data_4YYG # _entry.id 4YYG # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.379 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4YYG pdb_00004yyg 10.2210/pdb4yyg/pdb WWPDB D_1000208297 ? ? # loop_ _pdbx_database_related.content_type _pdbx_database_related.db_id _pdbx_database_related.db_name _pdbx_database_related.details unspecified 4YY4 PDB . unspecified 4YY6 PDB . unspecified 4YYD PDB . unspecified 4YYH PDB . unspecified 4YYI PDB . unspecified 4YYJ PDB . unspecified 4YYK PDB . unspecified 4YYM PDB . unspecified 4YYN PDB . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4YYG _pdbx_database_status.recvd_initial_deposition_date 2015-03-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site RCSB _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tang, Y.' 1 'Bellon, S.' 2 'Cochran, A.G.' 3 'Poy, F.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Structure _citation.journal_id_ASTM STRUE6 _citation.journal_id_CSD 2005 _citation.journal_id_ISSN 0969-2126 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 23 _citation.language ? _citation.page_first 1801 _citation.page_last 1814 _citation.title 'A Subset of Human Bromodomains Recognizes Butyryllysine and Crotonyllysine Histone Peptide Modifications.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.str.2015.08.004 _citation.pdbx_database_id_PubMed 26365797 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Flynn, E.M.' 1 ? primary 'Huang, O.W.' 2 ? primary 'Poy, F.' 3 ? primary 'Oppikofer, M.' 4 ? primary 'Bellon, S.F.' 5 ? primary 'Tang, Y.' 6 ? primary 'Cochran, A.G.' 7 ? # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 90.000 _cell.angle_gamma_esd ? _cell.entry_id 4YYG _cell.details ? _cell.formula_units_Z ? _cell.length_a 35.117 _cell.length_a_esd ? _cell.length_b 69.825 _cell.length_b_esd ? _cell.length_c 104.554 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4YYG _symmetry.cell_setting ? _symmetry.Int_Tables_number 20 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 2 2 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Bromodomain-containing protein 9' 12444.461 1 ? ? 'bromodomain (UNP residues 17-123)' ? 2 polymer syn 'Histone H4' 1114.279 1 ? ? 'N-terminal tail (UNP residues 2-12)' 'lysine residues butyrylated' 3 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Rhabdomyosarcoma antigen MU-RMS-40.8, BRD9' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDN AMTYNRPDTVYYKLAKKILHAGFKMMSK ; ;GSAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDN AMTYNRPDTVYYKLAKKILHAGFKMMSK ; A ? 2 'polypeptide(L)' no yes 'SGRG(BTK)GG(BTK)GLG' SGRGXGGXGLG B ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 ALA n 1 4 GLU n 1 5 ASN n 1 6 GLU n 1 7 SER n 1 8 THR n 1 9 PRO n 1 10 ILE n 1 11 GLN n 1 12 GLN n 1 13 LEU n 1 14 LEU n 1 15 GLU n 1 16 HIS n 1 17 PHE n 1 18 LEU n 1 19 ARG n 1 20 GLN n 1 21 LEU n 1 22 GLN n 1 23 ARG n 1 24 LYS n 1 25 ASP n 1 26 PRO n 1 27 HIS n 1 28 GLY n 1 29 PHE n 1 30 PHE n 1 31 ALA n 1 32 PHE n 1 33 PRO n 1 34 VAL n 1 35 THR n 1 36 ASP n 1 37 ALA n 1 38 ILE n 1 39 ALA n 1 40 PRO n 1 41 GLY n 1 42 TYR n 1 43 SER n 1 44 MET n 1 45 ILE n 1 46 ILE n 1 47 LYS n 1 48 HIS n 1 49 PRO n 1 50 MET n 1 51 ASP n 1 52 PHE n 1 53 GLY n 1 54 THR n 1 55 MET n 1 56 LYS n 1 57 ASP n 1 58 LYS n 1 59 ILE n 1 60 VAL n 1 61 ALA n 1 62 ASN n 1 63 GLU n 1 64 TYR n 1 65 LYS n 1 66 SER n 1 67 VAL n 1 68 THR n 1 69 GLU n 1 70 PHE n 1 71 LYS n 1 72 ALA n 1 73 ASP n 1 74 PHE n 1 75 LYS n 1 76 LEU n 1 77 MET n 1 78 CYS n 1 79 ASP n 1 80 ASN n 1 81 ALA n 1 82 MET n 1 83 THR n 1 84 TYR n 1 85 ASN n 1 86 ARG n 1 87 PRO n 1 88 ASP n 1 89 THR n 1 90 VAL n 1 91 TYR n 1 92 TYR n 1 93 LYS n 1 94 LEU n 1 95 ALA n 1 96 LYS n 1 97 LYS n 1 98 ILE n 1 99 LEU n 1 100 HIS n 1 101 ALA n 1 102 GLY n 1 103 PHE n 1 104 LYS n 1 105 MET n 1 106 MET n 1 107 SER n 1 108 LYS n 2 1 SER n 2 2 