data_4Y98 # _entry.id 4Y98 # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4Y98 pdb_00004y98 10.2210/pdb4y98/pdb WWPDB D_1000207067 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-03-09 2 'Structure model' 1 1 2016-03-16 3 'Structure model' 1 2 2016-06-01 4 'Structure model' 1 3 2024-02-28 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Source and taxonomy' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' 4 4 'Structure model' 'Database references' 5 4 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' chem_comp_atom 2 4 'Structure model' chem_comp_bond 3 4 'Structure model' citation 4 4 'Structure model' database_2 5 4 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_citation.journal_id_CSD' 2 4 'Structure model' '_database_2.pdbx_DOI' 3 4 'Structure model' '_database_2.pdbx_database_accession' 4 4 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4Y98 _pdbx_database_status.recvd_initial_deposition_date 2015-02-17 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 4Y9D _pdbx_database_related.db_name PDB _pdbx_database_related.details . # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Pereira, J.H.' 1 'McAndrew, R.P.' 2 'Heins, R.A.' 3 'Sale, K.L.' 4 'Simmons, B.A.' 5 'Adams, P.D.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Biol.Chem. _citation.journal_id_ASTM JBCHA3 _citation.journal_id_CSD 0071 _citation.journal_id_ISSN 1083-351X _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 291 _citation.language ? _citation.page_first 10228 _citation.page_last 10238 _citation.title ;Structural and Biochemical Characterization of the Early and Late Enzymes in the Lignin beta-Aryl Ether Cleavage Pathway from Sphingobium sp. SYK-6. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1074/jbc.M115.700427 _citation.pdbx_database_id_PubMed 26940872 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Pereira, J.H.' 1 ? primary 'Heins, R.A.' 2 ? primary 'Gall, D.L.' 3 ? primary 'McAndrew, R.P.' 4 ? primary 'Deng, K.' 5 ? primary 'Holland, K.C.' 6 ? primary 'Donohue, T.J.' 7 ? primary 'Noguera, D.R.' 8 ? primary 'Simmons, B.A.' 9 ? primary 'Sale, K.L.' 10 ? primary 'Ralph, J.' 11 ? primary 'Adams, P.D.' 12 ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'C alpha-dehydrogenase' _entity.formula_weight 32378.562 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKDFQDQVAFITGGASGAGFGQAKVFGQAGAKIVVADVRAEAVEKAVAELEGLGITAHGIVLDIMDREAYARAADEVEAV FGQAPTLLSNTAGVNSFGPIEKTTYDDFDWIIGVNLNGVINGMVTFVPRMIASGRPGHIVTVSSLGGFMGSALAGPYSAA KAASINLMEGYRQGLEKYGIGVSVCTPANIKSNIAEASRLRPAKYGTSGYVENEESIASLHSIHQHGLEPEKLAEAIKKG VEDNALYIIPYPEVREGLEKHFQAIIDSVAPMESDPEGARQRVEALMAWGRDRTRVFAEGDKKGA ; _entity_poly.pdbx_seq_one_letter_code_can ;MKDFQDQVAFITGGASGAGFGQAKVFGQAGAKIVVADVRAEAVEKAVAELEGLGITAHGIVLDIMDREAYARAADEVEAV FGQAPTLLSNTAGVNSFGPIEKTTYDDFDWIIGVNLNGVINGMVTFVPRMIASGRPGHIVTVSSLGGFMGSALAGPYSAA KAASINLMEGYRQGLEKYGIGVSVCTPANIKSNIAEASRLRPAKYGTSGYVENEESIASLHSIHQHGLEPEKLAEAIKKG VEDNALYIIPYPEVREGLEKHFQAIIDSVAPMESDPEGARQRVEALMAWGRDRTRVFAEGDKKGA ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 ASP n 1 4 PHE n 1 5 GLN n 1 6 ASP n 1 7 GLN n 1 8 VAL n 1 9 ALA n 1 10 PHE n 1 11 ILE n 1 12 THR n 1 13 GLY n 1 14 GLY n 1 15 ALA n 1 16 SER n 1 17 GLY n 1 18 ALA n 1 19 GLY n 1 20 PHE n 1 21 GLY n 1 22 GLN n 1 23 ALA n 1 24 LYS n 1 25 VAL n 1 26 PHE n 1 27 GLY n 1 28 GLN n 1 29 ALA n 1 30 GLY n 1 31 ALA n 1 32 LYS n 1 33 ILE n 1 34 VAL n 1 35 VAL n 1 36 ALA n 1 37 ASP n 1 38 VAL n 1 39 ARG n 1 40 ALA n 1 41 GLU n 1 42 ALA n 1 43 VAL n 1 44 GLU n 1 45 LYS n 1 46 ALA n 1 47 VAL n 1 48 ALA n 1 49 GLU n 1 50 LEU n 1 51 GLU n 1 52 GLY n 1 53 LEU n 1 54 GLY n 1 55 ILE n 1 56 THR n 1 57 ALA n 1 58 HIS n 1 59 GLY n 1 60 ILE n 1 61 VAL n 1 62 LEU n 1 