data_4XWU # _entry.id 4XWU # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.383 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4XWU pdb_00004xwu 10.2210/pdb4xwu/pdb WWPDB D_1000205854 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-07-22 2 'Structure model' 1 1 2015-11-11 3 'Structure model' 1 2 2024-01-10 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 4 3 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4XWU _pdbx_database_status.recvd_initial_deposition_date 2015-01-29 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBE _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Buey, R.M.' 1 'Ledesma-Amaro, R.' 2 'Balsera, M.' 3 'de Pereda, J.M.' 4 'Revuelta, J.L.' 5 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country GW _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Appl.Microbiol.Biotechnol. _citation.journal_id_ASTM AMBIDG _citation.journal_id_CSD 0786 _citation.journal_id_ISSN 1432-0614 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 99 _citation.language ? _citation.page_first 9577 _citation.page_last 9589 _citation.title ;Increased riboflavin production by manipulation of inosine 5'-monophosphate dehydrogenase in Ashbya gossypii. ; _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1007/s00253-015-6710-2 _citation.pdbx_database_id_PubMed 26150243 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Buey, R.M.' 1 ? primary 'Ledesma-Amaro, R.' 2 ? primary 'Balsera, M.' 3 ? primary 'de Pereda, J.M.' 4 ? primary 'Revuelta, J.L.' 5 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man ;Inosine-5'-monophosphate dehydrogenase,Inosine-5'-monophosphate dehydrogenase ; 44528.555 1 1.1.1.205,1.1.1.205 ;The CBS domain (residues 120-325) has been replaced by the sequence stretch SQDG. Residues numbered according to the full-length wild-type sequence,The CBS domain (residues 120-325) has been replaced by the sequence stretch SQDG. Residues numbered according to the full-length wild-type sequence ; 'UNP residues 1-119,UNP residues 236-522' ? 2 water nat water 18.015 95 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name IMPDH,IMPDH # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GSHMTYRDAATALEHLATYAEKDGLSVEQLMDSKTRGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMD TVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENGSQDGPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEA GLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTA VYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRDGKRLKTYRGMGSIDAMQKTDVK GNAATSRYFSESDKVLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGG VHNLHSYEKRLFD ; _entity_poly.pdbx_seq_one_letter_code_can ;GSHMTYRDAATALEHLATYAEKDGLSVEQLMDSKTRGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMD TVTEADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENGSQDGPLASKSADTKQLLCGAAIGTIDADRQRLAMLVEA GLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAASLIHAGADGLRIGMGSGSICITQEVMACGRPQGTA VYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAGTTESPGEYFFRDGKRLKTYRGMGSIDAMQKTDVK GNAATSRYFSESDKVLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSCQDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGG VHNLHSYEKRLFD ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 HIS n 1 4 MET n 1 5 THR n 1 6 TYR n 1 7 ARG n 1 8 ASP n 1 9 ALA n 1 10 ALA n 1 11 THR n 1 12 ALA n 1 13 LEU n 1 14 GLU n 1 15 HIS n 1 16 LEU n 1 17 ALA n 1 18 THR n 1 19 TYR n 1 20 ALA n 1 21 GLU n 1 22 LYS n 1 23 ASP n 1 24 GLY n 1 25 LEU n 1 26 SER n 1 27 VAL n 1 28 GLU n 1 29 GLN n 1 30 LEU n 1 31 MET n 1 32 ASP n 1 33 SER n 1 34 LYS n 1 35 THR n 1 36 ARG n 1 37 GLY n 1 38 GLY n 1 39 LEU n 1 40 THR n 1 41 TYR n 1 42 ASN n 1 43 ASP n 1 44 PHE n 1 45 LEU n 1 46 VAL n 1 47 LEU n 1 48 PRO n 1 49 GLY n 1 50 LYS n 1 51 ILE n 1 52 ASP n 1 53 PHE n 1 54 PRO n 1 55 SER n 1 56 SER n 1 57 GLU n 1 58 VAL n 1 59 VAL n 1 60 LEU n 1 61 SER n 1 62 SER n 1 63 ARG n 1 64 LEU n 1 65 THR n 1 66 LYS n 1 67 LYS n 1 68 ILE n 1 69 THR n 1 70 LEU n 1 71 ASN n 1 72 ALA n 1 73 PRO n 1 74 PHE n 1 75 VAL n 1 76 SER n 1 77 SER n 1 78 PRO n 1 79 MET n 1 80 ASP n 1 81 THR n 1 82 VAL n 1 83 THR n 1 84 GLU n 1 85 ALA n 1 86 ASP n 1 87 MET n 1 88 ALA n 1 89 ILE n 1 90 HIS n 1 91 MET n 1 92 ALA n 1 93 LEU n 1 94 LEU n 1 95 GLY n 1 96 GLY n 1 97 ILE n 1 98 GLY n 1 99 ILE n 1 100 ILE n 1 101 HIS n 1 102 HIS n 1 103 ASN n 1 104 CYS n 1 105 THR n 1 106 ALA n 1 107 GLU n 1 108 GLU n 1 109 GLN n 1 110 ALA n 1 111 GLU n 1 112 MET n 1 113 VAL n 1 114 ARG n 1 115 ARG n 1 116 VAL n 1 117 LYS n 1 118 LYS n 1 119 TYR n 1 120 GLU n 1 121 ASN n 1 122 GLY n 1 123 SER n 1 124 GLN n 1 125 ASP n 1 126 GLY n 1 127 PRO n 1 128 LEU n 1 129 ALA n 1 130 SER n 1 131 LYS n 1 132 SER n 1 133 ALA n 1 134 ASP n 1 135 THR n 1 136 LYS n 1 137 GLN n 1 138 LEU n 1 139 LEU n 1 140 CYS n 1 141 GLY n 1 142 ALA n 1 143 ALA n 1 144 ILE n 1 145 GLY n 1 146 THR n 1 147 ILE n 1 148 ASP n 1 149 ALA n 1 150 ASP n 1 151 ARG n 1 152 GLN n 1 153 ARG n 1 154 LEU n 1 155 ALA n 1 156 MET n 1 157 LEU n 1 158 VAL n 1 159 GLU n 1 160 ALA n 1 161 GLY n 1 162 LEU n 1 163 ASP n 1 164 VAL n 1 165 VAL n 1 166 VAL n 1 167 LEU n 1 168 ASP n 1 169 SER n 1 170 SER n 1 171 GLN n 1 172 GLY n 1 173 ASN n 1 174 SER n 1 175 VAL n 1 176 PHE n 1 177 GLN n 1 178 ILE n 1 179 ASN n 1 180 MET n 1 181 ILE n 1 182 LYS n 1 183 TRP n 1 184 ILE n 1 185 LYS n 1 186 GLU n 1 187 THR n 1 188 PHE n 1 189 PRO n 1 190 ASP n 1 191 LEU n 1 192 GLN n 1 193 VAL n 1 194 ILE n 1 195 ALA n 1 196 GLY n 1 197 ASN n 1 198 VAL n 1 199 VAL n 1 200 THR n 1 201 ARG n 1 202 GLU n 1 203 GLN n 1 204 ALA n 1 205 ALA n 1 206 SER n 1 207 LEU n 1 208 ILE n 1 209 HIS n 1 210 ALA n 1 211 GLY n 1 212 ALA n 1 213 ASP n 1 214 GLY n 1 215 LEU n 1 216 ARG n 1 217 ILE n 1 218 GLY n 1 219 MET n 1 220 GLY n 1 221 SER n 1 222 GLY n 1 223 SER n 1 224 ILE n 1 225 CYS n 1 226 ILE n 1 227 THR n 1 228 GLN n 1 229 GLU n 1 230 VAL n 1 231 MET n 1 232 ALA n 1 233 CYS n 1 234 GLY n 1 235 ARG n 1 236 PRO n 1 237 GLN n 1 238 GLY n 1 239 THR n 1 240 ALA n 1 241 VAL n 1 242 TYR n 1 243 ASN n 1 244 VAL n 1 245 THR n 1 246 GLN n 1 247 PHE n 1 248 ALA n 1 249 ASN n 1 250 GLN n 1 251 PHE n 1 252 GLY n 1 253 VAL n 1 254 PRO n 1 255 CYS n 1 256 ILE