data_4Y13 # _entry.id 4Y13 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.319 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 4Y13 WWPDB D_1000206636 # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 4Y15 PDB . unspecified 4Y17 PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4Y13 _pdbx_database_status.recvd_initial_deposition_date 2015-02-06 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal _audit_author.identifier_ORCID 'Nguyen, N.X.' 1 ? 'Nguyen, Y.' 2 ? 'Sperandio, V.' 3 ? 'Jiang, Y.' 4 ? # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Mbio _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2150-7511 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Structural and Mechanistic Roles of Novel Chemical Ligands on the SdiA Quorum-Sensing Transcription Regulator.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1128/mBio.02429-14 _citation.pdbx_database_id_PubMed 25827420 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nguyen, Y.' 1 ? primary 'Nguyen, N.X.' 2 ? primary 'Rogers, J.L.' 3 ? primary 'Liao, J.' 4 ? primary 'MacMillan, J.B.' 5 ? primary 'Jiang, Y.' 6 ? primary 'Sperandio, V.' 7 ? # _cell.entry_id 4Y13 _cell.length_a 129.857 _cell.length_b 129.857 _cell.length_c 125.680 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 120.00 _cell.Z_PDB 12 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4Y13 _symmetry.space_group_name_H-M 'P 65 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 179 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Transcriptional regulator of ftsQAZ gene cluster' 29539.904 1 ? ? ? ? 2 non-polymer syn 'SULFATE ION' 96.063 2 ? ? ? ? 3 non-polymer syn '(2S)-2,3-dihydroxypropyl octanoate' 218.290 1 ? ? ? ? 4 non-polymer nat GLYCEROL 92.094 2 ? ? ? ? 5 water nat water 18.015 5 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)QDTDFFSWRRT(MSE)LLRFQR(MSE)ETAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWV SYYQAKNFLAIDPVLNPENFSQGHL(MSE)WNDDLFNEAQPLWEAARAHGLRRGVTQYL(MSE)LPNRALGFLSFSRCSA REIPILSDELQLK(MSE)QLLVRESL(MSE)AL(MSE)RLNDEIV(MSE)TPE(MSE)NFSKREKEILRWTAEGKTSAEI A(MSE)ILSISENTVNFHQKN(MSE)QKKINAPNKTQVACYAAATGLIHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MQDTDFFSWRRTMLLRFQRMETAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSYYQAKNFLAID PVLNPENFSQGHLMWNDDLFNEAQPLWEAARAHGLRRGVTQYLMLPNRALGFLSFSRCSAREIPILSDELQLKMQLLVRE SLMALMRLNDEIVMTPEMNFSKREKEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI HHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 GLN n 1 3 ASP n 1 4 THR n 1 5 ASP n 1 6 PHE n 1 7 PHE n 1 8 SER n 1 9 TRP n 1 10 ARG n 1 11 ARG n 1 12 THR n 1 13 MSE n 1 14 LEU n 1 15 LEU n 1 16 ARG n 1 17 PHE n 1 18 GLN n 1 19 ARG n 1 20 MSE n 1 21 GLU n 1 22 THR n 1 23 ALA n 1 24 GLU n 1 25 GLU n 1 26 VAL n 1 27 TYR n 1 28 HIS n 1 29 GLU n 1 30 ILE n 1 31 GLU n 1 32 LEU n 1 33 GLN n 1 34 ALA n 1 35 GLN n 1 36 GLN n 1 37 LEU n 1 38 GLU n 1 39 TYR n 1 40 ASP n 1 41 TYR n 1 42 TYR n 1 43 SER n 1 44 LEU n 1 45 CYS n 1 46 VAL n 1 47 ARG n 1 48 HIS n 1 49 PRO n 1 50 VAL n 1 51 PRO n 1 52 PHE n 1 53 THR n 1 54 ARG n 1 55 PRO n 1 56 LYS n 1 57 VAL n 1 58 ALA n 1 59 PHE n 1 60 TYR n 1 61 THR n 1 62 ASN n 1 63 TYR n 1 64 PRO n 1 65 GLU n 1 66 ALA n 1 67 TRP n 1 68 VAL n 1 69 SER n 1 70 TYR n 1 71 TYR n 1 72 GLN n 1 73 ALA n 1 74 LYS n 1 75 ASN n 1 76 PHE n 1 77 LEU n 1 78 ALA n 1 79 ILE n 1 80 ASP n 1 81 PRO n 1 82 VAL n 1 83 LEU n 1 84 ASN n 1 85 PRO n 1 86 GLU n 1 87 ASN n 1 88 PHE n 1 89 SER n 1 90 GLN n 1 91 GLY n 1 92 HIS n 1 93 LEU n 1 94 MSE n 1 95 TRP n 1 96 ASN n 1 97 ASP n 1 98 ASP n 1 99 LEU n 1 100 PHE n 1 101 ASN n 1 102 GLU n 1 103 ALA n 1 104 GLN n 1 105 PRO n 1 106 LEU n 1 107 TRP n 1 108 GLU n 1 109 ALA n 1 110 ALA n 1 111 ARG n 1 112 ALA n 1 