data_4XYP # _entry.id 4XYP # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4XYP pdb_00004xyp 10.2210/pdb4xyp/pdb WWPDB D_1000206522 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-06-24 2 'Structure model' 1 1 2015-07-01 3 'Structure model' 1 2 2015-08-05 4 'Structure model' 1 3 2017-09-06 5 'Structure model' 1 4 2020-01-08 6 'Structure model' 1 5 2024-02-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 3 'Structure model' Other 4 4 'Structure model' 'Author supporting evidence' 5 4 'Structure model' 'Derived calculations' 6 5 'Structure model' 'Author supporting evidence' 7 6 'Structure model' 'Data collection' 8 6 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' pdbx_audit_support 2 4 'Structure model' pdbx_struct_oper_list 3 5 'Structure model' pdbx_audit_support 4 6 'Structure model' chem_comp_atom 5 6 'Structure model' chem_comp_bond 6 6 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_pdbx_audit_support.funding_organization' 2 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 5 'Structure model' '_pdbx_audit_support.funding_organization' 4 6 'Structure model' '_database_2.pdbx_DOI' 5 6 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4XYP _pdbx_database_status.recvd_initial_deposition_date 2015-02-02 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Cook, J.D.' 1 'Lee, J.E.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 290 _citation.language ? _citation.page_first 18495 _citation.page_last 18504 _citation.title ;Electrostatic Architecture of the Infectious Salmon Anemia Virus (ISAV) Core Fusion Protein Illustrates a Carboxyl-Carboxylate pH Sensor. ; _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M115.644781 _citation.pdbx_database_id_PubMed 26082488 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Cook, J.D.' 1 ? primary 'Soto-Montoya, H.' 2 ? primary 'Korpela, M.K.' 3 ? primary 'Lee, J.E.' 4 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Fusion protein' 7912.075 1 ? ? 'UNP residues 156-225' ? 2 non-polymer syn '3,7-BIS(DIMETHYLAMINO)PHENOTHIAZIN-5-IUM' 284.399 1 ? ? ? ? 3 non-polymer syn 'CHLORIDE ION' 35.453 2 ? ? ? ? 4 water nat water 18.015 6 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code VKEKLNGIIDQINKVNLLLEGEIEAVRRIAYMNQASSLQNQVEIGLIGEYLNISSWLETKTLTKTEEGLM _entity_poly.pdbx_seq_one_letter_code_can VKEKLNGIIDQINKVNLLLEGEIEAVRRIAYMNQASSLQNQVEIGLIGEYLNISSWLETKTLTKTEEGLM _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 '3,7-BIS(DIMETHYLAMINO)PHENOTHIAZIN-5-IUM' MBT 3 'CHLORIDE ION' CL 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 VAL n 1 2 LYS n 1 3 GLU n 1 4 LYS n 1 5 LEU n 1 6 ASN n 1 7 GLY n 1 8 ILE n 1 9 ILE n 1 10 ASP n 1 11 GLN n 1 12 ILE n 1 13 ASN n 1 14 LYS n 1 15 VAL n 1 16 ASN n 1 17 LEU n 1 18 LEU n 1 19 LEU n 1 20 GLU n 1 21 GLY n 1 22 GLU n 1 23 ILE n 1 24 GLU n 1 25 ALA n 1 26 VAL n 1 27 ARG n 1 28 ARG n 1 29 ILE n 1 30 ALA n 1 31 TYR n 1 32 MET n 1 33 ASN n 1 34 GLN n 1 35 ALA n 1 36 SER n 1 37 SER n 1 38 LEU n 1 39 GLN n 1 40 ASN n 1 41 GLN n 1 42 VAL n 1 43 GLU n 1 44 ILE n 1 45 GLY n 1 46 LEU n 1 47 ILE n 1 48 GLY n 1 49 GLU n 1 50 TYR n 1 51 LEU n 1 52 ASN n 1 53 ILE n 1 54 SER n 1 55 SER n 1 56 TRP n 1 57 LEU n 1 58 GLU n 1 59 THR n 1 60 LYS n 1 61 THR n 1 62 LEU n 1 63 THR n 1 64 LYS n 1 65 THR n 1 66 GLU n 1 67 GLU n 1 68 GLY n 1 69 LEU n 1 70 MET n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 70 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Infectious salmon anemia virus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 55987 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'BL21(DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET46 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CL non-polymer . 