n 1 257 ALA n 1 258 ASP n 1 259 GLY n 1 260 GLY n 1 261 VAL n 1 262 GLN n 1 263 ASN n 1 264 ILE n 1 265 GLY n 1 266 HIS n 1 267 ILE n 1 268 THR n 1 269 LYS n 1 270 ALA n 1 271 ILE n 1 272 ALA n 1 273 LEU n 1 274 GLY n 1 275 ALA n 1 276 SER n 1 277 THR n 1 278 VAL n 1 279 MET n 1 280 MET n 1 281 GLY n 1 282 GLY n 1 283 MET n 1 284 LEU n 1 285 ALA n 1 286 GLY n 1 287 THR n 1 288 THR n 1 289 GLU n 1 290 SER n 1 291 PRO n 1 292 GLY n 1 293 GLU n 1 294 TYR n 1 295 PHE n 1 296 PHE n 1 297 ARG n 1 298 ASP n 1 299 GLY n 1 300 LYS n 1 301 ARG n 1 302 LEU n 1 303 LYS n 1 304 THR n 1 305 TYR n 1 306 ARG n 1 307 GLY n 1 308 MET n 1 309 GLY n 1 310 SER n 1 311 ILE n 1 312 ASP n 1 313 ALA n 1 314 MET n 1 315 GLN n 1 316 LYS n 1 317 THR n 1 318 ASP n 1 319 VAL n 1 320 LYS n 1 321 GLY n 1 322 ASN n 1 323 ALA n 1 324 ALA n 1 325 THR n 1 326 SER n 1 327 ARG n 1 328 TYR n 1 329 PHE n 1 330 SER n 1 331 GLU n 1 332 SER n 1 333 ASP n 1 334 LYS n 1 335 VAL n 1 336 LEU n 1 337 VAL n 1 338 ALA n 1 339 GLN n 1 340 GLY n 1 341 VAL n 1 342 THR n 1 343 GLY n 1 344 SER n 1 345 VAL n 1 346 ILE n 1 347 ASP n 1 348 LYS n 1 349 GLY n 1 350 SER n 1 351 ILE n 1 352 LYS n 1 353 LYS n 1 354 TYR n 1 355 ILE n 1 356 PRO n 1 357 TYR n 1 358 LEU n 1 359 TYR n 1 360 ASN n 1 361 GLY n 1 362 LEU n 1 363 GLN n 1 364 HIS n 1 365 SER n 1 366 CYS n 1 367 GLN n 1 368 ASP n 1 369 ILE n 1 370 GLY n 1 371 VAL n 1 372 ARG n 1 373 SER n 1 374 LEU n 1 375 VAL n 1 376 GLU n 1 377 PHE n 1 378 ARG n 1 379 GLU n 1 380 LYS n 1 381 VAL n 1 382 ASP n 1 383 SER n 1 384 GLY n 1 385 SER n 1 386 VAL n 1 387 ARG n 1 388 PHE n 1 389 GLU n 1 390 PHE n 1 391 ARG n 1 392 THR n 1 393 PRO n 1 394 SER n 1 395 ALA n 1 396 GLN n 1 397 LEU n 1 398 GLU n 1 399 GLY n 1 400 GLY n 1 401 VAL n 1 402 HIS n 1 403 ASN n 1 404 LEU n 1 405 HIS n 1 406 SER n 1 407 TYR n 1 408 GLU n 1 409 LYS n 1 410 ARG n 1 411 LEU n 1 412 PHE n 1 413 ASP n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 122 Yeast ? AGOS_AER117W ? ? ? ? ? ? 'Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)' 284811 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 1 2 sample 'Biological sequence' 127 800 Yeast ? AGOS_AER117W ? ? ? ? ? ? 'Ashbya gossypii (strain ATCC 10895 / CBS 109.51 / FGSC 9923 / NRRL Y-1056)' 284811 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 -2 ? ? ? A . n A 1 2 SER 2 -1 ? ? ? A . n A 1 3 HIS 3 0 ? ? ? A . n A 1 4 MET 4 1 ? ? ? A . n A 1 5 THR 5 2 2 THR THR A . n A 1 6 TYR 6 3 3 TYR TYR A . n A 1 7 ARG 7 4 4 ARG ARG A . n A 1 8 ASP 8 5 5 ASP ASP A . n A 1 9 ALA 9 6 6 ALA ALA A . n A 1 10 ALA 10 7 7 ALA ALA A . n A 1 11 THR 11 8 8 THR THR A . n A 1 12 ALA 12 9 9 ALA ALA A . n A 1 13 LEU 13 10 10 LEU LEU A . n A 1 14 GLU 14 11 11 GLU GLU A . n A 1 15 HIS 15 12 12 HIS HIS A . n A 1 16 LEU 16 13 13 LEU LEU A . n A 1 17 ALA 17 14 14 ALA ALA A . n A 1 18 THR 18 15 15 THR THR A . n A 1 19 TYR 19 16 16 TYR TYR A . n A 1 20 ALA 20 17 17 ALA ALA A . n A 1 21 GLU 21 18 18 GLU GLU A . n A 1 22 LYS 22 19 19 LYS LYS A . n A 1 23 ASP 23 20 20 ASP ASP A . n A 1 24 GLY 24 21 21 GLY GLY A . n A 1 25 LEU 25 22 22 LEU LEU A . n A 1 26 SER 26 23 23 SER SER A . n A 1 27 VAL 27 24 24 VAL VAL A . n A 1 28 GLU 28 25 25 GLU GLU A . n A 1 29 GLN 29 26 26 GLN GLN A . n A 1 30 LEU 30 27 27 LEU LEU A . n A 1 31 MET 31 28 28 MET MET A . n A 1 32 ASP 32 29 29 ASP ASP A . n A 1 33 SER 33 30 30 SER SER A . n A 1 34 LYS 34 31 31 LYS LYS A . n A 1 35 THR 35 32 32 THR THR A . n A 1 36 ARG 36 33 33 ARG ARG A . n A 1 37 GLY 37 34 34 GLY GLY A . n A 1 38 GLY 38 35 35 GLY GLY A . n A 1 39 LEU 39 36 36 LEU LEU A . n A 1 40 THR 40 37 37 THR THR A . n A 1 41 TYR 41 38 38 TYR TYR A . n A 1 42 ASN 42 39 39 ASN ASN A . n A 1 43 ASP 43 40 40 ASP ASP A . n A 1 44 PHE 44 41 41 PHE PHE A . n A 1 45 LEU 45 42 42 LEU LEU A . n A 1 46 VAL 46 43 43 VAL VAL A . n A 1 47 LEU 47 44 44 LEU LEU A . n A 1 48 PRO 48 45 45 PRO PRO A . n A 1 49 GLY 49 46 46 GLY GLY A . n A 1 50 LYS 50 47 47 LYS LYS A . n A 1 51 ILE 51 48 48 ILE ILE A . n A 1 52 ASP 52 49 49 ASP ASP A . n A 1 53 PHE 53 50 50 PHE PHE A . n A 1 54 PRO 54 51 51 PRO PRO A . n A 1 55 SER 55 52 52 SER SER A . n A 1 56 SER 56 53 53 SER SER A . n A 1 57 GLU 57 54 54 GLU GLU A . n A 1 58 VAL 58 55 55 VAL VAL A . n A 1 59 VAL 59 56 56 VAL VAL A . n A 1 60 LEU 60 57 57 LEU LEU A . n A 1 61 SER 61 58 58 SER SER A . n A 1 62 SER 62 59 59 SER SER A . n A 1 63 ARG 63 60 60 ARG ARG A . n A 1 64 LEU 64 61 61 LEU LEU A . n A 1 65 THR 65 62 62 THR THR A . n A 1 66 LYS 66 63 63 LYS LYS A . n A 1 67 LYS 67 64 64 LYS LYS A . n A 1 68 ILE 68 65 65 ILE ILE A . n A 1 69 THR 69 66 66 THR THR A . n A 1 70 LEU 70 67 67 LEU LEU A . n A 1 71 ASN 71 68 68 ASN ASN A . n A 1 72 ALA 72 69 69 ALA ALA A . n A 1 73 PRO 73 70 70 PRO PRO A . n A 1 74 PHE 74 71 71 PHE PHE A . n A 1 75 VAL 75 72 72 VAL VAL A . n A 1 76 SER 76 73 73 SER SER A . n A 1 77 SER 77 74 74 SER SER A . n A 1 78 PRO 78 75 75 PRO PRO A . n A 1 79 MET 79 76 76 MET MET A . n A 1 80 ASP 80 77 77 ASP ASP A . n A 1 81 THR 81 78 78 THR THR A . n A 1 82 VAL 82 79 79 VAL VAL A . n A 1 83 THR 83 80 80 THR THR A . n A 1 84 GLU 84 81 81 GLU GLU A . n A 1 85 ALA 85 82 82 ALA ALA A . n A 1 86 ASP 86 83 83 ASP ASP A . n A 1 87 MET 87 84 84 MET MET A . n A 1 88 ALA 88 85 85 ALA ALA A . n A 1 89 ILE 89 86 86 ILE ILE A . n A 1 90 HIS 90 87 87 HIS HIS A . n A 1 91 MET 91 88 88 MET MET A . n A 1 92 ALA 92 89 89 ALA ALA A . n A 1 93 LEU 93 90 90 LEU LEU A . n A 1 94 LEU 94 91 91 LEU LEU A . n A 1 95 GLY 95 92 92 GLY GLY A . n A 1 96 GLY 96 93 93 GLY GLY A . n A 1 97 ILE 97 94 94 ILE ILE A . n A 1 98 GLY 98 95 95 GLY GLY A . n A 1 99 ILE 99 96 96 ILE ILE A . n A 1 100 ILE 100 97 97 ILE ILE A . n A 1 101 HIS 101 98 98 HIS HIS A . n A 1 102 HIS 102 99 99 HIS HIS A . n A 1 103 ASN 103 100 100 ASN ASN A . n A 1 104 CYS 104 101 101 CYS CYS A . n A 1 105 THR 105 102 102 THR THR A . n A 1 106 ALA 106 103 103 ALA ALA A . n A 1 107 GLU 107 104 104 GLU GLU A . n A 1 108 GLU 108 105 105 GLU GLU A . n A 1 109 GLN 109 106 106 GLN GLN A . n A 1 110 ALA 110 107 107 ALA ALA A . n A 1 111 GLU 111 108 108 GLU GLU A . n A 1 112 MET 112 109 109 MET MET A . n A 1 113 VAL 113 110 110 VAL VAL A . n A 1 114 ARG 114 111 111 ARG ARG A . n A 1 