113 HIS n 1 114 GLY n 1 115 LEU n 1 116 ARG n 1 117 ARG n 1 118 GLY n 1 119 VAL n 1 120 THR n 1 121 GLN n 1 122 TYR n 1 123 LEU n 1 124 MSE n 1 125 LEU n 1 126 PRO n 1 127 ASN n 1 128 ARG n 1 129 ALA n 1 130 LEU n 1 131 GLY n 1 132 PHE n 1 133 LEU n 1 134 SER n 1 135 PHE n 1 136 SER n 1 137 ARG n 1 138 CYS n 1 139 SER n 1 140 ALA n 1 141 ARG n 1 142 GLU n 1 143 ILE n 1 144 PRO n 1 145 ILE n 1 146 LEU n 1 147 SER n 1 148 ASP n 1 149 GLU n 1 150 LEU n 1 151 GLN n 1 152 LEU n 1 153 LYS n 1 154 MSE n 1 155 GLN n 1 156 LEU n 1 157 LEU n 1 158 VAL n 1 159 ARG n 1 160 GLU n 1 161 SER n 1 162 LEU n 1 163 MSE n 1 164 ALA n 1 165 LEU n 1 166 MSE n 1 167 ARG n 1 168 LEU n 1 169 ASN n 1 170 ASP n 1 171 GLU n 1 172 ILE n 1 173 VAL n 1 174 MSE n 1 175 THR n 1 176 PRO n 1 177 GLU n 1 178 MSE n 1 179 ASN n 1 180 PHE n 1 181 SER n 1 182 LYS n 1 183 ARG n 1 184 GLU n 1 185 LYS n 1 186 GLU n 1 187 ILE n 1 188 LEU n 1 189 ARG n 1 190 TRP n 1 191 THR n 1 192 ALA n 1 193 GLU n 1 194 GLY n 1 195 LYS n 1 196 THR n 1 197 SER n 1 198 ALA n 1 199 GLU n 1 200 ILE n 1 201 ALA n 1 202 MSE n 1 203 ILE n 1 204 LEU n 1 205 SER n 1 206 ILE n 1 207 SER n 1 208 GLU n 1 209 ASN n 1 210 THR n 1 211 VAL n 1 212 ASN n 1 213 PHE n 1 214 HIS n 1 215 GLN n 1 216 LYS n 1 217 ASN n 1 218 MSE n 1 219 GLN n 1 220 LYS n 1 221 LYS n 1 222 ILE n 1 223 ASN n 1 224 ALA n 1 225 PRO n 1 226 ASN n 1 227 LYS n 1 228 THR n 1 229 GLN n 1 230 VAL n 1 231 ALA n 1 232 CYS n 1 233 TYR n 1 234 ALA n 1 235 ALA n 1 236 ALA n 1 237 THR n 1 238 GLY n 1 239 LEU n 1 240 ILE n 1 241 HIS n 1 242 HIS n 1 243 HIS n 1 244 HIS n 1 245 HIS n 1 246 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 246 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'sdiA, ECs2654, Z3004' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain O157:H7 _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Escherichia coli O157:H7' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 83334 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q8XBD0_ECO57 _struct_ref.pdbx_db_accession Q8XBD0 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MQDTDFFSWRRTMLLRFQRMETAEEVYHEIELQAQQLEYDYYSLCVRHPVPFTRPKVAFYTNYPEAWVSYYQAKNFLAID PVLNPENFSQGHLMWNDDLFNEAQPLWEAARAHGLRRGVTQYLMLPNRALGFLSFSRCSAREIPILSDELQLKMQLLVRE SLMALMRLNDEIVMTPEMNFSKREKEILRWTAEGKTSAEIAMILSISENTVNFHQKNMQKKINAPNKTQVACYAAATGLI ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4Y13 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 240 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q8XBD0 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 240 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 240 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 4Y13 HIS A 241 ? UNP Q8XBD0 ? ? 'expression tag' 241 1 1 4Y13 HIS A 242 ? UNP Q8XBD0 ? ? 'expression tag' 242 2 1 4Y13 HIS A 243 ? UNP Q8XBD0 ? ? 'expression tag' 243 3 1 4Y13 HIS A 244 ? UNP Q8XBD0 ? ? 'expression tag' 244 4 1 4Y13 HIS A 245 ? UNP Q8XBD0 ? ? 'expression tag' 245 5 1 4Y13 HIS A 246 ? UNP Q8XBD0 ? ? 'expression tag' 246 6 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight 480 non-polymer . '(2S)-2,3-dihydroxypropyl octanoate' ? 'C11 H22 O4' 218.290 ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 GOL non-polymer . GLYCEROL 'GLYCERIN; PROPANE-1,2,3-TRIOL' 'C3 H8 O3' 92.094 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4Y13 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 5.17 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 76.03 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '5% (w/v) PEG 3350, 0.1M MES pH6.75, 0.1M ammonium sulfate' _exptl_crystal_grow.pdbx_pH_range 6.5-7.0 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'MARMOSAIC 300 mm CCD' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2011-12-02 