63 ASP n 1 64 ILE n 1 65 MET n 1 66 ASP n 1 67 ARG n 1 68 GLU n 1 69 ALA n 1 70 TYR n 1 71 ALA n 1 72 ARG n 1 73 ALA n 1 74 ALA n 1 75 ASP n 1 76 GLU n 1 77 VAL n 1 78 GLU n 1 79 ALA n 1 80 VAL n 1 81 PHE n 1 82 GLY n 1 83 GLN n 1 84 ALA n 1 85 PRO n 1 86 THR n 1 87 LEU n 1 88 LEU n 1 89 SER n 1 90 ASN n 1 91 THR n 1 92 ALA n 1 93 GLY n 1 94 VAL n 1 95 ASN n 1 96 SER n 1 97 PHE n 1 98 GLY n 1 99 PRO n 1 100 ILE n 1 101 GLU n 1 102 LYS n 1 103 THR n 1 104 THR n 1 105 TYR n 1 106 ASP n 1 107 ASP n 1 108 PHE n 1 109 ASP n 1 110 TRP n 1 111 ILE n 1 112 ILE n 1 113 GLY n 1 114 VAL n 1 115 ASN n 1 116 LEU n 1 117 ASN n 1 118 GLY n 1 119 VAL n 1 120 ILE n 1 121 ASN n 1 122 GLY n 1 123 MET n 1 124 VAL n 1 125 THR n 1 126 PHE n 1 127 VAL n 1 128 PRO n 1 129 ARG n 1 130 MET n 1 131 ILE n 1 132 ALA n 1 133 SER n 1 134 GLY n 1 135 ARG n 1 136 PRO n 1 137 GLY n 1 138 HIS n 1 139 ILE n 1 140 VAL n 1 141 THR n 1 142 VAL n 1 143 SER n 1 144 SER n 1 145 LEU n 1 146 GLY n 1 147 GLY n 1 148 PHE n 1 149 MET n 1 150 GLY n 1 151 SER n 1 152 ALA n 1 153 LEU n 1 154 ALA n 1 155 GLY n 1 156 PRO n 1 157 TYR n 1 158 SER n 1 159 ALA n 1 160 ALA n 1 161 LYS n 1 162 ALA n 1 163 ALA n 1 164 SER n 1 165 ILE n 1 166 ASN n 1 167 LEU n 1 168 MET n 1 169 GLU n 1 170 GLY n 1 171 TYR n 1 172 ARG n 1 173 GLN n 1 174 GLY n 1 175 LEU n 1 176 GLU n 1 177 LYS n 1 178 TYR n 1 179 GLY n 1 180 ILE n 1 181 GLY n 1 182 VAL n 1 183 SER n 1 184 VAL n 1 185 CYS n 1 186 THR n 1 187 PRO n 1 188 ALA n 1 189 ASN n 1 190 ILE n 1 191 LYS n 1 192 SER n 1 193 ASN n 1 194 ILE n 1 195 ALA n 1 196 GLU n 1 197 ALA n 1 198 SER n 1 199 ARG n 1 200 LEU n 1 201 ARG n 1 202 PRO n 1 203 ALA n 1 204 LYS n 1 205 TYR n 1 206 GLY n 1 207 THR n 1 208 SER n 1 209 GLY n 1 210 TYR n 1 211 VAL n 1 212 GLU n 1 213 ASN n 1 214 GLU n 1 215 GLU n 1 216 SER n 1 217 ILE n 1 218 ALA n 1 219 SER n 1 220 LEU n 1 221 HIS n 1 222 SER n 1 223 ILE n 1 224 HIS n 1 225 GLN n 1 226 HIS n 1 227 GLY n 1 228 LEU n 1 229 GLU n 1 230 PRO n 1 231 GLU n 1 232 LYS n 1 233 LEU n 1 234 ALA n 1 235 GLU n 1 236 ALA n 1 237 ILE n 1 238 LYS n 1 239 LYS n 1 240 GLY n 1 241 VAL n 1 242 GLU n 1 243 ASP n 1 244 ASN n 1 245 ALA n 1 246 LEU n 1 247 TYR n 1 248 ILE n 1 249 ILE n 1 250 PRO n 1 251 TYR n 1 252 PRO n 1 253 GLU n 1 254 VAL n 1 255 ARG n 1 256 GLU n 1 257 GLY n 1 258 LEU n 1 259 GLU n 1 260 LYS n 1 261 HIS n 1 262 PHE n 1 263 GLN n 1 264 ALA n 1 265 ILE n 1 266 ILE n 1 267 ASP n 1 268 SER n 1 269 VAL n 1 270 ALA n 1 271 PRO n 1 272 MET n 1 273 GLU n 1 274 SER n 1 275 ASP n 1 276 PRO n 1 277 GLU n 1 278 GLY n 1 279 ALA n 1 280 ARG n 1 281 GLN n 1 282 ARG n 1 283 VAL n 1 284 GLU n 1 285 ALA n 1 286 LEU n 1 287 MET n 1 288 ALA n 1 289 TRP n 1 290 GLY n 1 291 ARG n 1 292 ASP n 1 293 ARG n 1 294 THR n 1 295 ARG n 1 296 VAL n 1 297 PHE n 1 298 ALA n 1 299 GLU n 1 300 GLY n 1 301 ASP n 1 302 LYS n 1 303 LYS n 1 304 GLY n 1 305 ALA n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 305 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ligD _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Sphingobium sp. SYK-6' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 627192 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 1 ? ? ? A . n A 1 2 LYS 2 2 ? ? ? A . n A 1 3 ASP 3 3 3 ASP ASP A . n A 1 4 PHE 4 4 4 PHE PHE A . n A 1 5 GLN 5 5 5 GLN GLN A . n A 1 6 ASP 6 6 6 ASP ASP A . n A 1 7 GLN 7 7 7 GLN GLN A . n A 1 8 VAL 8 8 8 VAL VAL A . n A 1 9 ALA 9 9 9 ALA ALA A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 ILE 11 11 11 ILE ILE A . n A 1 12 THR 12 12 12 THR THR A . n A 1 13 GLY 13 13 13 GLY GLY A . n A 1 14 GLY 14 14 14 GLY GLY A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 SER 16 16 16 SER SER A . n A 1 17 GLY 17 17 17 GLY