115 ARG 115 112 112 ARG ARG A . n A 1 116 VAL 116 113 113 VAL VAL A . n A 1 117 LYS 117 114 114 LYS LYS A . n A 1 118 LYS 118 115 115 LYS LYS A . n A 1 119 TYR 119 116 116 TYR TYR A . n A 1 120 GLU 120 117 117 GLU GLU A . n A 1 121 ASN 121 230 ? ? ? A . n A 1 122 GLY 122 231 ? ? ? A . n A 1 123 SER 123 232 ? ? ? A . n A 1 124 GLN 124 233 ? ? ? A . n A 1 125 ASP 125 234 ? ? ? A . n A 1 126 GLY 126 235 ? ? ? A . n A 1 127 PRO 127 236 236 PRO PRO A . n A 1 128 LEU 128 237 237 LEU LEU A . n A 1 129 ALA 129 238 238 ALA ALA A . n A 1 130 SER 130 239 239 SER SER A . n A 1 131 LYS 131 240 240 LYS LYS A . n A 1 132 SER 132 241 241 SER SER A . n A 1 133 ALA 133 242 ? ? ? A . n A 1 134 ASP 134 243 ? ? ? A . n A 1 135 THR 135 244 244 THR THR A . n A 1 136 LYS 136 245 245 LYS LYS A . n A 1 137 GLN 137 246 246 GLN GLN A . n A 1 138 LEU 138 247 247 LEU LEU A . n A 1 139 LEU 139 248 248 LEU LEU A . n A 1 140 CYS 140 249 249 CYS CYS A . n A 1 141 GLY 141 250 250 GLY GLY A . n A 1 142 ALA 142 251 251 ALA ALA A . n A 1 143 ALA 143 252 252 ALA ALA A . n A 1 144 ILE 144 253 253 ILE ILE A . n A 1 145 GLY 145 254 254 GLY GLY A . n A 1 146 THR 146 255 255 THR THR A . n A 1 147 ILE 147 256 256 ILE ILE A . n A 1 148 ASP 148 257 257 ASP ASP A . n A 1 149 ALA 149 258 258 ALA ALA A . n A 1 150 ASP 150 259 259 ASP ASP A . n A 1 151 ARG 151 260 260 ARG ARG A . n A 1 152 GLN 152 261 261 GLN GLN A . n A 1 153 ARG 153 262 262 ARG ARG A . n A 1 154 LEU 154 263 263 LEU LEU A . n A 1 155 ALA 155 264 264 ALA ALA A . n A 1 156 MET 156 265 265 MET MET A . n A 1 157 LEU 157 266 266 LEU LEU A . n A 1 158 VAL 158 267 267 VAL VAL A . n A 1 159 GLU 159 268 268 GLU GLU A . n A 1 160 ALA 160 269 269 ALA ALA A . n A 1 161 GLY 161 270 270 GLY GLY A . n A 1 162 LEU 162 271 271 LEU LEU A . n A 1 163 ASP 163 272 272 ASP ASP A . n A 1 164 VAL 164 273 273 VAL VAL A . n A 1 165 VAL 165 274 274 VAL VAL A . n A 1 166 VAL 166 275 275 VAL VAL A . n A 1 167 LEU 167 276 276 LEU LEU A . n A 1 168 ASP 168 277 277 ASP ASP A . n A 1 169 SER 169 278 278 SER SER A . n A 1 170 SER 170 279 279 SER SER A . n A 1 171 GLN 171 280 280 GLN GLN A . n A 1 172 GLY 172 281 281 GLY GLY A . n A 1 173 ASN 173 282 282 ASN ASN A . n A 1 174 SER 174 283 283 SER SER A . n A 1 175 VAL 175 284 284 VAL VAL A . n A 1 176 PHE 176 285 285 PHE PHE A . n A 1 177 GLN 177 286 286 GLN GLN A . n A 1 178 ILE 178 287 287 ILE ILE A . n A 1 179 ASN 179 288 288 ASN ASN A . n A 1 180 MET 180 289 289 MET MET A . n A 1 181 ILE 181 290 290 ILE ILE A . n A 1 182 LYS 182 291 291 LYS LYS A . n A 1 183 TRP 183 292 292 TRP TRP A . n A 1 184 ILE 184 293 293 ILE ILE A . n A 1 185 LYS 185 294 294 LYS LYS A . n A 1 186 GLU 186 295 295 GLU GLU A . n A 1 187 THR 187 296 296 THR THR A . n A 1 188 PHE 188 297 297 PHE PHE A . n A 1 189 PRO 189 298 298 PRO PRO A . n A 1 190 ASP 190 299 299 ASP ASP A . n A 1 191 LEU 191 300 300 LEU LEU A . n A 1 192 GLN 192 301 301 GLN GLN A . n A 1 193 VAL 193 302 302 VAL VAL A . n A 1 194 ILE 194 303 303 ILE ILE A . n A 1 195 ALA 195 304 304 ALA ALA A . n A 1 196 GLY 196 305 305 GLY GLY A . n A 1 197 ASN 197 306 306 ASN ASN A . n A 1 198 VAL 198 307 307 VAL VAL A . n A 1 199 VAL 199 308 308 VAL VAL A . n A 1 200 THR 200 309 309 THR THR A . n A 1 201 ARG 201 310 310 ARG ARG A . n A 1 202 GLU 202 311 311 GLU GLU A . n A 1 203 GLN 203 312 312 GLN GLN A . n A 1 204 ALA 204 313 313 ALA ALA A . n A 1 205 ALA 205 314 314 ALA ALA A . n A 1 206 SER 206 315 315 SER SER A . n A 1 207 LEU 207 316 316 LEU LEU A . n A 1 208 ILE 208 317 317 ILE ILE A . n A 1 209 HIS 209 318 318 HIS HIS A . n A 1 210 ALA 210 319 319 ALA ALA A . n A 1 211 GLY 211 320 320 GLY GLY A . n A 1 212 ALA 212 321 321 ALA ALA A . n A 1 213 ASP 213 322 322 ASP ASP A . n A 1 214 GLY 214 323 323 GLY GLY A . n A 1 215 LEU 215 324 324 LEU LEU A . n A 1 216 ARG 216 325 325 ARG ARG A . n A 1 217 ILE 217 326 326 ILE ILE A . n A 1 218 GLY 218 327 327 GLY GLY A . n A 1 219 MET 219 328 328 MET MET A . n A 1 220 GLY 220 329 ? ? ? A . n A 1 221 SER 221 330 ? ? ? A . n A 1 222 GLY 222 331 ? ? ? A . n A 1 223 SER 223 332 ? ? ? A . n A 1 224 ILE 224 333 ? ? ? A . n A 1 225 CYS 225 334 ? ? ? A . n A 1 226 ILE 226 335 ? ? ? A . n A 1 227 THR 227 336 ? ? ? A . n A 1 228 GLN 228 337 ? ? ? A . n A 1 229 GLU 229 338 ? ? ? A . n A 1 230 VAL 230 339 ? ? ? A . n A 1 231 MET 231 340 ? ? ? A . n A 1 232 ALA 232 341 341 ALA ALA A . n A 1 233 CYS 233 342 342 CYS CYS A . n A 1 234 GLY 234 343 343 GLY GLY A . n A 1 235 ARG 235 344 344 ARG ARG A . n A 1 236 PRO 236 345 345 PRO PRO A . n A 1 237 GLN 237 346 346 GLN GLN A . n A 1 238 GLY 238 347 347 GLY GLY A . n A 1 239 THR 239 348 348 THR THR A . n A 1 240 ALA 240 349 349 ALA ALA A . n A 1 241 VAL 241 350 350 VAL VAL A . n A 1 242 TYR 242 351 351 TYR TYR A . n A 1 243 ASN 243 352 352 ASN ASN A . n A 1 244 VAL 244 353 353 VAL VAL A . n A 1 245 THR 245 354 354 THR THR A . n A 1 246 GLN 246 355 355 GLN GLN A . n A 1 247 PHE 247 356 356 PHE PHE A . n A 1 248 ALA 248 357 357 ALA ALA A . n A 1 249 ASN 249 358 358 ASN ASN A . n A 1 250 GLN 250 359 359 GLN GLN A . n A 1 251 PHE 251 360 360 PHE PHE A . n A 1 252 GLY 252 361 361 GLY GLY A . n A 1 253 VAL 253 362 362 VAL VAL A . n A 1 254 PRO 254 363 363 PRO PRO A . n A 1 255 CYS 255 364 364 CYS CYS A . n A 1 256 ILE 256 365 365 ILE ILE A . n A 1 257 ALA 257 366 366 ALA ALA A . n A 1 258 ASP 258 367 367 ASP ASP A . n A 1 259 GLY 259 368 368 GLY GLY A . n A 1 260 GLY 260 369 369 GLY GLY A . n A 1 261 VAL 261 370 370 VAL VAL A . n A 1 262 GLN 262 371 371 GLN GLN A . n A 1 263 ASN 263 372 372 ASN ASN A . n A 1 264 ILE 264 373 373 ILE ILE A . n A 1 265 GLY 265 374 374 GLY GLY A . n A 1 266 HIS 266 375 375 HIS HIS A . n A 1 267 ILE 267 376 376 ILE ILE A . n A 1 268 THR 268 377 377 THR THR A . n A 1 269 LYS 269 378 378 LYS LYS A . n A 1 270 ALA 270 379 379 ALA ALA A . n A 1 271 ILE 271 380 380 ILE ILE A . n A 1 272 ALA 272 381 381 ALA ALA A . n A 1 273 LEU 273 382 382 LEU LEU A . n A 1 274 GLY 274 383 383 GLY GLY A . n A 1 275 ALA 275 384 384 ALA ALA A . n A 1 276 SER 276 385 385 SER SER A . n A 1 277 THR 277 386 386 THR THR A . n A 1 278 VAL 278 387 387 VAL VAL A . n A 1 279 MET 279 388 388 MET MET A . n A 1 280 MET 280 389 389 MET