'CHLORIDE ION' ? 'Cl -1' 35.453 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MBT non-polymer . '3,7-BIS(DIMETHYLAMINO)PHENOTHIAZIN-5-IUM' 'METHYLENE BLUE' 'C16 H18 N3 S 1' 284.399 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 VAL 1 308 308 VAL VAL A . n A 1 2 LYS 2 309 309 LYS LYS A . n A 1 3 GLU 3 310 310 GLU GLU A . n A 1 4 LYS 4 311 311 LYS LYS A . n A 1 5 LEU 5 312 312 LEU LEU A . n A 1 6 ASN 6 313 313 ASN ASN A . n A 1 7 GLY 7 314 314 GLY GLY A . n A 1 8 ILE 8 315 315 ILE ILE A . n A 1 9 ILE 9 316 316 ILE ILE A . n A 1 10 ASP 10 317 317 ASP ASP A . n A 1 11 GLN 11 318 318 GLN GLN A . n A 1 12 ILE 12 319 319 ILE ILE A . n A 1 13 ASN 13 320 320 ASN ASN A . n A 1 14 LYS 14 321 321 LYS LYS A . n A 1 15 VAL 15 322 322 VAL VAL A . n A 1 16 ASN 16 323 323 ASN ASN A . n A 1 17 LEU 17 324 324 LEU LEU A . n A 1 18 LEU 18 325 325 LEU LEU A . n A 1 19 LEU 19 326 326 LEU LEU A . n A 1 20 GLU 20 327 327 GLU GLU A . n A 1 21 GLY 21 328 328 GLY GLY A . n A 1 22 GLU 22 329 329 GLU GLU A . n A 1 23 ILE 23 330 330 ILE ILE A . n A 1 24 GLU 24 331 331 GLU GLU A . n A 1 25 ALA 25 332 332 ALA ALA A . n A 1 26 VAL 26 333 333 VAL VAL A . n A 1 27 ARG 27 334 334 ARG ARG A . n A 1 28 ARG 28 335 335 ARG ARG A . n A 1 29 ILE 29 336 336 ILE ILE A . n A 1 30 ALA 30 337 337 ALA ALA A . n A 1 31 TYR 31 338 338 TYR TYR A . n A 1 32 MET 32 339 339 MET MET A . n A 1 33 ASN 33 340 340 ASN ASN A . n A 1 34 GLN 34 341 341 GLN GLN A . n A 1 35 ALA 35 342 342 ALA ALA A . n A 1 36 SER 36 343 343 SER SER A . n A 1 37 SER 37 344 344 SER SER A . n A 1 38 LEU 38 345 345 LEU LEU A . n A 1 39 GLN 39 346 346 GLN GLN A . n A 1 40 ASN 40 347 347 ASN ASN A . n A 1 41 GLN 41 348 348 GLN GLN A . n A 1 42 VAL 42 349 349 VAL VAL A . n A 1 43 GLU 43 350 350 GLU GLU A . n A 1 44 ILE 44 351 351 ILE ILE A . n A 1 45 GLY 45 352 352 GLY GLY A . n A 1 46 LEU 46 353 353 LEU LEU A . n A 1 47 ILE 47 354 354 ILE ILE A . n A 1 48 GLY 48 355 355 GLY GLY A . n A 1 49 GLU 49 356 356 GLU GLU A . n A 1 50 TYR 50 357 357 TYR TYR A . n A 1 51 LEU 51 358 358 LEU LEU A . n A 1 52 ASN 52 359 359 ASN ASN A . n A 1 53 ILE 53 360 360 ILE ILE A . n A 1 54 SER 54 361 361 SER SER A . n A 1 55 SER 55 362 362 SER SER A . n A 1 56 TRP 56 363 363 TRP TRP A . n A 1 57 LEU 57 364 364 LEU LEU A . n A 1 58 GLU 58 365 365 GLU GLU A . n A 1 59 THR 59 366 366 THR THR A . n A 1 60 LYS 60 367 367 LYS LYS A . n A 1 61 THR 61 368 368 THR THR A . n A 1 62 LEU 62 369 369 LEU LEU A . n A 1 63 THR 63 370 370 THR THR A . n A 1 64 LYS 64 371 371 LYS LYS A . n A 1 65 THR 65 372 372 THR THR A . n A 1 66 GLU 66 373 373 GLU GLU A . n A 1 67 GLU 67 374 374 GLU GLU A . n A 1 68 GLY 68 375 375 GLY GLY A . n A 1 69 LEU 69 376 376 LEU LEU A . n A 1 70 MET 70 377 377 MET MET A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 MBT 1 401 1 MBT MBT A . C 3 CL 1 402 2 CL CL A . D 3 CL 1 403 3 CL CL A . E 4 HOH 1 501 1 HOH HOH A . E 4 HOH 2 502 3 HOH HOH A . E 4 HOH 3 503 5 HOH HOH A . E 4 HOH 4 504 6 HOH HOH A . E 4 HOH 5 505 4 HOH HOH