GLY A . n A 1 18 ALA 18 18 18 ALA ALA A . n A 1 19 GLY 19 19 19 GLY GLY A . n A 1 20 PHE 20 20 20 PHE PHE A . n A 1 21 GLY 21 21 21 GLY GLY A . n A 1 22 GLN 22 22 22 GLN GLN A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 LYS 24 24 24 LYS LYS A . n A 1 25 VAL 25 25 25 VAL VAL A . n A 1 26 PHE 26 26 26 PHE PHE A . n A 1 27 GLY 27 27 27 GLY GLY A . n A 1 28 GLN 28 28 28 GLN GLN A . n A 1 29 ALA 29 29 29 ALA ALA A . n A 1 30 GLY 30 30 30 GLY GLY A . n A 1 31 ALA 31 31 31 ALA ALA A . n A 1 32 LYS 32 32 32 LYS LYS A . n A 1 33 ILE 33 33 33 ILE ILE A . n A 1 34 VAL 34 34 34 VAL VAL A . n A 1 35 VAL 35 35 35 VAL VAL A . n A 1 36 ALA 36 36 36 ALA ALA A . n A 1 37 ASP 37 37 37 ASP ASP A . n A 1 38 VAL 38 38 38 VAL VAL A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 GLU 41 41 41 GLU GLU A . n A 1 42 ALA 42 42 42 ALA ALA A . n A 1 43 VAL 43 43 43 VAL VAL A . n A 1 44 GLU 44 44 44 GLU GLU A . n A 1 45 LYS 45 45 45 LYS LYS A . n A 1 46 ALA 46 46 46 ALA ALA A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 ALA 48 48 48 ALA ALA A . n A 1 49 GLU 49 49 49 GLU GLU A . n A 1 50 LEU 50 50 50 LEU LEU A . n A 1 51 GLU 51 51 51 GLU GLU A . n A 1 52 GLY 52 52 52 GLY GLY A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 GLY 54 54 54 GLY GLY A . n A 1 55 ILE 55 55 55 ILE ILE A . n A 1 56 THR 56 56 56 THR THR A . n A 1 57 ALA 57 57 57 ALA ALA A . n A 1 58 HIS 58 58 58 HIS HIS A . n A 1 59 GLY 59 59 59 GLY GLY A . n A 1 60 ILE 60 60 60 ILE ILE A . n A 1 61 VAL 61 61 61 VAL VAL A . n A 1 62 LEU 62 62 62 LEU LEU A . n A 1 63 ASP 63 63 63 ASP ASP A . n A 1 64 ILE 64 64 64 ILE ILE A . n A 1 65 MET 65 65 65 MET MET A . n A 1 66 ASP 66 66 66 ASP ASP A . n A 1 67 ARG 67 67 67 ARG ARG A . n A 1 68 GLU 68 68 68 GLU GLU A . n A 1 69 ALA 69 69 69 ALA ALA A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 ALA 71 71 71 ALA ALA A . n A 1 72 ARG 72 72 72 ARG ARG A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 ALA 74 74 74 ALA ALA A . n A 1 75 ASP 75 75 75 ASP ASP A . n A 1 76 GLU 76 76 76 GLU GLU A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 GLU 78 78 78 GLU GLU A . n A 1 79 ALA 79 79 79 ALA ALA A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 PHE 81 81 81 PHE PHE A . n A 1 82 GLY 82 82 82 GLY GLY A . n A 1 83 GLN 83 83 83 GLN GLN A . n A 1 84 ALA 84 84 84 ALA ALA A . n A 1 85 PRO 85 85 85 PRO PRO A . n A 1 86 THR 86 86 86 THR THR A . n A 1 87 LEU 87 87 87 LEU LEU A . n A 1 88 LEU 88 88 88 LEU LEU A . n A 1 89 SER 89 89 89 SER SER A . n A 1 90 ASN 90 90 90 ASN ASN A . n A 1 91 THR 91 91 91 THR THR A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 GLY 93 93 93 GLY GLY A . n A 1 94 VAL 94 94 94 VAL VAL A . n A 1 95 ASN 95 95 95 ASN ASN A . n A 1 96 SER 96 96 96 SER SER A . n A 1 97 PHE 97 97 97 PHE PHE A . n A 1 98 GLY 98 98 98 GLY GLY A . n A 1 99 PRO 99 99 99 PRO PRO A . n A 1 100 ILE 100 100 100 ILE ILE A . n A 1 101 GLU 101 101 101 GLU GLU A . n A 1 102 LYS 102 102 102 LYS LYS A . n A 1 103 THR 103 103 103 THR THR A . n A 1 104 THR 104 104 104 THR THR A . n A 1 105 TYR 105 105 105 TYR TYR A . n A 1 106 ASP 106 106 106 ASP ASP A . n A 1 107 ASP 107 107 107 ASP ASP A . n A 1 108 PHE 108 108 108 PHE PHE A . n A 1 109 ASP 109 109 109 ASP ASP A . n A 1 110 TRP 110 110 110 TRP TRP A . n A 1 111 ILE 111 111 111 ILE ILE A . n A 1 112 ILE 112 112 112 ILE ILE A . n A 1 113 GLY 113 113 113 GLY GLY A . n A 1 114 VAL 114 114 114 VAL VAL A . n A 1 115 ASN 115 115 115 ASN ASN A . n A 1 116 LEU 116 116 116 LEU LEU A . n A 1 117 ASN 117 117 117 ASN ASN A . n A 1 118 GLY 118 118 118 GLY GLY A . n A 1 119 VAL 119 119 119 VAL VAL A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ASN 121 121 121 ASN ASN A . n A 1 122 GLY 122 122 122 GLY GLY A . n