GLY n 2 3 ARG n 2 4 GLY n 2 5 BTK n 2 6 GLY n 2 7 GLY n 2 8 BTK n 2 9 GLY n 2 10 LEU n 2 11 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 108 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'BRD9, UNQ3040/PRO9856' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli BL21(DE3)' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 469008 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pRSF _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _pdbx_entity_src_syn.entity_id 2 _pdbx_entity_src_syn.pdbx_src_id 1 _pdbx_entity_src_syn.pdbx_alt_source_flag sample _pdbx_entity_src_syn.pdbx_beg_seq_num 1 _pdbx_entity_src_syn.pdbx_end_seq_num 11 _pdbx_entity_src_syn.organism_scientific 'Homo sapiens' _pdbx_entity_src_syn.organism_common_name Human _pdbx_entity_src_syn.ncbi_taxonomy_id 9606 _pdbx_entity_src_syn.details ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP BRD9_HUMAN Q9H8M2 Q9H8M2-1 1 ;SAENESTPIQQLLEHFLRQLQRKDPHGFFAFPVTDAIAPGYSMIIKHPMDFGTMKDKIVANEYKSVTEFKADFKLMCDNA MTYNRPDTVYYKLAKKILHAGFKMMSK ; 17 2 UNP H4_HUMAN P62805 ? 2 SGRGKGGKGLG 2 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 4YYG A 2 ? 108 ? Q9H8M2 17 ? 123 ? 17 123 2 2 4YYG B 1 ? 11 ? P62805 2 ? 12 ? 1 11 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4YYG _struct_ref_seq_dif.mon_id GLY _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 1 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code Q9H8M2 _struct_ref_seq_dif.db_mon_id ? _struct_ref_seq_dif.pdbx_seq_db_seq_num ? _struct_ref_seq_dif.details 'expression tag' _struct_ref_seq_dif.pdbx_auth_seq_num 16 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 BTK 'L-peptide linking' n N~6~-butanoyl-L-lysine ? 'C10 H20 N2 O3' 216.277 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4YYG _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.58 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 52.24 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 6.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.05 M calcium chloride dihydrate, 0.1 M Bis-Tris, pH 6.5, 30% v/v PEG550 MME' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300-HS' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-02-24 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator 'Si(111)' _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'APS BEAMLINE 22-ID' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline 22-ID _diffrn_source.pdbx_synchrotron_site APS # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 4YYG _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.000 _reflns.d_resolution_low 50.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8638 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 95.200 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 4.300 _reflns.pdbx_Rmerge_I_obs 0.091 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 14.661 _reflns.pdbx_netI_over_sigmaI 8.000 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 1.043 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 36832 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.000 2.070 ? ? ? ? ? 747 ? 83.500 ? ? ? ? 0.632 ? ? ? ? ? ? ? ? 4.000 ? 1.014 ? ? ? ? 0 1 1 ? ? 2.070 2.150 ? ? ? ? ? 828 ? 94.800 ? ? ? ? 0.538 ? ? ? ? ? ? ? ? 4.000 ? 1.044 ? ? ? ? 0 2 1 ? ? 2.150 2.250 ? ? ? ? ? 853 ? 95.300 ? ? ? ? 0.358 ? ? ? ? ? ? ? ? 4.300 ? 1.045 ? ? ? ? 0 3 1 ? ? 2.250 2.370 ? ? ? ? ? 856 ? 97.500 ? ? ? ? 0.369 ? ? ? ? ? ? ? ? 4.500 ? 1.044 ? ? ? ? 0 4 1 ? ? 2.370 2.520 ? ? ? ? ? 884 ? 97.600 ? ? ? ? 0.250 ? ? ? ? ? ? ? ? 4.500 ? 1.053 ? ? ? ? 0 5 1 ? ? 2.520 2.710 ? ? ? ? ? 881 ? 98.300 ? ? ? ? 0.202 ? ? ? ? ? ? ? ? 4.500 ? 1.074 ? ? ? ? 0 6 1 ? ? 2.710 2.990 ? ? ? ? ? 881 ? 97.100 ? ? ? ? 0.121 ? ? ? ? ? ? ? ? 4.400 ? 1.047 ? ? ? ? 0 7 1 ? ? 2.990 3.420 ? ? ? ? ? 874 ? 97.300 ? ? ? ? 0.074 ? ? ? ? ? ? ? ? 4.300 ? 