A . E 4 HOH 6 506 2 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A VAL 308 ? CG1 ? A VAL 1 CG1 2 1 Y 1 A VAL 308 ? CG2 ? A VAL 1 CG2 3 1 Y 1 A LYS 309 ? CG ? A LYS 2 CG 4 1 Y 1 A LYS 309 ? CD ? A LYS 2 CD 5 1 Y 1 A LYS 309 ? CE ? A LYS 2 CE 6 1 Y 1 A LYS 309 ? NZ ? A LYS 2 NZ 7 1 Y 1 A GLU 310 ? CG ? A GLU 3 CG 8 1 Y 1 A GLU 310 ? CD ? A GLU 3 CD 9 1 Y 1 A GLU 310 ? OE1 ? A GLU 3 OE1 10 1 Y 1 A GLU 310 ? OE2 ? A GLU 3 OE2 11 1 Y 1 A LYS 311 ? CG ? A LYS 4 CG 12 1 Y 1 A LYS 311 ? CD ? A LYS 4 CD 13 1 Y 1 A LYS 311 ? CE ? A LYS 4 CE 14 1 Y 1 A LYS 311 ? NZ ? A LYS 4 NZ 15 1 Y 1 A GLU 331 ? CG ? A GLU 24 CG 16 1 Y 1 A GLU 331 ? CD ? A GLU 24 CD 17 1 Y 1 A GLU 331 ? OE1 ? A GLU 24 OE1 18 1 Y 1 A GLU 331 ? OE2 ? A GLU 24 OE2 19 1 Y 1 A ARG 335 ? CG ? A ARG 28 CG 20 1 Y 1 A ARG 335 ? CD ? A ARG 28 CD 21 1 Y 1 A ARG 335 ? NE ? A ARG 28 NE 22 1 Y 1 A ARG 335 ? CZ ? A ARG 28 CZ 23 1 Y 1 A ARG 335 ? NH1 ? A ARG 28 NH1 24 1 Y 1 A ARG 335 ? NH2 ? A ARG 28 NH2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? 2.5.3 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? Aimless ? ? ? 0.1.27 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 4XYP _cell.details ? _cell.formula_units_Z ? _cell.length_a 42.874 _cell.length_a_esd ? _cell.length_b 42.874 _cell.length_b_esd ? _cell.length_c 232.245 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 18 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4XYP _symmetry.cell_setting ? _symmetry.Int_Tables_number 155 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'H 3 2' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4XYP _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.60 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.62 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 4.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details ;1:1 volume ratio of 30mg/mL protein solution and 0.2 M lithium sulfate, 0.1 M sodium acetate, pH 4.5, 2 mg/mL tetramethylthionine chloride and 50% (v/v) PEG 400 ; _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details '9 CCDs, 9 tiled fiber-optic tapers' _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX-300' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-12-14 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'DOUBLE CRYSTAL MONOCHROMATOR' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.979490 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'CLSI BEAMLINE 08ID-1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.979490 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 08ID-1 _diffrn_source.pdbx_synchrotron_site CLSI # _reflns.B_iso_Wilson_estimate 33.750 _reflns.entry_id 4XYP _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.100 _reflns.d_resolution_low 38.710 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 5037 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 97.600 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.700 _reflns.pdbx_Rmerge_I_obs 0.066 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 13.700 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all 0.032 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 23796 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half 0.999 _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.100 2.160 ? 3.200 1453 ? ? 361 ? 88.600 ? ? ? ? 0.495 ? ? ? ? ? ? ? ? 4.000 ? ? ? ? ? 