A 1 123 MET 123 123 123 MET MET A . n A 1 124 VAL 124 124 124 VAL VAL A . n A 1 125 THR 125 125 125 THR THR A . n A 1 126 PHE 126 126 126 PHE PHE A . n A 1 127 VAL 127 127 127 VAL VAL A . n A 1 128 PRO 128 128 128 PRO PRO A . n A 1 129 ARG 129 129 129 ARG ARG A . n A 1 130 MET 130 130 130 MET MET A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 SER 133 133 133 SER SER A . n A 1 134 GLY 134 134 134 GLY GLY A . n A 1 135 ARG 135 135 135 ARG ARG A . n A 1 136 PRO 136 136 136 PRO PRO A . n A 1 137 GLY 137 137 137 GLY GLY A . n A 1 138 HIS 138 138 138 HIS HIS A . n A 1 139 ILE 139 139 139 ILE ILE A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 THR 141 141 141 THR THR A . n A 1 142 VAL 142 142 142 VAL VAL A . n A 1 143 SER 143 143 143 SER SER A . n A 1 144 SER 144 144 144 SER SER A . n A 1 145 LEU 145 145 145 LEU LEU A . n A 1 146 GLY 146 146 146 GLY GLY A . n A 1 147 GLY 147 147 147 GLY GLY A . n A 1 148 PHE 148 148 148 PHE PHE A . n A 1 149 MET 149 149 149 MET MET A . n A 1 150 GLY 150 150 150 GLY GLY A . n A 1 151 SER 151 151 151 SER SER A . n A 1 152 ALA 152 152 152 ALA ALA A . n A 1 153 LEU 153 153 153 LEU LEU A . n A 1 154 ALA 154 154 154 ALA ALA A . n A 1 155 GLY 155 155 155 GLY GLY A . n A 1 156 PRO 156 156 156 PRO PRO A . n A 1 157 TYR 157 157 157 TYR TYR A . n A 1 158 SER 158 158 158 SER SER A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 LYS 161 161 161 LYS LYS A . n A 1 162 ALA 162 162 162 ALA ALA A . n A 1 163 ALA 163 163 163 ALA ALA A . n A 1 164 SER 164 164 164 SER SER A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 ASN 166 166 166 ASN ASN A . n A 1 167 LEU 167 167 167 LEU LEU A . n A 1 168 MET 168 168 168 MET MET A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 TYR 171 171 171 TYR TYR A . n A 1 172 ARG 172 172 172 ARG ARG A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 GLY 174 174 174 GLY GLY A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 LYS 177 177 177 LYS LYS A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 GLY 179 179 179 GLY GLY A . n A 1 180 ILE 180 180 180 ILE ILE A . n A 1 181 GLY 181 181 181 GLY GLY A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 SER 183 183 183 SER SER A . n A 1 184 VAL 184 184 184 VAL VAL A . n A 1 185 CYS 185 185 185 CYS CYS A . n A 1 186 THR 186 186 186 THR THR A . n A 1 187 PRO 187 187 187 PRO PRO A . n A 1 188 ALA 188 188 188 ALA ALA A . n A 1 189 ASN 189 189 189 ASN ASN A . n A 1 190 ILE 190 190 190 ILE ILE A . n A 1 191 LYS 191 191 ? ? ? A . n A 1 192 SER 192 192 ? ? ? A . n A 1 193 ASN 193 193 ? ? ? A . n A 1 194 ILE 194 194 ? ? ? A . n A 1 195 ALA 195 195 ? ? ? A . n A 1 196 GLU 196 196 ? ? ? A . n A 1 197 ALA 197 197 ? ? ? A . n A 1 198 SER 198 198 ? ? ? A . n A 1 199 ARG 199 199 ? ? ? A . n A 1 200 LEU 200 200 ? ? ? A . n A 1 201 ARG 201 201 ? ? ? A . n A 1 202 PRO 202 202 ? ? ? A . n A 1 203 ALA 203 203 ? ? ? A . n A 1 204 LYS 204 204 ? ? ? A . n A 1 205 TYR 205 205 ? ? ? A . n A 1 206 GLY 206 206 ? ? ? A . n A 1 207 THR 207 207 ? ? ? A . n A 1 208 SER 208 208 ? ? ? A . n A 1 209 GLY 209 209 ? ? ? A . n A 1 210 TYR 210 210 ? ? ? A . n A 1 211 VAL 211 211 ? ? ? A . n A 1 212 GLU 212 212 ? ? ? A . n A 1 213 ASN 213 213 ? ? ? A . n A 1 214 GLU 214 214 ? ? ? A . n A 1 215 GLU 215 215 ? ? ? A . n A 1 216 SER 216 216 ? ? ? A . n A 1 217 ILE 217 217 ? ? ? A . n A 1 218 ALA 218 218 ? ? ? A . n A 1 219 SER 219 219 ? ? ? A . n A 1 220 LEU 220 220 ? ? ? A . n A 1 221 HIS 221 221 ? ? ? A . n A 1 222 SER 222 222 ? ? ? A . n A 1 223 ILE 223 223 ? ? ? A . n A 1 224 HIS 224 224 ? ? ? A . n A 1 225 GLN 225 225 ? ? ? A . n A 1 226 HIS 226 226 226 HIS HIS A . n A 1 227 GLY 227 227 227 GLY GLY A . n A 1 228 LEU 228 228 228 LEU LEU A . n A 1 229 GLU 229 229 