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.083 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 23-ID-B' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.083 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 23-ID-B _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4Y13 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.095 _reflns.d_resolution_low 45.155 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 21605 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.91 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 28.4 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value 0.138 _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 1.33 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.d_res_high 3.095 _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_sigI_obs 2.3 _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_gt ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_gt ? _reflns_shell.number_unique_obs ? _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_diffrn_id ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_redundancy 29.3 _reflns_shell.pdbx_rejects ? _reflns_shell.percent_possible_all 100 _reflns_shell.percent_possible_gt ? _reflns_shell.percent_possible_obs ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 4Y13 _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 21605 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.33 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 45.155 _refine.ls_d_res_high 3.096 _refine.ls_percent_reflns_obs 99.91 _refine.ls_R_factor_obs 0.2005 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.1985 _refine.ls_R_factor_R_free 0.2400 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.98 _refine.ls_number_reflns_R_free 1077 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.43 _refine.pdbx_overall_phase_error 25.59 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 2000 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 37 _refine_hist.number_atoms_solvent 5 _refine_hist.number_atoms_total 2042 _refine_hist.d_res_high 3.096 _refine_hist.d_res_low 45.155 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.003 ? ? 2095 'X-RAY DIFFRACTION' ? f_angle_d 0.669 ? ? 2831 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 12.906 ? ? 788 'X-RAY DIFFRACTION' ? f_chiral_restr 0.028 ? ? 299 'X-RAY DIFFRACTION' ? f_plane_restr 0.002 ? ? 362 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 3.0955 3.2364 2566 0.3317 100.00 0.3785 . . 132 . . . . 'X-RAY DIFFRACTION' . 3.2364 3.4070 2570 0.2785 100.00 0.3208 . . 143 . . . . 'X-RAY DIFFRACTION' . 3.4070 3.6203 2549 0.2429 100.00 0.2642 . . 139 . . . . 'X-RAY DIFFRACTION' . 3.6203 3.8997 2565 0.2150 100.00 0.2369 . . 133 . . . . 'X-RAY DIFFRACTION' . 3.8997 4.2919 2572 0.1954 100.00 0.2699 . . 132 . . . . 'X-RAY DIFFRACTION' . 4.2919 4.9123 2545 0.1699 100.00 0.2174 . . 135 . . . . 'X-RAY DIFFRACTION' . 4.9123 6.1865 2585 0.1887 100.00 0.2287 . . 133 . . . . 'X-RAY DIFFRACTION' . 6.1865 45.1597 2576 0.1711 100.00 0.2066 . . 130 . . . . # _struct.entry_id 4Y13 _struct.title 'SdiA in complex with octanoyl-rac-glycerol' _struct.pdbx_descriptor 'SdiA in complex with octanoyl-rac-glycerol' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4Y13 _struct_keywords.text 'Quorum sensor, DNA, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 2 ? D N N 3 ? E N N 4 ? F N N 4 ? G N N 5 ? # _struct_biol.details ? _struct_biol.id 1 _struct_biol.pdbx_parent_biol_id ? _struct_biol.pdbx_formula_weight ? _struct_biol.pdbx_formula_weight_method ? _struct_biol.pdbx_aggregation_state ? _struct_biol.pdbx_assembly_method SEC-MALS # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 5 ? ARG A 19 ? ASP A 5 ARG A 19 1 ? 