0.247 0 1 1 0.833 ? 8.920 38.710 ? 27.800 325 ? ? 87 ? 93.800 ? ? ? ? 0.036 ? ? ? ? ? ? ? ? 3.700 ? ? ? ? ? 0.023 0 2 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 101.880 _refine.B_iso_mean 45.5257 _refine.B_iso_min 23.550 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4XYP _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.10 _refine.ls_d_res_low 38.7070 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 5030 _refine.ls_number_reflns_R_free 503 _refine.ls_number_reflns_R_work 4527 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.4800 _refine.ls_percent_reflns_R_free 10.0000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2010 _refine.ls_R_factor_R_free 0.2511 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1958 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.930 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details 'Random selection' _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 23.2300 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.1900 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.10 _refine_hist.d_res_low 38.7070 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 6 _refine_hist.number_atoms_total 557 _refine_hist.pdbx_number_residues_total 70 _refine_hist.pdbx_B_iso_mean_ligand 36.85 _refine_hist.pdbx_B_iso_mean_solvent 47.95 _refine_hist.pdbx_number_atoms_protein 529 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.011 ? 560 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.234 ? 762 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.054 ? 91 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 96 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 16.676 ? 198 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.10 2.3147 1209 . 121 1088 96.0000 . . . 0.2441 . 0.1706 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.3147 2.6496 1252 . 125 1127 100.0000 . . . 0.2173 . 0.1570 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 2.6496 3.3379 1256 . 126 1130 99.0000 . . . 0.2419 . 0.1889 . . . . . . 4 . . . 'X-RAY DIFFRACTION' 3.3379 38.7140 1313 . 131 1182 96.0000 . . . 0.2671 . 0.2150 . . . . . . 4 . . . # _struct.entry_id 4XYP _struct.title 'Crystal structure of a piscine viral fusion protein' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4XYP _struct_keywords.text 'heptad repeat, 6-helix bundle, class I viral fusion protein, VIRAL PROTEIN' _struct_keywords.pdbx_keywords 'VIRAL PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? E N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code V5RD79_9ORTO _struct_ref.pdbx_db_accession V5RD79 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code VKEKLNGIIDQINKVNLLLEGEIEAVRRIAYMNQASSLQNQVEIGLIGEYLNISSWLETKTLTKTEEGLM _struct_ref.pdbx_align_begin 156 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4XYP _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 70 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession V5RD79 _struct_ref_seq.db_align_beg 156 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 225 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 308 _struct_ref_seq.pdbx_auth_seq_align_end 377 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 9050 ? 1 MORE -111 ? 