229 GLU GLU A . n A 1 230 PRO 230 230 230 PRO PRO A . n A 1 231 GLU 231 231 231 GLU GLU A . n A 1 232 LYS 232 232 232 LYS LYS A . n A 1 233 LEU 233 233 233 LEU LEU A . n A 1 234 ALA 234 234 234 ALA ALA A . n A 1 235 GLU 235 235 235 GLU GLU A . n A 1 236 ALA 236 236 236 ALA ALA A . n A 1 237 ILE 237 237 237 ILE ILE A . n A 1 238 LYS 238 238 238 LYS LYS A . n A 1 239 LYS 239 239 239 LYS LYS A . n A 1 240 GLY 240 240 240 GLY GLY A . n A 1 241 VAL 241 241 241 VAL VAL A . n A 1 242 GLU 242 242 242 GLU GLU A . n A 1 243 ASP 243 243 243 ASP ASP A . n A 1 244 ASN 244 244 244 ASN ASN A . n A 1 245 ALA 245 245 245 ALA ALA A . n A 1 246 LEU 246 246 246 LEU LEU A . n A 1 247 TYR 247 247 247 TYR TYR A . n A 1 248 ILE 248 248 248 ILE ILE A . n A 1 249 ILE 249 249 249 ILE ILE A . n A 1 250 PRO 250 250 250 PRO PRO A . n A 1 251 TYR 251 251 251 TYR TYR A . n A 1 252 PRO 252 252 252 PRO PRO A . n A 1 253 GLU 253 253 253 GLU GLU A . n A 1 254 VAL 254 254 254 VAL VAL A . n A 1 255 ARG 255 255 255 ARG ARG A . n A 1 256 GLU 256 256 256 GLU GLU A . n A 1 257 GLY 257 257 257 GLY GLY A . n A 1 258 LEU 258 258 258 LEU LEU A . n A 1 259 GLU 259 259 259 GLU GLU A . n A 1 260 LYS 260 260 260 LYS LYS A . n A 1 261 HIS 261 261 261 HIS HIS A . n A 1 262 PHE 262 262 262 PHE PHE A . n A 1 263 GLN 263 263 263 GLN GLN A . n A 1 264 ALA 264 264 264 ALA ALA A . n A 1 265 ILE 265 265 265 ILE ILE A . n A 1 266 ILE 266 266 266 ILE ILE A . n A 1 267 ASP 267 267 267 ASP ASP A . n A 1 268 SER 268 268 268 SER SER A . n A 1 269 VAL 269 269 269 VAL VAL A . n A 1 270 ALA 270 270 270 ALA ALA A . n A 1 271 PRO 271 271 271 PRO PRO A . n A 1 272 MET 272 272 272 MET MET A . n A 1 273 GLU 273 273 ? ? ? A . n A 1 274 SER 274 274 ? ? ? A . n A 1 275 ASP 275 275 ? ? ? A . n A 1 276 PRO 276 276 ? ? ? A . n A 1 277 GLU 277 277 ? ? ? A . n A 1 278 GLY 278 278 ? ? ? A . n A 1 279 ALA 279 279 ? ? ? A . n A 1 280 ARG 280 280 ? ? ? A . n A 1 281 GLN 281 281 ? ? ? A . n A 1 282 ARG 282 282 ? ? ? A . n A 1 283 VAL 283 283 ? ? ? A . n A 1 284 GLU 284 284 ? ? ? A . n A 1 285 ALA 285 285 ? ? ? A . n A 1 286 LEU 286 286 ? ? ? A . n A 1 287 MET 287 287 ? ? ? A . n A 1 288 ALA 288 288 ? ? ? A . n A 1 289 TRP 289 289 ? ? ? A . n A 1 290 GLY 290 290 ? ? ? A . n A 1 291 ARG 291 291 ? ? ? A . n A 1 292 ASP 292 292 ? ? ? A . n A 1 293 ARG 293 293 ? ? ? A . n A 1 294 THR 294 294 ? ? ? A . n A 1 295 ARG 295 295 ? ? ? A . n A 1 296 VAL 296 296 ? ? ? A . n A 1 297 PHE 297 297 ? ? ? A . n A 1 298 ALA 298 298 ? ? ? A . n A 1 299 GLU 299 299 ? ? ? A . n A 1 300 GLY 300 300 ? ? ? A . n A 1 301 ASP 301 301 ? ? ? A . n A 1 302 LYS 302 302 ? ? ? A . n A 1 303 LYS 303 303 ? ? ? A . n A 1 304 GLY 304 304 ? ? ? A . n A 1 305 ALA 305 305 ? ? ? A . n # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A HIS 226 ? CB ? A HIS 226 CB 2 1 Y 1 A HIS 226 ? CG ? A HIS 226 CG 3 1 Y 1 A HIS 226 ? ND1 ? A HIS 226 ND1 4 1 Y 1 A HIS 226 ? CD2 ? A HIS 226 CD2 5 1 Y 1 A HIS 226 ? CE1 ? A HIS 226 CE1 6 1 Y 1 A HIS 226 ? NE2 ? A HIS 226 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? dev_1839 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 4Y98 _cell.details ? _cell.formula_units_Z ? _cell.length_a 61.301 _cell.length_a_esd ? _cell.length_b 61.301 _cell.length_b_esd ? _cell.length_c 134.659 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4Y98 _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4Y98 _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.26 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 45.47 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 298 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.1 M Hepes pH 7.5, 1.5 M Lithium Sulfate' _exptl_crystal_grow.pdbx_pH_range 7.