15 HELX_P HELX_P2 AA2 THR A 22 ? LEU A 37 ? THR A 22 LEU A 37 1 ? 16 HELX_P HELX_P3 AA3 PRO A 64 ? LYS A 74 ? PRO A 64 LYS A 74 1 ? 11 HELX_P HELX_P4 AA4 ASN A 75 ? PHE A 88 ? ASN A 75 PHE A 88 5 ? 14 HELX_P HELX_P5 AA5 ASN A 96 ? ASN A 101 ? ASN A 96 ASN A 101 5 ? 6 HELX_P HELX_P6 AA6 ALA A 103 ? HIS A 113 ? ALA A 103 HIS A 113 1 ? 11 HELX_P HELX_P7 AA7 LEU A 146 ? LEU A 168 ? LEU A 146 LEU A 168 1 ? 23 HELX_P HELX_P8 AA8 SER A 181 ? GLU A 193 ? SER A 181 GLU A 193 1 ? 13 HELX_P HELX_P9 AA9 THR A 196 ? SER A 205 ? THR A 196 SER A 205 1 ? 10 HELX_P HELX_P10 AB1 SER A 207 ? ASN A 223 ? SER A 207 ASN A 223 1 ? 17 HELX_P HELX_P11 AB2 ASN A 226 ? THR A 237 ? ASN A 226 THR A 237 1 ? 12 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A MSE 1 C ? ? ? 1_555 A GLN 2 N ? ? A MSE 1 A GLN 2 1_555 ? ? ? ? ? ? ? 1.331 ? covale2 covale both ? A THR 12 C ? ? ? 1_555 A MSE 13 N ? ? A THR 12 A MSE 13 1_555 ? ? ? ? ? ? ? 1.329 ? covale3 covale both ? A MSE 13 C ? ? ? 1_555 A LEU 14 N ? ? A MSE 13 A LEU 14 1_555 ? ? ? ? ? ? ? 1.329 ? covale4 covale both ? A ARG 19 C ? ? ? 1_555 A MSE 20 N ? ? A ARG 19 A MSE 20 1_555 ? ? ? ? ? ? ? 1.331 ? covale5 covale both ? A MSE 20 C ? ? ? 1_555 A GLU 21 N ? ? A MSE 20 A GLU 21 1_555 ? ? ? ? ? ? ? 1.329 ? covale6 covale both ? A LEU 93 C ? ? ? 1_555 A MSE 94 N ? ? A LEU 93 A MSE 94 1_555 ? ? ? ? ? ? ? 1.328 ? covale7 covale both ? A MSE 94 C ? ? ? 1_555 A TRP 95 N ? ? A MSE 94 A TRP 95 1_555 ? ? ? ? ? ? ? 1.330 ? covale8 covale both ? A LEU 123 C ? ? ? 1_555 A MSE 124 N ? ? A LEU 123 A MSE 124 1_555 ? ? ? ? ? ? ? 1.328 ? covale9 covale both ? A MSE 124 C ? ? ? 1_555 A LEU 125 N ? ? A MSE 124 A LEU 125 1_555 ? ? ? ? ? ? ? 1.329 ? covale10 covale both ? A LYS 153 C ? ? ? 1_555 A MSE 154 N ? ? A LYS 153 A MSE 154 1_555 ? ? ? ? ? ? ? 1.329 ? covale11 covale both ? A MSE 154 C ? ? ? 1_555 A GLN 155 N ? ? A MSE 154 A GLN 155 1_555 ? ? ? ? ? ? ? 1.328 ? covale12 covale both ? A LEU 162 C ? ? ? 1_555 A MSE 163 N ? ? A LEU 162 A MSE 163 1_555 ? ? ? ? ? ? ? 1.329 ? covale13 covale both ? A MSE 163 C ? ? ? 1_555 A ALA 164 N ? ? A MSE 163 A ALA 164 1_555 ? ? ? ? ? ? ? 1.328 ? covale14 covale both ? A LEU 165 C ? ? ? 1_555 A MSE 166 N ? ? A LEU 165 A MSE 166 1_555 ? ? ? ? ? ? ? 1.331 ? covale15 covale both ? A MSE 166 C ? ? ? 1_555 A ARG 167 N ? ? A MSE 166 A ARG 167 1_555 ? ? ? ? ? ? ? 1.328 ? covale16 covale both ? A VAL 173 C ? ? ? 1_555 A MSE 174 N ? ? A VAL 173 A MSE 174 1_555 ? ? ? ? ? ? ? 1.329 ? covale17 covale both ? A MSE 174 C ? ? ? 1_555 A THR 175 N ? ? A MSE 174 A THR 175 1_555 ? ? ? ? ? ? ? 1.330 ? covale18 covale both ? A GLU 177 C ? ? ? 1_555 A MSE 178 N ? ? A GLU 177 A MSE 178 1_555 ? ? ? ? ? ? ? 1.326 ? covale19 covale both ? A MSE 178 C ? ? ? 1_555 A ASN 179 N ? ? A MSE 178 A ASN 179 1_555 ? ? ? ? ? ? ? 1.330 ? covale20 covale both ? A ALA 201 C ? ? ? 1_555 A MSE 202 N ? ? A ALA 201 A MSE 202 1_555 ? ? ? ? ? ? ? 1.330 ? covale21 covale both ? A MSE 202 C ? ? ? 1_555 A ILE 203 N ? ? A MSE 202 A ILE 203 1_555 ? ? ? ? ? ? ? 1.327 ? covale22 covale both ? A ASN 217 C ? ? ? 1_555 A MSE 218 N ? ? A ASN 217 A MSE 218 1_555 ? ? ? ? ? ? ? 1.330 ? covale23 covale both ? A MSE 218 C ? ? ? 1_555 A GLN 219 N ? ? A MSE 218 A GLN 219 1_555 ? ? ? ? ? ? ? 