MET A . n A 1 281 GLY 281 390 390 GLY GLY A . n A 1 282 GLY 282 391 391 GLY GLY A . n A 1 283 MET 283 392 392 MET MET A . n A 1 284 LEU 284 393 393 LEU LEU A . n A 1 285 ALA 285 394 394 ALA ALA A . n A 1 286 GLY 286 395 395 GLY GLY A . n A 1 287 THR 287 396 396 THR THR A . n A 1 288 THR 288 397 397 THR THR A . n A 1 289 GLU 289 398 398 GLU GLU A . n A 1 290 SER 290 399 399 SER SER A . n A 1 291 PRO 291 400 400 PRO PRO A . n A 1 292 GLY 292 401 ? ? ? A . n A 1 293 GLU 293 402 ? ? ? A . n A 1 294 TYR 294 403 ? ? ? A . n A 1 295 PHE 295 404 ? ? ? A . n A 1 296 PHE 296 405 ? ? ? A . n A 1 297 ARG 297 406 ? ? ? A . n A 1 298 ASP 298 407 ? ? ? A . n A 1 299 GLY 299 408 ? ? ? A . n A 1 300 LYS 300 409 ? ? ? A . n A 1 301 ARG 301 410 ? ? ? A . n A 1 302 LEU 302 411 ? ? ? A . n A 1 303 LYS 303 412 ? ? ? A . n A 1 304 THR 304 413 ? ? ? A . n A 1 305 TYR 305 414 ? ? ? A . n A 1 306 ARG 306 415 ? ? ? A . n A 1 307 GLY 307 416 ? ? ? A . n A 1 308 MET 308 417 ? ? ? A . n A 1 309 GLY 309 418 ? ? ? A . n A 1 310 SER 310 419 ? ? ? A . n A 1 311 ILE 311 420 ? ? ? A . n A 1 312 ASP 312 421 ? ? ? A . n A 1 313 ALA 313 422 ? ? ? A . n A 1 314 MET 314 423 ? ? ? A . n A 1 315 GLN 315 424 ? ? ? A . n A 1 316 LYS 316 425 ? ? ? A . n A 1 317 THR 317 426 ? ? ? A . n A 1 318 ASP 318 427 ? ? ? A . n A 1 319 VAL 319 428 ? ? ? A . n A 1 320 LYS 320 429 ? ? ? A . n A 1 321 GLY 321 430 ? ? ? A . n A 1 322 ASN 322 431 ? ? ? A . n A 1 323 ALA 323 432 ? ? ? A . n A 1 324 ALA 324 433 ? ? ? A . n A 1 325 THR 325 434 ? ? ? A . n A 1 326 SER 326 435 ? ? ? A . n A 1 327 ARG 327 436 ? ? ? A . n A 1 328 TYR 328 437 ? ? ? A . n A 1 329 PHE 329 438 ? ? ? A . n A 1 330 SER 330 439 ? ? ? A . n A 1 331 GLU 331 440 ? ? ? A . n A 1 332 SER 332 441 ? ? ? A . n A 1 333 ASP 333 442 ? ? ? A . n A 1 334 LYS 334 443 ? ? ? A . n A 1 335 VAL 335 444 ? ? ? A . n A 1 336 LEU 336 445 ? ? ? A . n A 1 337 VAL 337 446 ? ? ? A . n A 1 338 ALA 338 447 ? ? ? A . n A 1 339 GLN 339 448 ? ? ? A . n A 1 340 GLY 340 449 ? ? ? A . n A 1 341 VAL 341 450 ? ? ? A . n A 1 342 THR 342 451 ? ? ? A . n A 1 343 GLY 343 452 ? ? ? A . n A 1 344 SER 344 453 ? ? ? A . n A 1 345 VAL 345 454 ? ? ? A . n A 1 346 ILE 346 455 ? ? ? A . n A 1 347 ASP 347 456 456 ASP ASP A . n A 1 348 LYS 348 457 457 LYS LYS A . n A 1 349 GLY 349 458 458 GLY GLY A . n A 1 350 SER 350 459 459 SER SER A . n A 1 351 ILE 351 460 460 ILE ILE A . n A 1 352 LYS 352 461 461 LYS LYS A . n A 1 353 LYS 353 462 462 LYS LYS A . n A 1 354 TYR 354 463 463 TYR TYR A . n A 1 355 ILE 355 464 464 ILE ILE A . n A 1 356 PRO 356 465 465 PRO PRO A . n A 1 357 TYR 357 466 466 TYR TYR A . n A 1 358 LEU 358 467 467 LEU LEU A . n A 1 359 TYR 359 468 468 TYR TYR A . n A 1 360 ASN 360 469 469 ASN ASN A . n A 1 361 GLY 361 470 470 GLY GLY A . n A 1 362 LEU 362 471 471 LEU LEU A . n A 1 363 GLN 363 472 472 GLN GLN A . n A 1 364 HIS 364 473 473 HIS HIS A . n A 1 365 SER 365 474 474 SER SER A . n A 1 366 CYS 366 475 475 CYS CYS A . n A 1 367 GLN 367 476 476 GLN GLN A . n A 1 368 ASP 368 477 477 ASP ASP A . n A 1 369 ILE 369 478 478 ILE ILE A . n A 1 370 GLY 370 479 479 GLY GLY A . n A 1 371 VAL 371 480 480 VAL VAL A . n A 1 372 ARG 372 481 481 ARG ARG A . n A 1 373 SER 373 482 482 SER SER A . n A 1 374 LEU 374 483 483 LEU LEU A . n A 1 375 VAL 375 484 484 VAL VAL A . n A 1 376 GLU 376 485 485 GLU GLU A . n A 1 377 PHE 377 486 486 PHE PHE A . n A 1 378 ARG 378 487 487 ARG ARG A . n A 1 379 GLU 379 488 488 GLU GLU A . n A 1 380 LYS 380 489 489 LYS LYS A . n A 1 381 VAL 381 490 490 VAL VAL A . n A 1 382 ASP 382 491 491 ASP ASP A . n A 1 383 SER 383 492 492 SER SER A . n A 1 384 GLY 384 493 493 GLY GLY A . n A 1 385 SER 385 494 494 SER SER A . n A 1 386 VAL 386 495 495 VAL VAL A . n A 1 387 ARG 387 496 496 ARG ARG A . n A 1 388 PHE 388 497 497 PHE PHE A . n A 1 389 GLU 389 498 498 GLU GLU A . n A 1 390 PHE 390 499 499 PHE PHE A . n A 1 391 ARG 391 500 500 ARG ARG A . n A 1 392 THR 392 501 501 THR THR A . n A 1 393 PRO 393 502 502 PRO PRO A . n A 1 394 SER 394 503 ? ? ? A . n A 1 395 ALA 395 504 ? ? ? A . n A 1 396 GLN 396 505 ? ? ? A . n A 1 397 LEU 397 506 ? ? ? A . n A 1 398 GLU 398 507 ? ? ? A . n A 1 399 GLY 399 508 ? ? ? A . n A 1 400 GLY 400 509 ? ? ? A . n A 1 401 VAL 401 510 ? ? ? A . n A 1 402 HIS 402 511 ? ? ? A . n A 1 403 ASN 403 512 ? ? ? A . n A 1 404 LEU 404 513 ? ? ? A . n A 1 405 HIS 405 514 ? ? ? A . n A 1 406 SER 406 515 ? ? ? A . n A 1 407 TYR 407 516 ? ? ? A . n A 1 408 GLU 408 517 ? ? ? A . n A 1 409 LYS 409 518 ? ? ? A . n A 1 410 ARG 410 519 ? ? ? A . n A 1 411 LEU 411 520 ? ? ? A . n A 1 412 PHE 412 521 ? ? ? A . n A 1 413 ASP 413 522 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 601 121 HOH HOH A . B 2 HOH 2 602 45 HOH HOH A . B 2 HOH 3 603 12 HOH HOH A . B 2 HOH 4 604 9 HOH HOH A . B 2 HOH 5 605 13 HOH HOH A . B 2 HOH 6 606 142 HOH HOH A . B 2 HOH 7 607 143 HOH HOH A . B 2 HOH 8 608 119 HOH HOH A . B 2 HOH 9 609 5 HOH HOH A . B 2 HOH 10 610 118 HOH HOH A . B 2 HOH 11 611 8 HOH HOH A . B 2 HOH 12 612 52 HOH HOH A . B 2 HOH 13 613 49 HOH HOH A . B 2 HOH 14 614 38 HOH HOH A . B 2 HOH 15 615 17 HOH HOH A . B 2 HOH 16 616 113 HOH HOH A . B 2 HOH 17 617 63 HOH HOH A . B 2 HOH 18 618 14 HOH HOH A . B 2 HOH 19 619 140 HOH HOH A . B 2 HOH 20 620 10 HOH HOH A . B 2 HOH 21 621 109 HOH HOH A . B 2 HOH 22 622 42 HOH HOH A . B 2 HOH 23 623 127 HOH HOH A . B 2 HOH 24 624 74 HOH HOH A . B 2 HOH 25 625 71 HOH HOH A . B 2 HOH 26 626 120 HOH HOH A . B 2 HOH 27 627 80 HOH HOH A . B 2 HOH 28 628 51 HOH HOH A . B 2 HOH 29 629 89 HOH HOH A . B 2 HOH 30 630 90 HOH HOH A . B 2 HOH 31 631 128 HOH HOH A . B 2 HOH 32 632 1 HOH HOH A . B 2 HOH 33 633 2 HOH HOH A . B 2 HOH 34 634 3 HOH HOH A . B 2 HOH 35 635 4 HOH HOH A . B 2 HOH 36 636 6 HOH HOH A . B 2 HOH 37 637 11 HOH HOH A . B 2 HOH 38 638 16 HOH HOH A . B 2 HOH 39 639 18 HOH HOH A . B 2 HOH 40 640 19 HOH HOH A . B 2 HOH 41 641 20 HOH HOH A . B 2 HOH 42 642 21 HOH HOH A . B 2 HOH 43 643 22 HOH HOH A . B 2 HOH 44 644 24 HOH HOH A . B 2 HOH 45 645 25 HOH HOH A . B 2 HOH 46 646 26 HOH HOH A . B 2 HOH 47 647 31 HOH HOH A . B 2 HOH 48 648 32 HOH HOH A . B 2 HOH 49 649 33 HOH HOH A . B 2 HOH 50 650 34 HOH HOH A . B 2 HOH 51 651 35 HOH HOH A . B 