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2012-12-03 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.00000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'ALS BEAMLINE 8.2.2' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.00000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 8.2.2 _diffrn_source.pdbx_synchrotron_site ALS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4Y98 _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.64 _reflns.d_resolution_low 49.389 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 9044 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 10.9 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 25.2 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4Y98 _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.648 _refine.ls_d_res_low 49.389 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8829 _refine.ls_number_reflns_R_free 417 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 97.85 _refine.ls_percent_reflns_R_free 4.72 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2135 _refine.ls_R_factor_R_free 0.2544 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2114 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 35.98 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.33 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1724 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1724 _refine_hist.d_res_high 2.648 _refine_hist.d_res_low 49.389 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1754 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.939 ? 2376 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 15.164 ? 624 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.033 ? 269 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.004 ? 314 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.6482 3.0313 . . 149 2675 97.00 . . . 0.3995 . 0.3286 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0313 3.8190 . . 126 2781 97.00 . . . 0.2764 . 0.2459 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.8190 49.3972 . . 142 2956 99.00 . . . 0.2169 . 0.1744 . . . . . . . . . . # _struct.entry_id 4Y98 _struct.title 'Crystal structure of LigD-apo form from Sphingobium sp. strain SYK-6' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4Y98 _struct_keywords.text 'Short Chain Dehydrogenase/reductase SDR family, OXIDOREDUCTASE' _struct_keywords.pdbx_keywords OXIDOREDUCTASE # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code G2IN91_9SPHN _struct_ref.pdbx_db_accession G2IN91 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MKDFQDQVAFITGGASGAGFGQAKVFGQAGAKIVVADVRAEAVEKAVAELEGLGITAHGIVLDIMDREAYARAADEVEAV FGQAPTLLSNTAGVNSFGPIEKTTYDDFDWIIGVNLNGVINGMVTFVPRMIASGRPGHIVTVSSLGGFMGSALAGPYSAA KAASINLMEGYRQGLEKYGIGVSVCTPANIKSNIAEASRLRPAKYGTSGYVENEESIASLHSIHQHGLEPEKLAEAIKKG VEDNALYIIPYPEVREGLEKHFQAIIDSVAPMESDPEGARQRVEALMAWGRDRTRVFAEGDKKGA ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4Y98 _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 305 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession G2IN91 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 305 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 305 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4720 ? 1 MORE -33 ? 1 'SSA (A^2)' 18200 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_645 y+1,x-1,-z -0.5000000000 0.8660254038 0.0000000000 91.9515000000 0.8660254038 0.5000000000 0.0000000000 -53.0882232774 0.0000000000 0.0000000000 -1.0000000000 0.0000000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 SER A 16 ? GLN A 28 ? SER A 16 GLN A 28 1 ? 13 HELX_P HELX_P2 AA2 ARG A 39 ? GLY A 52 ? ARG A 39 GLY A 52 1 ? 14 HELX_P HELX_P3 AA3 ASP A 66 ? GLY A 82 ? ASP A 66 GLY A 82 1 ? 