1.327 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id VAL _struct_mon_prot_cis.label_seq_id 50 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id VAL _struct_mon_prot_cis.auth_seq_id 50 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 PRO _struct_mon_prot_cis.pdbx_label_seq_id_2 51 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 PRO _struct_mon_prot_cis.pdbx_auth_seq_id_2 51 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 0.03 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 5 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 VAL A 57 ? TYR A 60 ? VAL A 57 TYR A 60 AA1 2 LEU A 44 ? ARG A 47 ? LEU A 44 ARG A 47 AA1 3 LEU A 130 ? ARG A 137 ? LEU A 130 ARG A 137 AA1 4 ARG A 117 ? MSE A 124 ? ARG A 117 MSE A 124 AA1 5 HIS A 92 ? MSE A 94 ? HIS A 92 MSE A 94 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ALA A 58 ? O ALA A 58 N VAL A 46 ? N VAL A 46 AA1 2 3 N CYS A 45 ? N CYS A 45 O PHE A 132 ? O PHE A 132 AA1 3 4 O GLY A 131 ? O GLY A 131 N LEU A 123 ? N LEU A 123 AA1 4 5 O THR A 120 ? O THR A 120 N LEU A 93 ? N LEU A 93 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A SO4 301 ? 4 'binding site for residue SO4 A 301' AC2 Software A SO4 302 ? 4 'binding site for residue SO4 A 302' AC3 Software A 480 303 ? 13 'binding site for residue 480 A 303' AC4 Software A GOL 304 ? 7 'binding site for residue GOL A 304' AC5 Software A GOL 305 ? 6 'binding site for residue GOL A 305' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 ARG A 111 ? ARG A 111 . ? 1_555 ? 2 AC1 4 ARG A 116 ? ARG A 116 . ? 1_555 ? 3 AC1 4 ARG A 117 ? ARG A 117 . ? 1_555 ? 4 AC1 4 ALA A 140 ? ALA A 140 . ? 1_555 ? 5 AC2 4 LYS A 216 ? LYS A 216 . ? 1_555 ? 6 AC2 4 GLN A 219 ? GLN A 219 . ? 1_555 ? 7 AC2 4 ASN A 226 ? ASN A 226 . ? 1_555 ? 8 AC2 4 LYS A 227 ? LYS A 227 . ? 1_555 ? 9 AC3 13 SER A 43 ? SER A 43 . ? 1_555 ? 10 AC3 13 CYS A 45 ? CYS A 45 . ? 1_555 ? 11 AC3 13 PHE A 59 ? PHE A 59 . ? 1_555 ? 12 AC3 13 TYR A 63 ? TYR A 63 . ? 1_555 ? 13 AC3 13 TYR A 71 ? TYR A 71 . ? 1_555 ? 14 AC3 13 ASP A 80 ? ASP A 80 . ? 1_555 ? 15 AC3 13 VAL A 82 ? VAL A 82 . ? 1_555 ? 16 AC3 13 TRP A 95 ? TRP A 95 . ? 1_555 ? 17 AC3 13 SER A 134 ? SER A 134 . ? 1_555 ? 18 AC3 13 GOL E . ? GOL A 304 . ? 1_555 ? 19 AC3 13 GOL F . ? GOL A 305 . ? 1_555 ? 20 AC3 13 HOH G . ? HOH A 402 . ? 1_555 ? 21 AC3 13 HOH G . ? HOH A 405 . ? 1_555 ? 22 AC4 7 TRP A 95 ? TRP A 95 . ? 1_555 ? 23 AC4 7 TRP A 107 ? TRP A 107 . ? 1_555 ? 24 AC4 7 ALA A 110 ? ALA A 110 . ? 1_555 ? 25 AC4 7 ARG A 111 ? ARG A 111 . ? 1_555 ? 26 AC4 7 LEU A 115 ? LEU A 115 . ? 1_555 ? 27 AC4 7 ARG A 116 ? ARG A 116 . ? 1_555 ? 28 AC4 7 480 D . ? 480 A 303 . ? 1_555 ? 29 AC5 6 VAL A 57 ? VAL A 57 . ? 1_555 ? 30 AC5 6 TYR A 71 ? TYR A 71 . ? 1_555 ? 31 AC5 6 GLN A 72 ? GLN A 72 . ? 1_555 ? 32 AC5 6 LEU A 77 ? LEU A 77 . ? 1_555 ? 33 AC5 6 480 D . ? 480 A 303 . ? 1_555 ? 34 AC5 6 HOH G . ? HOH A 404 . ? 1_555 ? # _atom_sites.entry_id 4Y13 _atom_sites.fract_transf_matrix[1][1] 0.007701 _atom_sites.fract_transf_matrix[1][2] 0.004446 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.008892 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007957 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 GLN 2 2 2 GLN GLN A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 THR 4 4 4 THR THR A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 PHE 6 6 6 PHE PHE A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 SER 8 8 8 SER SER A . n A 1 9 TRP 9 9 9 TRP TRP A . n A 1 10 ARG 10 10 10 ARG ARG A . n A 1 11 ARG 11 11 11 ARG ARG A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 MSE 13 13 13 MSE MSE A . n A 1 14 LEU 14 14 14 LEU LEU A . n A 1 15 LEU 15 15 15 LEU LEU A . n A 1 16 ARG 16 16 16 ARG ARG A . n A 1 17 PHE 17 17 17 PHE PHE A . n A 1 18 GLN 18 18 18 GLN GLN A . n A 1 19 ARG 19 19 19 ARG ARG A . n A 1 20 MSE 20 20 20 MSE MSE A . n A 1 21 GLU 21 21 21 GLU GLU A . n A 1 22 THR 22 22 22 THR THR A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 GLU 24 24 24 GLU GLU A . n A 1 25 GLU 25 25 25 GLU GLU A . n A 1 26 VAL 26 26 26 VAL VAL A . n A 1 27 TYR 27 27 27 TYR TYR A . n A 1 28 HIS 28 28 28 HIS HIS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 