 418 VAL HXT H N N 419 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 PTR N CA sing N N 277 PTR N H sing N N 278 PTR N H2 sing N N 279 PTR CA C sing N N 280 PTR CA CB sing N N 281 PTR CA HA sing N N 282 PTR C O doub N N 283 PTR C OXT sing N N 284 PTR OXT HXT sing N N 285 PTR CB CG sing N N 286 PTR CB HB2 sing N N 287 PTR CB HB3 sing N N 288 PTR CG CD1 doub Y N 289 PTR CG CD2 sing Y N 290 PTR CD1 CE1 sing Y N 291 PTR CD1 HD1 sing N N 292 PTR CD2 CE2 doub Y N 293 PTR CD2 HD2 sing N N 294 PTR CE1 CZ doub Y N 295 PTR CE1 HE1 sing N N 296 PTR CE2 CZ sing Y N 297 PTR CE2 HE2 sing N N 298 PTR CZ OH sing N N 299 PTR OH P sing N N 300 PTR P O1P doub N N 301 PTR P O2P sing N N 302 PTR P O3P sing N N 303 PTR O2P HO2P sing N N 304 PTR O3P HO3P sing N N 305 SER N CA sing N N 306 SER N H sing N N 307 SER N H2 sing N N 308 SER CA C sing N N 309 SER CA CB sing N N 310 SER CA HA sing N N 311 SER C O doub N N 312 SER C OXT sing N N 313 SER CB OG sing N N 314 SER CB HB2 sing N N 315 SER CB HB3 sing N N 316 SER OG HG sing N N 317 SER OXT HXT sing N N 318 THR N CA sing N N 319 THR N H sing N N 320 THR N H2 sing N N 321 THR CA C sing N N 322 THR CA CB sing N N 323 THR CA HA sing N N 324 THR C O doub N N 325 THR C OXT sing N N 326 THR CB OG1 sing N N 327 THR CB CG2 sing N N 328 THR CB HB sing N N 329 THR OG1 HG1 sing N N 330 THR CG2 HG21 sing N N 331 THR CG2 HG22 sing N N 332 THR CG2 HG23 sing N N 333 THR OXT HXT sing N N 334 TRP N CA sing N N 335 TRP N H sing N N 336 TRP N H2 sing N N 337 TRP CA C sing N N 338 TRP CA CB sing N N 339 TRP CA HA sing N N 340 TRP C O doub N N 341 TRP C OXT sing N N 342 TRP CB CG sing N N 343 TRP CB HB2 sing N N 344 TRP CB HB3 sing N N 345 TRP CG CD1 doub Y N 346 TRP CG CD2 sing Y N 347 TRP CD1 NE1 sing Y N 348 TRP CD1 HD1 sing N N 349 TRP CD2 CE2 doub Y N 350 TRP CD2 CE3 sing Y N 351 TRP NE1 CE2 sing Y N 352 TRP NE1 HE1 sing N N 353 TRP CE2 CZ2 sing Y N 354 TRP CE3 CZ3 doub Y N 355 TRP CE3 HE3 sing N N 356 TRP CZ2 CH2 doub Y N 357 TRP CZ2 HZ2 sing N N 358 TRP CZ3 CH2 sing Y N 359 TRP CZ3 HZ3 sing N N 360 TRP CH2 HH2 sing N N 361 TRP OXT HXT sing N N 362 TYR N CA sing N N 363 TYR N H sing N N 364 TYR N H2 sing N N 365 TYR CA C sing N N 366 TYR CA CB sing N N 367 TYR CA HA sing N N 368 TYR C O doub N N 369 TYR C OXT sing N N 370 TYR CB CG sing N N 371 TYR CB HB2 sing N N 372 TYR CB HB3 sing N N 373 TYR CG CD1 doub Y N 374 TYR CG CD2 sing Y N 375 TYR CD1 CE1 sing Y N 376 TYR CD1 HD1 sing N N 377 TYR CD2 CE2 doub Y N 378 TYR CD2 HD2 sing N N 379 TYR CE1 CZ doub Y N 380 TYR CE1 HE1 sing N N 381 TYR CE2 CZ sing Y N 382 TYR CE2 HE2 sing N N 383 TYR CZ OH sing N N 384 TYR OH HH sing N N 385 TYR OXT HXT sing N N 386 VAL N CA sing N N 387 VAL N H sing N N 388 VAL N H2 sing N N 389 VAL CA C sing N N 390 VAL CA CB sing N N 391 VAL CA HA sing N N 392 VAL C O doub N N 393 VAL C OXT sing N N 394 VAL CB CG1 sing N N 395 VAL CB CG2 sing N N 396 VAL CB HB sing N N 397 VAL CG1 HG11 sing N N 398 VAL CG1 HG12 sing N N 399 VAL CG1 HG13 sing N N 400 VAL CG2 HG21 sing N N 401 VAL CG2 HG22 sing N N 402 VAL CG2 HG23 sing N N 403 VAL OXT HXT sing N N 404 # _atom_sites.entry_id 4TRL _atom_sites.fract_transf_matrix[1][1] 0.013508 _atom_sites.fract_transf_matrix[1][2] 0.007799 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.015598 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009809 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O P S # loop_ #