2 HOH 52 652 36 HOH HOH A . B 2 HOH 53 653 37 HOH HOH A . B 2 HOH 54 654 39 HOH HOH A . B 2 HOH 55 655 40 HOH HOH A . B 2 HOH 56 656 41 HOH HOH A . B 2 HOH 57 657 43 HOH HOH A . B 2 HOH 58 658 44 HOH HOH A . B 2 HOH 59 659 53 HOH HOH A . B 2 HOH 60 660 54 HOH HOH A . B 2 HOH 61 661 55 HOH HOH A . B 2 HOH 62 662 56 HOH HOH A . B 2 HOH 63 663 61 HOH HOH A . B 2 HOH 64 664 64 HOH HOH A . B 2 HOH 65 665 72 HOH HOH A . B 2 HOH 66 666 77 HOH HOH A . B 2 HOH 67 667 85 HOH HOH A . B 2 HOH 68 668 86 HOH HOH A . B 2 HOH 69 669 88 HOH HOH A . B 2 HOH 70 670 99 HOH HOH A . B 2 HOH 71 671 103 HOH HOH A . B 2 HOH 72 672 104 HOH HOH A . B 2 HOH 73 673 105 HOH HOH A . B 2 HOH 74 674 107 HOH HOH A . B 2 HOH 75 675 108 HOH HOH A . B 2 HOH 76 676 110 HOH HOH A . B 2 HOH 77 677 111 HOH HOH A . B 2 HOH 78 678 112 HOH HOH A . B 2 HOH 79 679 115 HOH HOH A . B 2 HOH 80 680 117 HOH HOH A . B 2 HOH 81 681 122 HOH HOH A . B 2 HOH 82 682 123 HOH HOH A . B 2 HOH 83 683 124 HOH HOH A . B 2 HOH 84 684 125 HOH HOH A . B 2 HOH 85 685 126 HOH HOH A . B 2 HOH 86 686 130 HOH HOH A . B 2 HOH 87 687 131 HOH HOH A . B 2 HOH 88 688 132 HOH HOH A . B 2 HOH 89 689 133 HOH HOH A . B 2 HOH 90 690 134 HOH HOH A . B 2 HOH 91 691 138 HOH HOH A . B 2 HOH 92 692 139 HOH HOH A . B 2 HOH 93 693 144 HOH HOH A . B 2 HOH 94 694 146 HOH HOH A . B 2 HOH 95 695 147 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A THR 2 ? OG1 ? A THR 5 OG1 2 1 Y 1 A THR 2 ? CG2 ? A THR 5 CG2 3 1 Y 1 A GLU 11 ? CD ? A GLU 14 CD 4 1 Y 1 A GLU 11 ? OE1 ? A GLU 14 OE1 5 1 Y 1 A GLU 11 ? OE2 ? A GLU 14 OE2 6 1 Y 1 A GLU 25 ? CD ? A GLU 28 CD 7 1 Y 1 A GLU 25 ? OE1 ? A GLU 28 OE1 8 1 Y 1 A GLU 25 ? OE2 ? A GLU 28 OE2 9 1 Y 1 A LYS 31 ? CG ? A LYS 34 CG 10 1 Y 1 A LYS 31 ? CD ? A LYS 34 CD 11 1 Y 1 A LYS 31 ? CE ? A LYS 34 CE 12 1 Y 1 A LYS 31 ? NZ ? A LYS 34 NZ 13 1 Y 1 A LYS 47 ? CD ? A LYS 50 CD 14 1 Y 1 A LYS 47 ? CE ? A LYS 50 CE 15 1 Y 1 A LYS 47 ? NZ ? A LYS 50 NZ 16 1 Y 1 A ASP 49 ? OD1 ? A ASP 52 OD1 17 1 Y 1 A ASP 49 ? OD2 ? A ASP 52 OD2 18 1 Y 1 A GLU 54 ? CG ? A GLU 57 CG 19 1 Y 1 A GLU 54 ? CD ? A GLU 57 CD 20 1 Y 1 A GLU 54 ? OE1 ? A GLU 57 OE1 21 1 Y 1 A GLU 54 ? OE2 ? A GLU 57 OE2 22 1 Y 1 A LYS 64 ? CD ? A LYS 67 CD 23 1 Y 1 A LYS 64 ? CE ? A LYS 67 CE 24 1 Y 1 A LYS 64 ? NZ ? A LYS 67 NZ 25 1 Y 1 A LYS 115 ? CG ? A LYS 118 CG 26 1 Y 1 A LYS 115 ? CD ? A LYS 118 CD 27 1 Y 1 A LYS 115 ? CE ? A LYS 118 CE 28 1 Y 1 A LYS 115 ? NZ ? A LYS 118 NZ 29 1 Y 1 A GLU 117 ? CG ? A GLU 120 CG 30 1 Y 1 A GLU 117 ? CD ? A GLU 120 CD 31 1 Y 1 A GLU 117 ? OE1 ? A GLU 120 OE1 32 1 Y 1 A GLU 117 ? OE2 ? A GLU 120 OE2 33 1 Y 1 A LEU 237 ? CG ? A LEU 128 CG 34 1 Y 1 A LEU 237 ? CD1 ? A LEU 128 CD1 35 1 Y 1 A LEU 237 ? CD2 ? A LEU 128 CD2 36 1 Y 1 A ALA 238 ? CB ? A ALA 129 CB 37 1 Y 1 A LYS 240 ? CG ? A LYS 131 CG 38 1 Y 1 A LYS 240 ? CD ? A LYS 131 CD 39 1 Y 1 A LYS 240 ? CE ? A LYS 131 CE 40 1 Y 1 A LYS 240 ? NZ ? A LYS 131 NZ 41 1 Y 1 A SER 241 ? OG ? A SER 132 OG 42 1 Y 1 A THR 244 ? OG1 ? A THR 135 OG1 43 1 Y 1 A THR 244 ? CG2 ? A THR 135 CG2 44 1 Y 1 A LYS 245 ? CG ? A LYS 136 CG 45 1 Y 1 A LYS 245 ? CD ? A LYS 136 CD 46 1 Y 1 A LYS 245 ? CE ? A LYS 136 CE 47 1 Y 1 A LYS 245 ? NZ ? A LYS 136 NZ 48 1 Y 1 A THR 255 ? CG2 ? A THR 146 CG2 49 1 Y 1 A GLN 261 ? CG ? A GLN 152 CG 50 1 Y 1 A GLN 261 ? CD ? A GLN 152 CD 51 1 Y 1 A GLN 261 ? OE1 ? A GLN 152 OE1 52 1 Y 1 A GLN 261 ? NE2 ? A GLN 152 NE2 53 1 Y 1 A GLU 268 ? CG ? A GLU 159 CG 54 1 Y 1 A GLU 268 ? CD ? A GLU 159 CD 55 1 Y 1 A GLU 268 ? OE1 ? A GLU 159 OE1 56 1 Y 1 A GLU 268 ? OE2 ? A GLU 159 OE2 57 1 Y 1 A PHE 285 ? CG ? A PHE 176 CG 58 1 Y 1 A PHE 285 ? CD1 ? A PHE 176 CD1 59 1 Y 1 A PHE 285 ? CD2 ? A PHE 176 CD2 60 1 Y 1 A PHE 285 ? CE1 ? A PHE 176 CE1 61 1 Y 1 A PHE 285 ? CE2 ? A PHE 176 CE2 62 1 Y 1 A PHE 285 ? CZ ? A PHE 176 CZ 63 1 Y 1 A LYS 291 ? CE ? A LYS 182 CE 64 1 Y 1 A LYS 291 ? NZ ? A LYS 182 NZ 65 1 Y 1 A GLU 295 ? CG ? A GLU 186 CG 66 1 Y 1 A GLU 295 ? CD ? A GLU 186 CD 67 1 Y 1 A GLU 295 ? OE1 ? A GLU 186 OE1 68 1 Y 1 A GLU 295 ? OE2 ? A GLU 186 OE2 69 1 Y 1 A ILE 365 ? CD1 ? A ILE 256 CD1 70 1 Y 1 A GLN 371 ? CD ? A GLN 262 CD 71 1 Y 1 A GLN 371 ? OE1 ? A GLN 262 OE1 72 1 Y 1 A GLN 371 ? NE2 ? A GLN 262 NE2 73 1 Y 1 A ALA 394 ? CB ? A ALA 285 CB 74 1 Y 1 A THR 397 ? OG1 ? A THR 288 OG1 75 1 Y 1 A THR 397 ? CG2 ? A THR 288 CG2 76 1 Y 1 A ASP 456 ? CG ? A ASP 347 CG 77 1 Y 1 A ASP 456 ? OD1 ? A ASP 347 OD1 78 1 Y 1 A ASP 456 ? OD2 ? A ASP 347 OD2 79 1 Y 1 A LYS 457 ? CG ? A LYS 348 CG 80 1 Y 1 A LYS 457 ? CD ? A LYS 348 CD 81 1 Y 1 A LYS 457 ? CE ? A LYS 348 CE 82 1 Y 1 A LYS 457 ? NZ ? A LYS 348 NZ 83 1 Y 1 A ILE 460 ? CG1 ? A ILE 351 CG1 84 1 Y 1 A ILE 460 ? CG2 ? A ILE 351 CG2 85 1 Y 1 A ILE 460 ? CD1 ? A ILE 351 CD1 86 1 Y 1 A LYS 461 ? CG ? A LYS 352 CG 87 1 Y 1 A LYS 461 ? CD ? A LYS 352 CD 88 1 Y 1 A LYS 461 ? CE ? A LYS 352 CE 89 1 Y 1 A LYS 461 ? NZ ? A LYS 352 NZ 90 1 Y 1 A LYS 462 ? CG ? A LYS 353 CG 91 1 Y 1 A LYS 462 ? CD ? A LYS 353 CD 92 1 Y 1 A LYS 462 ? CE ? A LYS 353 CE 93 1 Y 1 A LYS 462 ? NZ ? A LYS 353 NZ 94 1 Y 1 A ARG 481 ? CG ? A ARG 372 CG 95 1 Y 1 A ARG 481 ? CD ? A ARG 372 CD 96 1 Y 1 A ARG 481 ? NE ? A ARG 372 NE 97 1 Y 1 A ARG 481 ? CZ ? A ARG 372 CZ 98 1 Y 1 A ARG 481 ? NH1 ? A ARG 372 NH1 99 1 Y 1 A ARG 481 ? NH2 ? A ARG 372 NH2 100 1 Y 1 A GLU 488 ? CG ? A GLU 379 CG 101 1 Y 1 A GLU 488 ? CD ? A GLU 379 CD 102 1 Y 1 A GLU 488 ? OE1 ? A GLU 379 OE1 103 1 Y 1 A GLU 488 ? OE2 ? A GLU 379 OE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: dev_1839)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? XDS ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? XSCALE ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 4XWU _cell.details ? _cell.formula_units_Z ? _cell.length_a 106.787 _cell.length_a_esd ? _cell.length_b 106.787 _cell.length_b_esd ? _cell.length_c 69.681 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4XWU _symmetry.cell_setting ? _symmetry.Int_Tables_number 79 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'I 4' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4XWU _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.23 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 44.86 