1 'SSA (A^2)' 12120 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_545 -y,x-y-1,z -0.5000000000 -0.8660254038 0.0000000000 21.4370000000 0.8660254038 -0.5000000000 0.0000000000 -37.1299731619 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_655 -x+y+1,-x,z -0.5000000000 0.8660254038 0.0000000000 42.8740000000 -0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 1 ? LEU A 51 ? VAL A 308 LEU A 358 1 ? 51 HELX_P HELX_P2 AA2 ILE A 53 ? MET A 70 ? ILE A 360 MET A 377 1 ? 18 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A MBT 401 ? 4 'binding site for residue MBT A 401' AC2 Software A CL 402 ? 4 'binding site for residue CL A 402' AC3 Software A CL 403 ? 3 'binding site for residue CL A 403' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 TYR A 50 ? TYR A 357 . ? 2_545 ? 2 AC1 4 TYR A 50 ? TYR A 357 . ? 1_555 ? 3 AC1 4 LEU A 51 ? LEU A 358 . ? 1_555 ? 4 AC1 4 LEU A 51 ? LEU A 358 . ? 2_545 ? 5 AC2 4 ALA A 30 ? ALA A 337 . ? 2_545 ? 6 AC2 4 ASN A 33 ? ASN A 340 . ? 3_655 ? 7 AC2 4 ASN A 33 ? ASN A 340 . ? 2_545 ? 8 AC2 4 ASN A 33 ? ASN A 340 . ? 1_555 ? 9 AC3 3 ASN A 40 ? ASN A 347 . ? 1_555 ? 10 AC3 3 ASN A 40 ? ASN A 347 . ? 3_655 ? 11 AC3 3 ASN A 40 ? ASN A 347 . ? 2_545 ? # loop_ _pdbx_struct_special_symmetry.id _pdbx_struct_special_symmetry.PDB_model_num _pdbx_struct_special_symmetry.auth_asym_id _pdbx_struct_special_symmetry.auth_comp_id _pdbx_struct_special_symmetry.auth_seq_id _pdbx_struct_special_symmetry.PDB_ins_code _pdbx_struct_special_symmetry.label_asym_id _pdbx_struct_special_symmetry.label_comp_id _pdbx_struct_special_symmetry.label_seq_id 1 1 A CL 402 ? C CL . 2 1 A CL 403 ? D CL . # _pdbx_phasing_MR.entry_id 4XYP _pdbx_phasing_MR.method_rotation ? _pdbx_phasing_MR.method_translation ? _pdbx_phasing_MR.model_details ? _pdbx_phasing_MR.R_factor ? _pdbx_phasing_MR.R_rigid_body ? _pdbx_phasing_MR.correlation_coeff_Fo_to_Fc ? _pdbx_phasing_MR.correlation_coeff_Io_to_Ic ? _pdbx_phasing_MR.d_res_high_rotation 2.100 _pdbx_phasing_MR.d_res_low_rotation 38.710 _pdbx_phasing_MR.d_res_high_translation 2.100 _pdbx_phasing_MR.d_res_low_translation 38.710 _pdbx_phasing_MR.packing ? _pdbx_phasing_MR.reflns_percent_rotation ? _pdbx_phasing_MR.reflns_percent_translation ? _pdbx_phasing_MR.sigma_F_rotation ? _pdbx_phasing_MR.sigma_F_translation ? _pdbx_phasing_MR.sigma_I_rotation ? _pdbx_phasing_MR.sigma_I_translation ? # _phasing.method MR # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CL CL CL N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HOH O O N N 124 HOH H1 H N N 125 HOH H2 H N N 126 ILE N N N N 127 ILE CA C N S 128 ILE C C N N 129 ILE O O N N 130 ILE CB C N S 131 ILE CG1 C N N 132 ILE CG2 C N N 133 ILE CD1 C N N 134 ILE OXT O N N 135 ILE H H N N 136 ILE H2 H N N 137 ILE HA H N N 138 ILE HB H N N 139 ILE HG12 H N N 140 ILE HG13 H N N 141 ILE HG21 H N N 142 ILE HG22 H N N 143 ILE HG23 H N N 144 ILE HD11 H N N 145 ILE HD12 H N N 146 ILE HD13 H N N 147 ILE HXT H N N 148 LEU N N N N 149 LEU CA C N S 150 LEU C C N N 151 LEU O O N N 152 LEU CB C N N 153 LEU CG C N N 154 LEU CD1 C N N 155 LEU CD2 C N N 156 LEU OXT O N N 157 LEU H H N N 158 LEU H2 H N N 159 LEU HA H N N 160 LEU HB2 H N N 161 LEU HB3 H N N 162 LEU HG H N N 163 LEU HD11 H N N 164 LEU HD12 H N N 165 LEU HD13 H N N 166 LEU HD21 H N N 167 LEU HD22 H N N 168 LEU HD23 H N N 169 LEU HXT H N N 170 LYS N N N N 171 LYS CA C N S 172 LYS C C N N 173 LYS O O N N 174 LYS CB C N N 175 LYS CG C N N 176 LYS CD C N N 177 LYS CE C N N 178 LYS NZ N N N 179 LYS OXT