ILE 30 30 30 ILE ILE A . n A 1 31 GLU 31 31 31 GLU GLU A . n A 1 32 LEU 32 32 32 LEU LEU A . n A 1 33 GLN 33 33 33 GLN GLN A . n A 1 34 ALA 34 34 34 ALA ALA A . n A 1 35 GLN 35 35 35 GLN GLN A . n A 1 36 GLN 36 36 36 GLN GLN A . n A 1 37 LEU 37 37 37 LEU LEU A . n A 1 38 GLU 38 38 38 GLU GLU A . n A 1 39 TYR 39 39 39 TYR TYR A . n A 1 40 ASP 40 40 40 ASP ASP A . n A 1 41 TYR 41 41 41 TYR TYR A . n A 1 42 TYR 42 42 42 TYR TYR A . n A 1 43 SER 43 43 43 SER SER A . n A 1 44 LEU 44 44 44 LEU LEU A . n A 1 45 CYS 45 45 45 CYS CYS A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 ARG 47 47 47 ARG ARG A . n A 1 48 HIS 48 48 48 HIS HIS A . n A 1 49 PRO 49 49 49 PRO PRO A . n A 1 50 VAL 50 50 50 VAL VAL A . n A 1 51 PRO 51 51 51 PRO PRO A . n A 1 52 PHE 52 52 52 PHE PHE A . n A 1 53 THR 53 53 53 THR THR A . n A 1 54 ARG 54 54 54 ARG ARG A . n A 1 55 PRO 55 55 55 PRO PRO A . n A 1 56 LYS 56 56 56 LYS LYS A . n A 1 57 VAL 57 57 57 VAL VAL A . n A 1 58 ALA 58 58 58 ALA ALA A . n A 1 59 PHE 59 59 59 PHE PHE A . n A 1 60 TYR 60 60 60 TYR TYR A . n A 1 61 THR 61 61 61 THR THR A . n A 1 62 ASN 62 62 62 ASN ASN A . n A 1 63 TYR 63 63 63 TYR TYR A . n A 1 64 PRO 64 64 64 PRO PRO A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 ALA 66 66 66 ALA ALA A . n A 1 67 TRP 67 67 67 TRP TRP A . n A 1 68 VAL 68 68 68 VAL VAL A . n A 1 69 SER 69 69 69 SER SER A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 TYR 71 71 71 TYR TYR A . n A 1 72 GLN 72 72 72 GLN GLN A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 ASN 75 75 75 ASN ASN A . n A 1 76 PHE 76 76 76 PHE PHE A . n A 1 77 LEU 77 77 77 LEU LEU A . n A 1 78 ALA 78 78 78 ALA ALA A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 ASP 80 80 80 ASP ASP A . n A 1 81 PRO 81 81 81 PRO PRO A . n A 1 82 VAL 82 82 82 VAL VAL A . n A 1 83 LEU 83 83 83 LEU LEU A . n A 1 84 ASN 84 84 84 ASN ASN A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 GLU 86 86 86 GLU GLU A . n A 1 87 ASN 87 87 87 ASN ASN A . n A 1 88 PHE 88 88 88 PHE PHE A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 GLN 90 90 90 GLN GLN A . n A 1 91 GLY 91 91 91 GLY GLY A . n A 1 92 HIS 92 92 92 HIS HIS A . n A 1 93 LEU 93 93 93 LEU LEU A . n A 1 94 MSE 94 94 94 MSE MSE A . n A 1 95 TRP 95 95 95 TRP TRP A . n A 1 96 ASN 96 96 96 ASN ASN A . n A 1 97 ASP 97 97 97 ASP ASP A . n A 1 98 ASP 98 98 98 ASP ASP A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 PHE 100 100 100 PHE PHE A . n A 1 101 ASN 101 101 101 ASN ASN A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 ALA 103 103 103 ALA ALA A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 PRO 105 105 105 PRO PRO A . n A 1 106 LEU 106 106 106 LEU LEU A . n A 1 107 TRP 107 107 107 TRP TRP A . n A 1 108 GLU 108 108 108 GLU GLU A . n A 1 109 ALA 109 109 109 ALA ALA A . n A 1 110 ALA 110 110 110 ALA ALA A . n A 1 111 ARG 111 111 111 ARG ARG A . n A 1 112 ALA 112 112 112 ALA ALA A . n A 1 113 HIS 113 113 113 HIS HIS A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 ARG 117 117 117 ARG ARG A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 THR 120 120 120 THR THR A . n A 1 121 GLN 121 121 121 GLN GLN A . n A 1 122 TYR 122 122 122 TYR TYR A . n A 1 123 LEU 123 123 123 LEU LEU A . n A 1 124 MSE 124 124 124 MSE MSE A . n A 1 125 LEU 125 125 125 LEU LEU A . n A 1 126 PRO 126 126 126 PRO PRO A . n A 1 127 ASN 127 127 127 ASN ASN A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 LEU 130 130 130 LEU LEU A . n A 1 131 GLY 131 131 131 GLY GLY A . n A 1 132 PHE 132 132 132 PHE PHE A . n A 1 133 LEU 133 133 133 LEU LEU A . n A 1 134 SER 134 134 134 SER SER A . n A 1 135 PHE 135 135 135 PHE PHE A . n A 1 136 SER 136 136 136 SER SER A . n A 1 137 ARG 137 137 137 ARG ARG A . n A 1 138 CYS 138 