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M HEPES pH 7.5, 40% PEG-300, 0.2 M NaCl' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector PIXEL _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'DECTRIS PILATUS 6M' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-09-15 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97949 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALBA BEAMLINE XALOC' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97949 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline XALOC _diffrn_source.pdbx_synchrotron_site ALBA # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4XWU _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.75 _reflns.d_resolution_low 39.39 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 39565 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 12.4 _reflns.pdbx_Rmerge_I_obs 0.0397 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 30.28 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.75 _reflns_shell.d_res_low 1.813 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 1.88 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 1.37 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 12.7 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4XWU _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.750 _refine.ls_d_res_low 39.39 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 39552 _refine.ls_number_reflns_R_free 1946 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.95 _refine.ls_percent_reflns_R_free 4.92 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1683 _refine.ls_R_factor_R_free 0.1922 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1670 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 4avf _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 19.44 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.22 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2264 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 95 _refine_hist.number_atoms_total 2359 _refine_hist.d_res_high 1.750 _refine_hist.d_res_low 39.39 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.006 ? 2299 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.950 ? 3116 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 11.566 ? 803 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.034 ? 372 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 403 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 1.7501 1.7938 . . 140 2670 100.00 . . . 0.3387 . 0.3491 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.7938 1.8423 . . 164 2686 100.00 . . . 0.3043 . 0.2785 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8423 1.8965 . . 115 2679 100.00 . . . 0.2243 . 0.2223 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.8965 1.9577 . . 157 2635 100.00 . . . 0.2632 . 0.2204 . . . . . . . . . . 'X-RAY DIFFRACTION' 1.9577 2.0277 . . 129 2694 100.00 . . . 0.2133 . 0.1746 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.0277 2.1089 . . 149 2643 100.00 . . . 0.1982 . 0.1742 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.1089 2.2049 . . 129 2679 100.00 . . . 0.2123 . 0.1555 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.2049 2.3211 . . 122 2723 100.00 . . . 0.2151 . 0.1586 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.3211 2.4665 . . 140 2667 100.00 . . . 0.1668 . 0.1471 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.4665 2.6569 . . 134 2682 100.00 . . . 0.1960 . 0.1632 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6569 2.9242 . . 164 2674 100.00 . . . 0.1716 . 0.1658 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.9242 3.3471 . . 141 2692 100.00 . . . 0.1960 . 0.1739 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3471 4.2163 . . 121 2717 100.00 . . . 0.1846 . 0.1565 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.2163 39.4027 . . 141 2765 100.00 . . . 0.1816 . 0.1618 . . . . . . . . . . # _struct.entry_id 4XWU _struct.title 'Structure of the IMP dehydrogenase from Ashbya gossypii' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4XWU _struct_keywords.text 'oxidoreductase, IMP dehydrogenase, Ashbya gossypii' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP Q756Z6_ASHGO Q756Z6 ? 1 ;MTYRDAATALEHLATYAEKDGLSVEQLMDSKTRGGLTYNDFLVLPGKIDFPSSEVVLSSRLTKKITLNAPFVSSPMDTVT EADMAIHMALLGGIGIIHHNCTAEEQAEMVRRVKKYENG ; 1 2 UNP Q756Z6_ASHGO Q756Z6 ? 1 ;PLASKSADTKQLLCGAAIGTIDADRQRLAMLVEAGLDVVVLDSSQGNSVFQINMIKWIKETFPDLQVIAGNVVTREQAAS LIHAGADGLRIGMGSGSICITQEVMACGRPQGTAVYNVTQFANQFGVPCIADGGVQNIGHITKAIALGASTVMMGGMLAG TTESPGEYFFRDGKRLKTYRGMGSIDAMQKTDVKGNAATSRYFSESDKVLVAQGVTGSVIDKGSIKKYIPYLYNGLQHSC QDIGVRSLVEFREKVDSGSVRFEFRTPSAQLEGGVHNLHSYEKRLFD ; 236 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4XWU A 4 ? 122 ? Q756Z6 1 ? 119 ? 1 231 2 2 4XWU A 127 ? 413 ? Q756Z6 236 ? 522 ? 236 522 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4XWU GLY A 1 ? UNP Q756Z6 ? ? 'expression tag' -2 1 1 4XWU SER A 2 ? UNP Q756Z6 ? ? 'expression tag' -1 2 1 4XWU HIS A 3 ? UNP Q756Z6 ? ? 'expression tag' 0 3 1 4XWU SER A 123 ? UNP Q756Z6 ? ? linker 232 4 1 4XWU GLN A 124 ? UNP Q756Z6 ? ? linker 233 5 1 4XWU ASP A 125 ? UNP Q756Z6 ? ? linker 234 6 1 4XWU GLY A 126 ? UNP Q756Z6 ? ? linker 235 7 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 12160 ? 1 MORE -71 ? 1 'SSA (A^2)' 42920 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_775 -x+2,-y+2,z -1.0000000000 0.0000000000 0.0000000000 213.5740000000 0.0000000000 -1.0000000000 0.0000000000 213.5740000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_755 -y+2,x,z 0.0000000000 -1.0000000000 0.0000000000 213.5740000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 4 'crystal symmetry operation' 4_575 y,-x+2,z 0.0000000000 1.0000000000 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 0.0000000000 213.5740000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 8 ? ALA A 10 ? ASP A 5 ALA A 7 5 ? 3 HELX_P HELX_P2 AA2 THR A 11 ? LEU A 16 ? THR A 8 LEU A 13 1 ? 6 HELX_P HELX_P3 AA3 ALA A 17 ? TYR A 19 ? ALA A 14 TYR A 16 5 ? 3 HELX_P HELX_P4 AA4 SER A 26 ? MET A 31 ? SER A 23 MET A 28 1 ? 6 HELX_P HELX_P5 AA5 THR A 40 ? ASN A 42 ? THR A 37 ASN A 39 5 ? 