O N N 180 LYS H H N N 181 LYS H2 H N N 182 LYS HA H N N 183 LYS HB2 H N N 184 LYS HB3 H N N 185 LYS HG2 H N N 186 LYS HG3 H N N 187 LYS HD2 H N N 188 LYS HD3 H N N 189 LYS HE2 H N N 190 LYS HE3 H N N 191 LYS HZ1 H N N 192 LYS HZ2 H N N 193 LYS HZ3 H N N 194 LYS HXT H N N 195 MBT C1 C Y N 196 MBT C2 C Y N 197 MBT S3 S Y N 198 MBT C4 C Y N 199 MBT C5 C Y N 200 MBT N6 N Y N 201 MBT C7 C Y N 202 MBT C8 C Y N 203 MBT C9 C Y N 204 MBT C10 C Y N 205 MBT C11 C Y N 206 MBT C12 C Y N 207 MBT C13 C Y N 208 MBT C14 C Y N 209 MBT N15 N N N 210 MBT C16 C N N 211 MBT C17 C N N 212 MBT N18 N N N 213 MBT C19 C N N 214 MBT C20 C N N 215 MBT H191 H N N 216 MBT H192 H N N 217 MBT H193 H N N 218 MBT H201 H N N 219 MBT H202 H N N 220 MBT H203 H N N 221 MBT H13 H N N 222 MBT H14 H N N 223 MBT H10 H N N 224 MBT H9 H N N 225 MBT H7 H N N 226 MBT H11 H N N 227 MBT H161 H N N 228 MBT H162 H N N 229 MBT H163 H N N 230 MBT H171 H N N 231 MBT H172 H N N 232 MBT H173 H N N 233 MET N N N N 234 MET CA C N S 235 MET C C N N 236 MET O O N N 237 MET CB C N N 238 MET CG C N N 239 MET SD S N N 240 MET CE C N N 241 MET OXT O N N 242 MET H H N N 243 MET H2 H N N 244 MET HA H N N 245 MET HB2 H N N 246 MET HB3 H N N 247 MET HG2 H N N 248 MET HG3 H N N 249 MET HE1 H N N 250 MET HE2 H N N 251 MET HE3 H N N 252 MET HXT H N N 253 SER N N N N 254 SER CA C N S 255 SER C C N N 256 SER O O N N 257 SER CB C N N 258 SER OG O N N 259 SER OXT O N N 260 SER H H N N 261 SER H2 H N N 262 SER HA H N N 263 SER HB2 H N N 264 SER HB3 H N N 265 SER HG H N N 266 SER HXT H N N 267 THR N N N N 268 THR CA C N S 269 THR C C N N 270 THR O O N N 271 THR CB C N R 272 THR OG1 O N N 273 THR CG2 C N N 274 THR OXT O N N 275 THR H H N N 276 THR H2 H N N 277 THR HA H N N 278 THR HB H N N 279 THR HG1 H N N 280 THR HG21 H N N 281 THR HG22 H N N 282 THR HG23 H N N 283 THR HXT H N N 284 TRP N N N N 285 TRP CA C N S 286 TRP C C N N 287 TRP O O N N 288 TRP CB C N N 289 TRP CG C Y N 290 TRP CD1 C Y N 291 TRP CD2 C Y N 292 TRP NE1 N Y N 293 TRP CE2 C Y N 294 TRP CE3 C Y N 295 TRP CZ2 C Y N 296 TRP CZ3 C Y N 297 TRP CH2 C Y N 298 TRP OXT O N N 299 TRP H H N N 300 TRP H2 H N N 301 TRP HA H N N 302 TRP HB2 H N N 303 TRP HB3 H N N 304 TRP HD1 H N N 305 TRP HE1 H N N 306 TRP HE3 H N N 307 TRP HZ2 H N N 308 TRP HZ3 H N N 309 TRP HH2 H N N 310 TRP HXT H N N 311 TYR N N N N 312 TYR CA C N S 313 TYR C C N N 314 TYR O O N N 315 TYR CB C N N 316 TYR CG C Y N 317 TYR CD1 C Y N 318 TYR CD2 C Y N 319 TYR CE1 C Y N 320 TYR CE2 C Y N 321 TYR CZ C Y N 322 TYR OH O N N 323 TYR OXT O N N 324 TYR H H N N 325 TYR H2 H N N 326 TYR HA H N N 327 TYR HB2 H N N 328 TYR HB3 H N N 329 TYR HD1 H N N 330 TYR HD2 H N N 331 TYR HE1 H N N 332 TYR HE2 H N N 333 TYR HH H N N 334 TYR HXT H N N 335 VAL N N N N 336 VAL CA C N S 337 VAL C C N N 338 VAL O O N N 339 VAL CB C N N 340 VAL CG1 C N N 341 VAL CG2 C N N 342 VAL OXT O N N 343 VAL H H N N 344 VAL H2 H N N 345 VAL HA H N N 346 VAL HB H N N 347 VAL HG11 H N N 348 VAL HG12 H N N 349 VAL HG13 H N N 350 VAL HG21 H N N 351 VAL HG22 H N N 352 VAL HG23 H N N 353 VAL HXT H N N 354 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 GLN N CA sing N N 70 GLN N H sing N N 71 GLN N H2 sing N N 72 GLN CA C sing N N 73 GLN CA CB sing N N 74 GLN CA HA sing N N 75 GLN C O doub N N 76 GLN C OXT sing N N 77 GLN CB CG sing N N 78 GLN CB HB2 sing N N 79 GLN CB HB3 sing N N 80 