17 HELX_P HELX_P4 AA4 PRO A 99 ? THR A 103 ? PRO A 99 THR A 103 5 ? 5 HELX_P HELX_P5 AA5 THR A 104 ? LEU A 116 ? THR A 104 LEU A 116 1 ? 13 HELX_P HELX_P6 AA6 LEU A 116 ? GLY A 134 ? LEU A 116 GLY A 134 1 ? 19 HELX_P HELX_P7 AA7 SER A 144 ? MET A 149 ? SER A 144 MET A 149 5 ? 6 HELX_P HELX_P8 AA8 ALA A 154 ? GLU A 176 ? ALA A 154 GLU A 176 1 ? 23 HELX_P HELX_P9 AA9 GLU A 229 ? ASN A 244 ? GLU A 229 ASN A 244 1 ? 16 HELX_P HELX_P10 AB1 TYR A 251 ? GLU A 253 ? TYR A 251 GLU A 253 5 ? 3 HELX_P HELX_P11 AB2 VAL A 254 ? VAL A 269 ? VAL A 254 VAL A 269 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id PRO _struct_mon_prot_cis.label_seq_id 271 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id PRO _struct_mon_prot_cis.auth_seq_id 271 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 MET _struct_mon_prot_cis.pdbx_label_seq_id_2 272 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 MET _struct_mon_prot_cis.pdbx_auth_seq_id_2 272 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 3.04 # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 7 _struct_sheet.details ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? parallel AA1 2 3 ? parallel AA1 3 4 ? parallel AA1 4 5 ? parallel AA1 5 6 ? parallel AA1 6 7 ? parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ALA A 57 ? VAL A 61 ? ALA A 57 VAL A 61 AA1 2 LYS A 32 ? ASP A 37 ? LYS A 32 ASP A 37 AA1 3 VAL A 8 ? THR A 12 ? VAL A 8 THR A 12 AA1 4 LEU A 87 ? ASN A 90 ? LEU A 87 ASN A 90 AA1 5 GLY A 137 ? VAL A 142 ? GLY A 137 VAL A 142 AA1 6 ILE A 180 ? CYS A 185 ? ILE A 180 CYS A 185 AA1 7 TYR A 247 ? ILE A 248 ? TYR A 247 ILE A 248 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O ILE A 60 ? O ILE A 60 N VAL A 35 ? N VAL A 35 AA1 2 3 O VAL A 34 ? O VAL A 34 N ALA A 9 ? N ALA A 9 AA1 3 4 N PHE A 10 ? N PHE A 10 O LEU A 87 ? O LEU A 87 AA1 4 5 N LEU A 88 ? N LEU A 88 O VAL A 140 ? O VAL A 140 AA1 5 6 N THR A 141 ? N THR A 141 O CYS A 185 ? O CYS A 185 AA1 6 7 N VAL A 184 ? N VAL A 184 O ILE A 248 ? O ILE A 248 # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 HE2 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 HIS _pdbx_validate_close_contact.auth_seq_id_1 138 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 HG _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 SER _pdbx_validate_close_contact.auth_seq_id_2 183 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.22 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 SER A 143 ? ? -94.44 -122.03 2 1 MET A 149 ? ? -163.19 108.74 3 1 ASN A 189 ? ? -113.48 69.06 4 1 PRO A 250 ? ? -80.97 49.41 # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 32.2378 -20.2742 21.5810 0.9757 ? -0.0189 ? -0.0505 ? 0.8603 ? -0.0045 ? 0.9617 ? 0.3788 ? 0.3263 ? 0.0621 ? 0.2293 ? 0.0467 ? 0.1220 ? 0.1284 ? -0.1683 ? -0.2113 ? -0.4847 ? -0.2054 ? 0.3117 ? 0.4528 ? -0.6804 ? -0.0004 ? 2 'X-RAY DIFFRACTION' ? refined 36.3158 -23.8447 24.3694 0.9997 ? -0.0900 ? 0.1283 ? 0.9360 ? -0.0291 ? 0.8769 ? 0.4383 ? 0.1214 ? 0.1271 ? 0.2228 ? -0.2232 ? 0.2979 ? -0.1253 ? 0.4703 ? 0.1753 ? 0.5254 ? -0.0801 ? -0.1292 ? 1.0857 ? -0.2888 ? -0.0001 ? 3 'X-RAY DIFFRACTION' ? refined 33.4302 -31.9550 23.5724 1.2132 ? -0.2305 ? 0.0389 ? 0.9769 ? -0.0156 ? 0.9989 ? 0.4312 ? -0.1604 ? -0.0990 ? 0.4072 ? -0.3474 ? 0.4142 ? -0.7018 ? -0.2445 ? -0.4431 ? 0.1980 ? 0.3299 ? 0.2933 ? -0.2901 ? -0.4259 ? -0.0052 ? 4 'X-RAY DIFFRACTION' ? refined 38.5255 -28.2402 9.7623 0.9020 ? -0.1653 ? 0.0557 ? 0.8137 ? -0.0329 ? 0.8662 ? -0.0061 ? -0.3160 ? -0.2780 ? -0.1166 ? -0.0966 ? 3.7198 ? -0.2607 ? -0.1960 ? -0.0412 ? 0.0847 ? 0.1125 ? 0.0348 ? 0.5417 ? -0.5424 ? 0.0001 ? 5 'X-RAY DIFFRACTION' ? refined 42.4724 -19.3162 7.4471 1.0367 ? -0.0453 ? -0.0160 ? 0.6985 ? 