3 HELX_P HELX_P6 AA6 PRO A 54 ? VAL A 58 ? PRO A 51 VAL A 55 5 ? 5 HELX_P HELX_P7 AA7 GLU A 84 ? LEU A 94 ? GLU A 81 LEU A 91 1 ? 11 HELX_P HELX_P8 AA8 THR A 105 ? LYS A 118 ? THR A 102 LYS A 115 1 ? 14 HELX_P HELX_P9 AA9 ASP A 148 ? ALA A 160 ? ASP A 257 ALA A 269 1 ? 13 HELX_P HELX_P10 AB1 SER A 174 ? PHE A 188 ? SER A 283 PHE A 297 1 ? 15 HELX_P HELX_P11 AB2 THR A 200 ? GLY A 211 ? THR A 309 GLY A 320 1 ? 12 HELX_P HELX_P12 AB3 PRO A 236 ? ASN A 249 ? PRO A 345 ASN A 358 1 ? 14 HELX_P HELX_P13 AB4 GLN A 250 ? GLY A 252 ? GLN A 359 GLY A 361 5 ? 3 HELX_P HELX_P14 AB5 ASN A 263 ? GLY A 274 ? ASN A 372 GLY A 383 1 ? 12 HELX_P HELX_P15 AB6 SER A 350 ? GLY A 370 ? SER A 459 GLY A 479 1 ? 21 HELX_P HELX_P16 AB7 SER A 373 ? SER A 383 ? SER A 482 SER A 492 1 ? 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id GLY _struct_mon_prot_cis.label_seq_id 196 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id GLY _struct_mon_prot_cis.auth_seq_id 305 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 ASN _struct_mon_prot_cis.pdbx_label_seq_id_2 197 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 ASN _struct_mon_prot_cis.pdbx_auth_seq_id_2 306 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 2.00 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 2 ? AA2 ? 2 ? AA3 ? 9 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA2 1 2 ? anti-parallel AA3 1 2 ? parallel AA3 2 3 ? parallel AA3 3 4 ? parallel AA3 4 5 ? parallel AA3 5 6 ? parallel AA3 6 7 ? parallel AA3 7 8 ? parallel AA3 8 9 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 PHE A 44 ? VAL A 46 ? PHE A 41 VAL A 43 AA1 2 PHE A 388 ? PHE A 390 ? PHE A 497 PHE A 499 AA2 1 SER A 62 ? ARG A 63 ? SER A 59 ARG A 60 AA2 2 THR A 69 ? LEU A 70 ? THR A 66 LEU A 67 AA3 1 PHE A 74 ? SER A 76 ? PHE A 71 SER A 73 AA3 2 ILE A 97 ? ILE A 100 ? ILE A 94 ILE A 97 AA3 3 GLY A 141 ? ILE A 144 ? GLY A 250 ILE A 253 AA3 4 VAL A 164 ? LEU A 167 ? VAL A 273 LEU A 276 AA3 5 GLN A 192 ? VAL A 198 ? GLN A 301 VAL A 307 AA3 6 GLY A 214 ? ILE A 217 ? GLY A 323 ILE A 326 AA3 7 CYS A 255 ? ALA A 257 ? CYS A 364 ALA A 366 AA3 8 THR A 277 ? MET A 280 ? THR A 386 MET A 389 AA3 9 PHE A 74 ? SER A 76 ? PHE A 71 SER A 73 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 45 ? N LEU A 42 O GLU A 389 ? O GLU A 498 AA2 1 2 N SER A 62 ? N SER A 59 O LEU A 70 ? O LEU A 67 AA3 1 2 N SER A 76 ? N SER A 73 O ILE A 97 ? O ILE A 94 AA3 2 3 N ILE A 100 ? N ILE A 97 O ALA A 143 ? O ALA A 252 AA3 3 4 N ALA A 142 ? N ALA A 251 O VAL A 166 ? O VAL A 275 AA3 4 5 N VAL A 165 ? N VAL A 274 O ILE A 194 ? O ILE A 303 AA3 5 6 N ALA A 195 ? N ALA A 304 O GLY A 214 ? O GLY A 323 AA3 6 7 N LEU A 215 ? N LEU A 324 O ILE A 256 ? O ILE A 365 AA3 7 8 N ALA A 257 ? N ALA A 366 O MET A 279 ? O MET A 388 AA3 8 9 O MET A 280 ? O MET A 389 N VAL A 75 ? N VAL A 72 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 MET A 28 ? ? -94.24 56.21 2 1 THR A 32 ? ? -95.80 -61.16 3 1 VAL A 79 ? ? -124.75 -52.92 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 99.8589 128.6958 14.2783 0.3469 ? 0.0753 ? 0.0379 ? 0.3499 ? -0.0053 ? 0.2908 ? 4.0697 ? 1.2069 ? -0.3852 ? 0.9955 ? -0.2598 ? 0.8551 ? 0.0609 ? -0.1326 ? 0.3895 ? 0.0113 ? 0.0780 ? 0.0221 ? -0.1669 ? -0.1455 ? -0.0001 ? 2 'X-RAY DIFFRACTION' ? refined 118.2695 140.8435 -8.1094 0.6467 ? -0.0648 ? 0.1415 ? 0.6664 ? 0.2004 ? 0.4928 ? 1.1741 ? 0.2828 ? 0.4375 ? 0.0925 ? 0.1130 ? 0.1726 ? -0.3105 ? 1.3852 ? 0.2427 ? -0.9263 ? 0.4421 ? 0.3220 ? 0.2223 ? -0.7513 ? 0.0627 ? 3 'X-RAY DIFFRACTION' ? refined 125.8622 144.7720 -7.0027 0.6517 ? -0.0657 ? 0.2053 ? 0.5130 ? 0.1666 ? 0.5372 ? 0.6271 ? 0.2883 ? 0.5096 ? 0.2330 ? 0.0950 ? 0.5228 ? -0.2403 ? 0.6086 ? 0.5029 ? -0.5153 ? 0.3050 ? -0.2274 ? -0.2094 ? -0.0598 ? -0.0098 ? 4 'X-RAY DIFFRACTION' ? refined 129.3927 142.3507 3.3985 0.4162 ? -0.0783 ? 0.1060 ? 0.3225 ? 0.0510 ? 0.5487 ? 1.4557 ? 1.4545 ? -0.9229 ? 1.7561 ? -0.5495 ? 2.5185 ? 0.1708 ? 0.0642 ? 0.4952 ? -0.2142 ? -0.1056 ? -0.2748 ? -0.2947 ? 0.1155 ? 0.0003 ? 5 'X-RAY DIFFRACTION' ? refined 118.7495 131.3213 10.2819 0.3456 ? -0.0241 ? 0.0451 ? 0.2759 ? -0.0088 ? 0.2718 ? 3.1615 ? 0.4333 ? -0.3731 ? 2.5656 ? -0.4262 ? 1.6844 ? 0.1249 ? 0.1542 ? 0.2978 ? 0.0500 ? 0.0384 ? -0.0767 ? -0.1835 ? 0.0679 ? 0.0002 ? 6 'X-RAY DIFFRACTION' ? refined 112.4286 136.0277 -12.2795 0.6978 ? -0.1357 ? -0.0119 ? 0.8258 ? 0.1456 ? 0.4446 ? 0.0550 ? 0.0082 ? -0.0299 ? 0.0329 ? -0.0236 ? 0.0389 ? -0.2343 ? 1.4440 ? 0.0440 ? -0.2702 ? 0.5572 ? 0.4950 ? 0.1983 ? -0.5861 ? 0.0001 ? 7 'X-RAY DIFFRACTION' ? refined 101.2219 133.5426 7.8329 0.3978 ? 0.0124 ? 0.0107 ? 0.4114 ? 0.0877 ? 0.4146 ? 2.5201 ? 0.9434 ? -0.7073 ? 1.0250 ? -0.5496 ? 0.6041 ? -0.0556 ? 0.4590 ? 0.5701 ? -0.2243 ? 0.1895 ? 0.3651 ? 0.0262 ? -0.3495 ? -0.0036 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 2 through 73 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 74 through 90 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 91 through 115 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 116 through 296 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 297 through 389 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 390 through 459 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 460 through 500 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY -2 ? A GLY 1 2 1 Y 1 A SER -1 ? A SER 2 3 1 Y 1 A HIS 0 ? A HIS 3 4 1 Y 1 A MET 1 ? A MET 4 5 1 Y 1 A ASN 230 ? A ASN 121 6 1 Y 1 A GLY 231 ? A GLY 122 7 1 Y 1 A SER 232 ? A SER 123 8 1 Y 1 A GLN 233 ? A GLN 124 9 1 Y 1 A ASP 234 ? A ASP 125 10 1 Y 1 A GLY 235 ? A GLY 126 11 1 Y 1 A ALA 242 ? A ALA 133 12 1 Y 1 A ASP 243 ? A ASP 134 13 1 Y 1 A GLY 329 ? A GLY 220 14 1 Y 1 A SER 330 ? A SER 221 15 1 Y 1 A GLY 331 ? A GLY 222 16 1 Y 1 A SER 332 ? A SER 223 17 1 Y 1 A ILE 333 ? A ILE 224 18 1 Y 1 A CYS 334 ? A CYS 225 19 1 Y 1 A ILE 335 ? A ILE 226 20 1 Y 1 A THR 336 ? A THR 227 21 1 Y 1 A GLN 337 ? A GLN 228 22 1 Y 1 A GLU 338 ? A GLU 229 23 1 Y 1 A VAL 339 ? A VAL 230 24 1 Y 1 A MET 340 ? A MET 231 25 1 Y 1 A GLY 401 ? A GLY 292 26 1 Y 1 A GLU 402 ? A GLU 293 27 1 Y 1 A TYR 403 ? A TYR 294 28 1 Y 1 A PHE 404 ? A PHE 295 29 1 Y 1 A PHE 405 ? A PHE 296 30 1 Y 1 A ARG 406 ? A ARG 297 31 