138 138 CYS CYS A . n A 1 139 SER 139 139 139 SER SER A . n A 1 140 ALA 140 140 140 ALA ALA A . n A 1 141 ARG 141 141 141 ARG ARG A . n A 1 142 GLU 142 142 142 GLU GLU A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 PRO 144 144 144 PRO PRO A . n A 1 145 ILE 145 145 145 ILE ILE A . n A 1 146 LEU 146 146 146 LEU LEU A . n A 1 147 SER 147 147 147 SER SER A . n A 1 148 ASP 148 148 148 ASP ASP A . n A 1 149 GLU 149 149 149 GLU GLU A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 GLN 151 151 151 GLN GLN A . n A 1 152 LEU 152 152 152 LEU LEU A . n A 1 153 LYS 153 153 153 LYS LYS A . n A 1 154 MSE 154 154 154 MSE MSE A . n A 1 155 GLN 155 155 155 GLN GLN A . n A 1 156 LEU 156 156 156 LEU LEU A . n A 1 157 LEU 157 157 157 LEU LEU A . n A 1 158 VAL 158 158 158 VAL VAL A . n A 1 159 ARG 159 159 159 ARG ARG A . n A 1 160 GLU 160 160 160 GLU GLU A . n A 1 161 SER 161 161 161 SER SER A . n A 1 162 LEU 162 162 162 LEU LEU A . n A 1 163 MSE 163 163 163 MSE MSE A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 LEU 165 165 165 LEU LEU A . n A 1 166 MSE 166 166 166 MSE MSE A . n A 1 167 ARG 167 167 167 ARG ARG A . n A 1 168 LEU 168 168 168 LEU LEU A . n A 1 169 ASN 169 169 169 ASN ASN A . n A 1 170 ASP 170 170 170 ASP ASP A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 ILE 172 172 172 ILE ILE A . n A 1 173 VAL 173 173 173 VAL VAL A . n A 1 174 MSE 174 174 174 MSE MSE A . n A 1 175 THR 175 175 175 THR THR A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 GLU 177 177 177 GLU GLU A . n A 1 178 MSE 178 178 178 MSE MSE A . n A 1 179 ASN 179 179 179 ASN ASN A . n A 1 180 PHE 180 180 180 PHE PHE A . n A 1 181 SER 181 181 181 SER SER A . n A 1 182 LYS 182 182 182 LYS LYS A . n A 1 183 ARG 183 183 183 ARG ARG A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 LYS 185 185 185 LYS LYS A . n A 1 186 GLU 186 186 186 GLU GLU A . n A 1 187 ILE 187 187 187 ILE ILE A . n A 1 188 LEU 188 188 188 LEU LEU A . n A 1 189 ARG 189 189 189 ARG ARG A . n A 1 190 TRP 190 190 190 TRP TRP A . n A 1 191 THR 191 191 191 THR THR A . n A 1 192 ALA 192 192 192 ALA ALA A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 GLY 194 194 194 GLY GLY A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 THR 196 196 196 THR THR A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 GLU 199 199 199 GLU GLU A . n A 1 200 ILE 200 200 200 ILE ILE A . n A 1 201 ALA 201 201 201 ALA ALA A . n A 1 202 MSE 202 202 202 MSE MSE A . n A 1 203 ILE 203 203 203 ILE ILE A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 ILE 206 206 206 ILE ILE A . n A 1 207 SER 207 207 207 SER SER A . n A 1 208 GLU 208 208 208 GLU GLU A . n A 1 209 ASN 209 209 209 ASN ASN A . n A 1 210 THR 210 210 210 THR THR A . n A 1 211 VAL 211 211 211 VAL VAL A . n A 1 212 ASN 212 212 212 ASN ASN A . n A 1 213 PHE 213 213 213 PHE PHE A . n A 1 214 HIS 214 214 214 HIS HIS A . n A 1 215 GLN 215 215 215 GLN GLN A . n A 1 216 LYS 216 216 216 LYS LYS A . n A 1 217 ASN 217 217 217 ASN ASN A . n A 1 218 MSE 218 218 218 MSE MSE A . n A 1 219 GLN 219 219 219 GLN GLN A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 LYS 221 221 221 LYS LYS A . n A 1 222 ILE 222 222 222 ILE ILE A . n A 1 223 ASN 223 223 223 ASN ASN A . n A 1 224 ALA 224 224 224 ALA ALA A . n A 1 225 PRO 225 225 225 PRO PRO A . n A 1 226 ASN 226 226 226 ASN ASN A . n A 1 227 LYS 227 227 227 LYS LYS A . n A 1 228 THR 228 228 228 THR THR A . n A 1 229 GLN 229 229 229 GLN GLN A . n A 1 230 VAL 230 230 230 VAL VAL A . n A 1 231 ALA 231 231 231 ALA ALA A . n A 1 232 CYS 232 232 232 CYS CYS A . n A 1 233 TYR 233 233 233 TYR TYR A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 ALA 235 235 235 ALA ALA A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 THR 237 