0.0081 ? 0.9091 ? 0.8211 ? -0.1657 ? -0.1926 ? -0.1391 ? 0.2482 ? 0.4003 ? -0.2367 ? 0.0722 ? 0.0794 ? 0.0719 ? 0.1113 ? 0.0581 ? 0.0819 ? -0.5091 ? -0.0001 ? 6 'X-RAY DIFFRACTION' ? refined 43.9036 -13.2772 17.6058 1.1426 ? -0.1024 ? -0.1009 ? 0.7634 ? -0.0283 ? 0.9796 ? 0.3116 ? 0.1720 ? -0.1009 ? 0.0457 ? 0.0027 ? 0.1604 ? -0.2960 ? -0.5862 ? 0.4289 ? 0.2193 ? 0.1463 ? -0.1645 ? -0.7971 ? 0.0549 ? 0.0001 ? 7 'X-RAY DIFFRACTION' ? refined 59.0840 -12.1466 -0.2585 0.9966 ? -0.3155 ? 0.0322 ? 0.8754 ? -0.0157 ? 1.0342 ? 0.3485 ? -0.3819 ? 0.0325 ? 0.2010 ? -0.0473 ? 0.0322 ? -0.0155 ? -0.1214 ? 0.2074 ? 0.0060 ? -0.0370 ? -0.3231 ? 0.1021 ? 0.5642 ? -0.0006 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 3 through 16 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 17 through 39 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 40 through 68 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 69 through 154 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 155 through 229 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 230 through 251 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 252 through 272 ) ; # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 1 ? A MET 1 2 1 Y 1 A LYS 2 ? A LYS 2 3 1 Y 1 A LYS 191 ? A LYS 191 4 1 Y 1 A SER 192 ? A SER 192 5 1 Y 1 A ASN 193 ? A ASN 193 6 1 Y 1 A ILE 194 ? A ILE 194 7 1 Y 1 A ALA 195 ? A ALA 195 8 1 Y 1 A GLU 196 ? A GLU 196 9 1 Y 1 A ALA 197 ? A ALA 197 10 1 Y 1 A SER 198 ? A SER 198 11 1 Y 1 A ARG 199 ? A ARG 199 12 1 Y 1 A LEU 200 ? A LEU 200 13 1 Y 1 A ARG 201 ? A ARG 201 14 1 Y 1 A PRO 202 ? A PRO 202 15 1 Y 1 A ALA 203 ? A ALA 203 16 1 Y 1 A LYS 204 ? A LYS 204 17 1 Y 1 A TYR 205 ? A TYR 205 18 1 Y 1 A GLY 206 ? A GLY 206 19 1 Y 1 A THR 207 ? A THR 207 20 1 Y 1 A SER 208 ? A SER 208 21 1 Y 1 A GLY 209 ? A GLY 209 22 1 Y 1 A TYR 210 ? A TYR 210 23 1 Y 1 A VAL 211 ? A VAL 211 24 1 Y 1 A GLU 212 ? A GLU 212 25 1 Y 1 A ASN 213 ? A ASN 213 26 1 Y 1 A GLU 214 ? A GLU 214 27 1 Y 1 A GLU 215 ? A GLU 215 28 1 Y 1 A SER 216 ? A SER 216 29 1 Y 1 A ILE 217 ? A ILE 217 30 1 Y 1 A ALA 218 ? A ALA 218 31 1 Y 1 A SER 219 ? A SER 219 32 1 Y 1 A LEU 220 ? A LEU 220 33 1 Y 1 A HIS 221 ? A HIS 221 34 1 Y 1 A SER 222 ? A SER 222 35 1 Y 1 A ILE 223 ? A ILE 223 36 1 Y 1 A HIS 224 ? A HIS 224 37 1 Y 1 A GLN 225 ? A GLN 225 38 1 Y 1 A GLU 273 ? A GLU 273 39 1 Y 1 A SER 274 ? A SER 274 40 1 Y 1 A ASP 275 ? A ASP 275 41 1 Y 1 A PRO 276 ? A PRO 276 42 1 Y 1 A GLU 277 ? A GLU 277 43 1 Y 1 A GLY 278 ? A GLY 278 44 1 Y 1 A ALA 279 ? A ALA 279 45 1 Y 1 A ARG 280 ? A ARG 280 46 1 Y 1 A GLN 281 ? A GLN 281 47 1 Y 1 A ARG 282 ? A ARG 282 48 1 Y 1 A VAL 283 ? A VAL 283 49 1 Y 1 A GLU 284 ? A GLU 284 50 1 Y 1 A ALA 285 ? A ALA 285 51 1 Y 1 A LEU 286 ? A LEU 286 52 1 Y 1 A MET 287 ? A MET 287 53 1 Y 1 A ALA 288 ? A ALA 288 54 1 Y 1 A TRP 289 ? A TRP 289 55 1 Y 1 A GLY 290 ? A GLY 290 56 1 Y 1 A ARG 291 ? A ARG 291 57 1 Y 1 A ASP 292 ? A ASP 292 58 1 Y 1 A ARG 293 ? A ARG 293 59 1 Y 1 A THR 294 ? A THR 294 60 1 Y 1 A ARG 295 ? A ARG 295 61 1 Y 1 A VAL 296 ? A VAL 296 62 1 Y 1 A PHE 297 ? A PHE 297 63 1 Y 1 A ALA 298 ? A ALA 298 64 1 Y 1 A GLU 299 ? A GLU 299 65 1 Y 1 A GLY 300 ? A GLY 300 66 1 Y 1 A ASP 301 ? A ASP 301 67 1 Y 1 A LYS 302 ? A LYS 302 68 1 Y 1 A LYS 303 ? A LYS 303 69 1 Y 1 A GLY 304 ? A GLY 304 70 1 Y 1 A ALA 305 ? A ALA 305 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _atom_sites.entry_id 4Y98 _atom_sites.fract_transf_matrix[1][1] 0.016313 _atom_sites.fract_transf_matrix[1][2] 0.009418 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.018837 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.007426 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C H N O S # loop_