1 Y 1 A ASP 407 ? A ASP 298 32 1 Y 1 A GLY 408 ? A GLY 299 33 1 Y 1 A LYS 409 ? A LYS 300 34 1 Y 1 A ARG 410 ? A ARG 301 35 1 Y 1 A LEU 411 ? A LEU 302 36 1 Y 1 A LYS 412 ? A LYS 303 37 1 Y 1 A THR 413 ? A THR 304 38 1 Y 1 A TYR 414 ? A TYR 305 39 1 Y 1 A ARG 415 ? A ARG 306 40 1 Y 1 A GLY 416 ? A GLY 307 41 1 Y 1 A MET 417 ? A MET 308 42 1 Y 1 A GLY 418 ? A GLY 309 43 1 Y 1 A SER 419 ? A SER 310 44 1 Y 1 A ILE 420 ? A ILE 311 45 1 Y 1 A ASP 421 ? A ASP 312 46 1 Y 1 A ALA 422 ? A ALA 313 47 1 Y 1 A MET 423 ? A MET 314 48 1 Y 1 A GLN 424 ? A GLN 315 49 1 Y 1 A LYS 425 ? A LYS 316 50 1 Y 1 A THR 426 ? A THR 317 51 1 Y 1 A ASP 427 ? A ASP 318 52 1 Y 1 A VAL 428 ? A VAL 319 53 1 Y 1 A LYS 429 ? A LYS 320 54 1 Y 1 A GLY 430 ? A GLY 321 55 1 Y 1 A ASN 431 ? A ASN 322 56 1 Y 1 A ALA 432 ? A ALA 323 57 1 Y 1 A ALA 433 ? A ALA 324 58 1 Y 1 A THR 434 ? A THR 325 59 1 Y 1 A SER 435 ? A SER 326 60 1 Y 1 A ARG 436 ? A ARG 327 61 1 Y 1 A TYR 437 ? A TYR 328 62 1 Y 1 A PHE 438 ? A PHE 329 63 1 Y 1 A SER 439 ? A SER 330 64 1 Y 1 A GLU 440 ? A GLU 331 65 1 Y 1 A SER 441 ? A SER 332 66 1 Y 1 A ASP 442 ? A ASP 333 67 1 Y 1 A LYS 443 ? A LYS 334 68 1 Y 1 A VAL 444 ? A VAL 335 69 1 Y 1 A LEU 445 ? A LEU 336 70 1 Y 1 A VAL 446 ? A VAL 337 71 1 Y 1 A ALA 447 ? A ALA 338 72 1 Y 1 A GLN 448 ? A GLN 339 73 1 Y 1 A GLY 449 ? A GLY 340 74 1 Y 1 A VAL 450 ? A VAL 341 75 1 Y 1 A THR 451 ? A THR 342 76 1 Y 1 A GLY 452 ? A GLY 343 77 1 Y 1 A SER 453 ? A SER 344 78 1 Y 1 A VAL 454 ? A VAL 345 79 1 Y 1 A ILE 455 ? A ILE 346 80 1 Y 1 A SER 503 ? A SER 394 81 1 Y 1 A ALA 504 ? A ALA 395 82 1 Y 1 A GLN 505 ? A GLN 396 83 1 Y 1 A LEU 506 ? A LEU 397 84 1 Y 1 A GLU 507 ? A GLU 398 85 1 Y 1 A GLY 508 ? A GLY 399 86 1 Y 1 A GLY 509 ? A GLY 400 87 1 Y 1 A VAL 510 ? A VAL 401 88 1 Y 1 A HIS 511 ? A HIS 402 89 1 Y 1 A ASN 512 ? A ASN 403 90 1 Y 1 A LEU 513 ? A LEU 404 91 1 Y 1 A HIS 514 ? A HIS 405 92 1 Y 1 A SER 515 ? A SER 406 93 1 Y 1 A TYR 516 ? A TYR 407 94 1 Y 1 A GLU 517 ? A GLU 408 95 1 Y 1 A LYS 518 ? A LYS 409 96 1 Y 1 A ARG 519 ? A ARG 410 97 1 Y 1 A LEU 520 ? A LEU 411 98 1 Y 1 A PHE 521 ? A PHE 412 99 1 Y 1 A ASP 522 ? A ASP 413 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 THR N N N N 304 THR CA C N S 305 THR C C N N 306 THR O O N N 307 THR CB C N R 308 THR OG1 O N N 309 THR CG2 C N N 310 THR OXT O N N 311 THR H H N N 312 THR H2 H N N 313 THR HA H N N 314 THR HB H N N 315 THR HG1 H N N 316 THR HG21 H N N 317 THR HG22 H N N 318 THR HG23 H N N 319 THR HXT H N N 320 TRP N N N N 321 TRP CA C N S 322 TRP C C N N 323 TRP O O N N 324 TRP CB C N N 325 TRP CG C Y N 326 TRP CD1 C Y N 327 TRP CD2 C Y N 328 TRP NE1 N Y N 329 TRP CE2 C Y N 330 TRP CE3 C Y N 331 TRP CZ2 C Y N 332 TRP CZ3 C Y N 333 TRP CH2 C Y N 334 TRP OXT O N N 335 TRP H H N N 336 TRP H2 H N N 337 TRP HA H N N 338 TRP HB2 H N N 339 TRP HB3 H N N 340 TRP HD1 H N N 341 TRP HE1 H N N 342 TRP HE3 H N N 343 TRP HZ2 H N N 344 TRP HZ3 H N N 345 TRP HH2 H N N 346 TRP HXT H N N 347 TYR N N N N 348 TYR CA C N S 349 TYR C C N N 350 TYR O O N N 351 TYR CB C N N 352 TYR CG C Y N 353 TYR CD1 C Y N 354 TYR CD2 C Y N 355 TYR CE1 C Y N 356 TYR CE2 C Y N 357 TYR CZ C Y N 358 TYR OH O N N 359 TYR OXT O N N 360 TYR H H N N 361 TYR H2 H N N 362 TYR HA H N N 363 TYR HB2 H N N 364 TYR HB3 H N N 365 TYR HD1 H N N 366 TYR HD2 H N N 367 TYR HE1 H N N 368 TYR HE2 H N N 369 TYR HH H N N 370 TYR HXT H N N 371 VAL N N N N 372 VAL CA C N S 373 VAL C C N N 374 VAL O O N N 375 VAL CB C N N 376 VAL CG1 C N N 377 VAL CG2 C N N 378 VAL OXT O N N 379 VAL H H N N 380 VAL H2 H N N 381 VAL HA H N N 382 VAL HB H N N 383 VAL HG11 H N N 384 VAL HG12 H N N 385 VAL HG13 H N N 386 VAL HG21 H N N 387 VAL HG22 H N N 388 VAL HG23 H N N 389 VAL HXT H N N 390 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 THR N CA sing N N 290 THR N H sing N N 291 THR N H2 sing N N 292 THR CA C sing N N 293 THR CA CB sing N N 294 THR CA HA sing N N 295 THR C O doub N N 296 THR C OXT sing N N 297 THR CB OG1 sing N N 298 THR CB CG2 sing N N 299 THR CB HB sing N N 300 THR OG1 HG1 sing N N 301 THR CG2 HG21 sing N N 302 THR CG2 HG22 sing N N 303 THR CG2 HG23 sing N N 304 THR OXT HXT sing N N 305 TRP N CA sing N N 306 TRP N H sing N N 307 TRP N H2 sing N N 308 TRP CA C sing N N 309 TRP CA CB sing N N 310 TRP CA HA sing N N 311 TRP C O doub N N 312 TRP C OXT sing N N 313 TRP CB CG sing N N 314 TRP CB HB2 sing N N 315 TRP CB HB3 sing N N 316 TRP CG CD1 doub Y N 317 TRP CG CD2 sing Y N 318 TRP CD1 NE1 sing Y N 319 TRP CD1 HD1 sing N N 320 TRP CD2 CE2 doub Y N 321 TRP CD2 CE3 sing Y N 322 TRP NE1 CE2 sing Y N 323 TRP NE1 HE1 sing N N 324 TRP CE2 CZ2 sing Y N 325 TRP CE3 CZ3 doub Y N 326 TRP CE3 HE3 sing N N 327 TRP CZ2 CH2 doub Y N 328 TRP CZ2 HZ2 sing N N 329 TRP CZ3 CH2 sing Y N 330 TRP CZ3 HZ3 sing N N 331 TRP CH2 HH2 sing N N 332 TRP OXT HXT sing N N 333 TYR N CA sing N N 334 TYR N H sing N N 335 TYR N H2 sing N N 336 TYR CA C sing N N 337 TYR CA CB sing N N 338 TYR CA HA sing N N 339 TYR C O doub N N 340 TYR C OXT sing N N 341 TYR CB CG sing N N 342 TYR CB HB2 sing N N 343 TYR CB HB3 sing N N 344 TYR CG CD1 doub Y N 345 TYR CG CD2 sing Y N 346 TYR CD1 CE1 sing Y N 347 TYR CD1 HD1 sing N N 348 TYR CD2 CE2 doub Y N 349 TYR CD2 HD2 sing N N 350 TYR CE1 CZ doub Y N 351 TYR CE1 HE1 sing N N 352 TYR CE2 CZ sing Y N 353 TYR CE2 HE2 sing N N 354 TYR CZ OH sing N N 355 TYR OH HH sing N N 356 TYR OXT HXT sing N N 357 VAL N CA sing N N 358 VAL N H sing N N 359 VAL N H2 sing N N 360 VAL CA C sing N N 361 VAL CA CB sing N N 362 VAL CA HA sing N N 363 VAL C O doub N N 364 VAL C OXT sing N N 365 VAL CB CG1 sing N N 366 VAL CB CG2 sing N N 367 VAL CB HB sing N N 368 VAL CG1 HG11 sing N N 369 VAL CG1 HG12 sing N N 370 VAL CG1 HG13 sing N N 371 VAL CG2 HG21 sing N N 372 VAL CG2 HG22 sing N N 373 VAL CG2 HG23 sing N N 374 VAL OXT HXT sing N N 375 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 4AVF _pdbx_initial_refinement_model.details ? # _atom_sites.entry_id 4XWU _atom_sites.fract_transf_matrix[1][1] 0.009364 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.009364 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014351 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H K N O P S # loop_