GLN CG CD sing N N 81 GLN CG HG2 sing N N 82 GLN CG HG3 sing N N 83 GLN CD OE1 doub N N 84 GLN CD NE2 sing N N 85 GLN NE2 HE21 sing N N 86 GLN NE2 HE22 sing N N 87 GLN OXT HXT sing N N 88 GLU N CA sing N N 89 GLU N H sing N N 90 GLU N H2 sing N N 91 GLU CA C sing N N 92 GLU CA CB sing N N 93 GLU CA HA sing N N 94 GLU C O doub N N 95 GLU C OXT sing N N 96 GLU CB CG sing N N 97 GLU CB HB2 sing N N 98 GLU CB HB3 sing N N 99 GLU CG CD sing N N 100 GLU CG HG2 sing N N 101 GLU CG HG3 sing N N 102 GLU CD OE1 doub N N 103 GLU CD OE2 sing N N 104 GLU OE2 HE2 sing N N 105 GLU OXT HXT sing N N 106 GLY N CA sing N N 107 GLY N H sing N N 108 GLY N H2 sing N N 109 GLY CA C sing N N 110 GLY CA HA2 sing N N 111 GLY CA HA3 sing N N 112 GLY C O doub N N 113 GLY C OXT sing N N 114 GLY OXT HXT sing N N 115 HOH O H1 sing N N 116 HOH O H2 sing N N 117 ILE N CA sing N N 118 ILE N H sing N N 119 ILE N H2 sing N N 120 ILE CA C sing N N 121 ILE CA CB sing N N 122 ILE CA HA sing N N 123 ILE C O doub N N 124 ILE C OXT sing N N 125 ILE CB CG1 sing N N 126 ILE CB CG2 sing N N 127 ILE CB HB sing N N 128 ILE CG1 CD1 sing N N 129 ILE CG1 HG12 sing N N 130 ILE CG1 HG13 sing N N 131 ILE CG2 HG21 sing N N 132 ILE CG2 HG22 sing N N 133 ILE CG2 HG23 sing N N 134 ILE CD1 HD11 sing N N 135 ILE CD1 HD12 sing N N 136 ILE CD1 HD13 sing N N 137 ILE OXT HXT sing N N 138 LEU N CA sing N N 139 LEU N H sing N N 140 LEU N H2 sing N N 141 LEU CA C sing N N 142 LEU CA CB sing N N 143 LEU CA HA sing N N 144 LEU C O doub N N 145 LEU C OXT sing N N 146 LEU CB CG sing N N 147 LEU CB HB2 sing N N 148 LEU CB HB3 sing N N 149 LEU CG CD1 sing N N 150 LEU CG CD2 sing N N 151 LEU CG HG sing N N 152 LEU CD1 HD11 sing N N 153 LEU CD1 HD12 sing N N 154 LEU CD1 HD13 sing N N 155 LEU CD2 HD21 sing N N 156 LEU CD2 HD22 sing N N 157 LEU CD2 HD23 sing N N 158 LEU OXT HXT sing N N 159 LYS N CA sing N N 160 LYS N H sing N N 161 LYS N H2 sing N N 162 LYS CA C sing N N 163 LYS CA CB sing N N 164 LYS CA HA sing N N 165 LYS C O doub N N 166 LYS C OXT sing N N 167 LYS CB CG sing N N 168 LYS CB HB2 sing N N 169 LYS CB HB3 sing N N 170 LYS CG CD sing N N 171 LYS CG HG2 sing N N 172 LYS CG HG3 sing N N 173 LYS CD CE sing N N 174 LYS CD HD2 sing N N 175 LYS CD HD3 sing N N 176 LYS CE NZ sing N N 177 LYS CE HE2 sing N N 178 LYS CE HE3 sing N N 179 LYS NZ HZ1 sing N N 180 LYS NZ HZ2 sing N N 181 LYS NZ HZ3 sing N N 182 LYS OXT HXT sing N N 183 MBT C1 C14 sing Y N 184 MBT C1 N6 doub Y N 185 MBT C1 C2 sing Y N 186 MBT C2 S3 doub Y N 187 MBT C2 C11 sing Y N 188 MBT S3 C4 sing Y N 189 MBT C4 C7 doub Y N 190 MBT C4 C5 sing Y N 191 MBT C5 N6 sing Y N 192 MBT C5 C10 doub Y N 193 MBT C7 C8 sing Y N 194 MBT C7 H7 sing N N 195 MBT C8 C9 doub Y N 196 MBT C8 N15 sing N N 197 MBT C9 C10 sing Y N 198 MBT C9 H9 sing N N 199 MBT C10 H10 sing N N 200 MBT C11 C12 doub Y N 201 MBT C11 H11 sing N N 202 MBT C12 N18 sing N N 203 MBT C12 C13 sing Y N 204 MBT C13 C14 doub Y N 205 MBT C13 H13 sing N N 206 MBT C14 H14 sing N N 207 MBT N15 C16 sing N N 208 MBT N15 C17 sing N N 209 MBT C16 H161 sing N N 210 MBT C16 H162 sing N N 211 MBT C16 H163 sing N N 212 MBT C17 H171 sing N N 213 MBT C17 H172 sing N N 214 MBT C17 H173 sing N N 215 MBT N18 C19 sing N N 216 MBT N18 C20 sing N N 217 MBT C19 H191 sing N N 218 MBT C19 H192 sing N N 219 MBT C19 H193 sing N N 220 MBT C20 H201 sing N N 221 MBT C20 H202 