237 237 THR THR A . n A 1 238 GLY 238 238 238 GLY GLY A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 ILE 240 240 240 ILE ILE A . n A 1 241 HIS 241 241 241 HIS HIS A . n A 1 242 HIS 242 242 242 HIS HIS A . n A 1 243 HIS 243 243 243 HIS HIS A . n A 1 244 HIS 244 244 244 HIS HIS A . n A 1 245 HIS 245 245 ? ? ? A . n A 1 246 HIS 246 246 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 SO4 1 301 301 SO4 SO4 A . C 2 SO4 1 302 302 SO4 SO4 A . D 3 480 1 303 501 480 OLC A . E 4 GOL 1 304 601 GOL GOL A . F 4 GOL 1 305 602 GOL GOL A . G 5 HOH 1 401 401 HOH HOH A . G 5 HOH 2 402 402 HOH HOH A . G 5 HOH 3 403 403 HOH HOH A . G 5 HOH 4 404 404 HOH HOH A . G 5 HOH 5 405 405 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET 'modified residue' 2 A MSE 13 A MSE 13 ? MET 'modified residue' 3 A MSE 20 A MSE 20 ? MET 'modified residue' 4 A MSE 94 A MSE 94 ? MET 'modified residue' 5 A MSE 124 A MSE 124 ? MET 'modified residue' 6 A MSE 154 A MSE 154 ? MET 'modified residue' 7 A MSE 163 A MSE 163 ? MET 'modified residue' 8 A MSE 166 A MSE 166 ? MET 'modified residue' 9 A MSE 174 A MSE 174 ? MET 'modified residue' 10 A MSE 178 A MSE 178 ? MET 'modified residue' 11 A MSE 202 A MSE 202 ? MET 'modified residue' 12 A MSE 218 A MSE 218 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E,F,G # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 6770 ? 1 MORE -81 ? 1 'SSA (A^2)' 22460 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 12_565 x,x-y+1,-z+5/6 0.5000000000 0.8660254038 0.0000000000 -64.9285000000 0.8660254038 -0.5000000000 0.0000000000 112.4594608592 0.0000000000 0.0000000000 -1.0000000000 104.7333333333 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-04-08 2 'Structure model' 1 1 2015-04-15 3 'Structure model' 1 2 2019-12-04 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Author supporting evidence' 3 3 'Structure model' 'Data collection' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Source and taxonomy' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' entity_src_gen 2 3 'Structure model' pdbx_audit_support 3 3 'Structure model' pdbx_prerelease_seq 4 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_entity_src_gen.pdbx_alt_source_flag' 2 3 'Structure model' '_pdbx_audit_support.funding_organization' 3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.8.4_1496)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASP A 3 ? ? -167.16 111.62 2 1 ASP A 5 ? ? -132.06 -33.76 3 1 GLU A 21 ? ? -149.88 -27.01 4 1 TYR A 42 ? ? -118.60 -167.91 5 1 SER A 43 ? ? -177.52 139.70 6 1 ASN A 75 ? ? 37.55 68.48 7 1 ARG A 128 ? ? 59.58 19.13 8 1 HIS A 242 ? ? 61.58 -145.97 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A MSE 1 ? CG ? A MSE 1 CG 2 1 Y 1 A MSE 1 ? SE ? A MSE 1 SE 3 1 Y 1 A MSE 1 ? CE ? A MSE 1 CE 4 1 Y 1 A GLN 2 ? CG ? A GLN 2 CG 5 1 Y 1 A GLN 2 ? CD ? A GLN 2 CD 6 1 Y 1 A GLN 2 ? OE1 ? A GLN 2 OE1 7 1 Y 1 A GLN 2 ? NE2 ? A GLN 2 NE2 8 1 Y 1 A ASP 3 ? CG ? A ASP 3 CG 9 1 Y 1 A ASP 3 ? OD1 ? A ASP 3 OD1 10 1 Y 1 A ASP 3 ? OD2 ? A ASP 3 OD2 11 1 Y 1 A HIS 244 ? CG ? A HIS 244 CG 12 1 Y 1 A HIS 244 ? ND1 ? A HIS 244 ND1 13 1 Y 1 A HIS 244 ? CD2 ? A HIS 244 CD2 14 1 Y 1 A HIS 244 ? CE1 ? A HIS 244 CE1 15 1 Y 1 A HIS 244 ? NE2 ? A HIS 244 NE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A HIS 245 ? A HIS 245 2 1 Y 1 A HIS 246 ? A HIS 246 # _pdbx_audit_support.funding_organization 'National Institutes of Health/National Institute Of Allergy and Infectious Diseases (NIH/NIAID)' _pdbx_audit_support.country 'United States' _pdbx_audit_support.grant_number ? _pdbx_audit_support.ordinal 1 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'SULFATE ION' SO4 3 '(2S)-2,3-dihydroxypropyl octanoate' 480 4 GLYCEROL GOL 5 water HOH #