sing N N 222 MBT C20 H203 sing N N 223 MET N CA sing N N 224 MET N H sing N N 225 MET N H2 sing N N 226 MET CA C sing N N 227 MET CA CB sing N N 228 MET CA HA sing N N 229 MET C O doub N N 230 MET C OXT sing N N 231 MET CB CG sing N N 232 MET CB HB2 sing N N 233 MET CB HB3 sing N N 234 MET CG SD sing N N 235 MET CG HG2 sing N N 236 MET CG HG3 sing N N 237 MET SD CE sing N N 238 MET CE HE1 sing N N 239 MET CE HE2 sing N N 240 MET CE HE3 sing N N 241 MET OXT HXT sing N N 242 SER N CA sing N N 243 SER N H sing N N 244 SER N H2 sing N N 245 SER CA C sing N N 246 SER CA CB sing N N 247 SER CA HA sing N N 248 SER C O doub N N 249 SER C OXT sing N N 250 SER CB OG sing N N 251 SER CB HB2 sing N N 252 SER CB HB3 sing N N 253 SER OG HG sing N N 254 SER OXT HXT sing N N 255 THR N CA sing N N 256 THR N H sing N N 257 THR N H2 sing N N 258 THR CA C sing N N 259 THR CA CB sing N N 260 THR CA HA sing N N 261 THR C O doub N N 262 THR C OXT sing N N 263 THR CB OG1 sing N N 264 THR CB CG2 sing N N 265 THR CB HB sing N N 266 THR OG1 HG1 sing N N 267 THR CG2 HG21 sing N N 268 THR CG2 HG22 sing N N 269 THR CG2 HG23 sing N N 270 THR OXT HXT sing N N 271 TRP N CA sing N N 272 TRP N H sing N N 273 TRP N H2 sing N N 274 TRP CA C sing N N 275 TRP CA CB sing N N 276 TRP CA HA sing N N 277 TRP C O doub N N 278 TRP C OXT sing N N 279 TRP CB CG sing N N 280 TRP CB HB2 sing N N 281 TRP CB HB3 sing N N 282 TRP CG CD1 doub Y N 283 TRP CG CD2 sing Y N 284 TRP CD1 NE1 sing Y N 285 TRP CD1 HD1 sing N N 286 TRP CD2 CE2 doub Y N 287 TRP CD2 CE3 sing Y N 288 TRP NE1 CE2 sing Y N 289 TRP NE1 HE1 sing N N 290 TRP CE2 CZ2 sing Y N 291 TRP CE3 CZ3 doub Y N 292 TRP CE3 HE3 sing N N 293 TRP CZ2 CH2 doub Y N 294 TRP CZ2 HZ2 sing N N 295 TRP CZ3 CH2 sing Y N 296 TRP CZ3 HZ3 sing N N 297 TRP CH2 HH2 sing N N 298 TRP OXT HXT sing N N 299 TYR N CA sing N N 300 TYR N H sing N N 301 TYR N H2 sing N N 302 TYR CA C sing N N 303 TYR CA CB sing N N 304 TYR CA HA sing N N 305 TYR C O doub N N 306 TYR C OXT sing N N 307 TYR CB CG sing N N 308 TYR CB HB2 sing N N 309 TYR CB HB3 sing N N 310 TYR CG CD1 doub Y N 311 TYR CG CD2 sing Y N 312 TYR CD1 CE1 sing Y N 313 TYR CD1 HD1 sing N N 314 TYR CD2 CE2 doub Y N 315 TYR CD2 HD2 sing N N 316 TYR CE1 CZ doub Y N 317 TYR CE1 HE1 sing N N 318 TYR CE2 CZ sing Y N 319 TYR CE2 HE2 sing N N 320 TYR CZ OH sing N N 321 TYR OH HH sing N N 322 TYR OXT HXT sing N N 323 VAL N CA sing N N 324 VAL N H sing N N 325 VAL N H2 sing N N 326 VAL CA C sing N N 327 VAL CA CB sing N N 328 VAL CA HA sing N N 329 VAL C O doub N N 330 VAL C OXT sing N N 331 VAL CB CG1 sing N N 332 VAL CB CG2 sing N N 333 VAL CB HB sing N N 334 VAL CG1 HG11 sing N N 335 VAL CG1 HG12 sing N N 336 VAL CG1 HG13 sing N N 337 VAL CG2 HG21 sing N N 338 VAL CG2 HG22 sing N N 339 VAL CG2 HG23 sing N N 340 VAL OXT HXT sing N N 341 # _pdbx_audit_support.funding_organization 'Natural Sciences and Engineering Research Council (NSERC, Canada)' _pdbx_audit_support.country Canada _pdbx_audit_support.grant_number RGPIN435607-13 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 4XYP _atom_sites.fract_transf_matrix[1][1] 0.023324 _atom_sites.fract_transf_matrix[1][2] 0.013466 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.026932 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.004306 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C CL H N O S # loop_