1.054 ? ? ? ? 0 8 1 ? ? 3.420 4.310 ? ? ? ? ? 863 ? 92.300 ? ? ? ? 0.049 ? ? ? ? ? ? ? ? 4.000 ? 1.018 ? ? ? ? 0 9 1 ? ? 4.310 50.000 ? ? ? ? ? 971 ? 98.300 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 4.100 ? 1.026 ? ? ? ? 0 10 1 ? ? # _refine.aniso_B[1][1] 3.4200 _refine.aniso_B[1][2] 0.0000 _refine.aniso_B[1][3] 0.0000 _refine.aniso_B[2][2] -5.0700 _refine.aniso_B[2][3] -0.0000 _refine.aniso_B[3][3] 1.6500 _refine.B_iso_max 81.460 _refine.B_iso_mean 35.9800 _refine.B_iso_min 21.140 _refine.correlation_coeff_Fo_to_Fc 0.9300 _refine.correlation_coeff_Fo_to_Fc_free 0.8940 _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4YYG _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.1000 _refine.ls_d_res_low 33.1200 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 7156 _refine.ls_number_reflns_R_free 346 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 95.8000 _refine.ls_percent_reflns_R_free 4.6000 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2557 _refine.ls_R_factor_R_free 0.3115 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2530 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details MASK _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.000 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 'PDB entry 3HME' _refine.pdbx_stereochemistry_target_values 'MAXIMUM LIKELIHOOD' _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R 0.0560 _refine.pdbx_overall_ESU_R_Free 0.0500 _refine.pdbx_solvent_vdw_probe_radii 1.2000 _refine.pdbx_solvent_ion_probe_radii 0.8000 _refine.pdbx_solvent_shrinkage_radii 0.8000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B 12.5430 _refine.overall_SU_ML 0.1630 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.1000 _refine_hist.d_res_low 33.1200 _refine_hist.pdbx_number_atoms_ligand 22 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 858 _refine_hist.pdbx_number_residues_total 100 _refine_hist.pdbx_B_iso_mean_ligand 43.33 _refine_hist.pdbx_B_iso_mean_solvent 33.87 _refine_hist.pdbx_number_atoms_protein 815 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.016 0.019 858 ? r_bond_refined_d ? ? 'X-RAY DIFFRACTION' ? 1.967 1.972 1149 ? r_angle_refined_deg ? ? 'X-RAY DIFFRACTION' ? 4.971 5.000 101 ? r_dihedral_angle_1_deg ? ? 'X-RAY DIFFRACTION' ? 37.947 23.784 37 ? r_dihedral_angle_2_deg ? ? 'X-RAY DIFFRACTION' ? 18.897 15.000 155 ? r_dihedral_angle_3_deg ? ? 'X-RAY DIFFRACTION' ? 11.999 15.000 3 ? r_dihedral_angle_4_deg ? ? 'X-RAY DIFFRACTION' ? 0.132 0.200 120 ? r_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.009 0.021 636 ? r_gen_planes_refined ? ? 'X-RAY DIFFRACTION' ? 2.639 2.777 410 ? r_mcbond_it ? ? 'X-RAY DIFFRACTION' ? 3.360 4.143 509 ? r_mcangle_it ? ? 'X-RAY DIFFRACTION' ? 3.525 3.047 448 ? r_scbond_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.1000 _refine_ls_shell.d_res_low 2.1540 _refine_ls_shell.number_reflns_all 535 _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 24 _refine_ls_shell.number_reflns_R_work 511 _refine_ls_shell.percent_reflns_obs 95.8800 _refine_ls_shell.percent_reflns_R_free ? _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.3540 _refine_ls_shell.R_factor_R_free_error ? _refine_ls_shell.R_factor_R_work 0.2720 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 20 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # _struct.entry_id 4YYG _struct.title 'Crystal structure of BRD9 Bromodomain bound to a butyryllysine peptide' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4YYG _struct_keywords.text 'Bromodomain-butyryllysine complex, PROTEIN BINDING' _struct_keywords.pdbx_keywords 'PROTEIN BINDING' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ILE A 10 ? LYS A 24 ? ILE A 25 LYS A 39 1 ? 15 HELX_P HELX_P2 AA2 GLY A 41 ? ILE A 46 ? GLY A 56 ILE A 61 1 ? 6 HELX_P HELX_P3 AA3 ASP A 51 ? ALA A 61 ? ASP A 66 ALA A 76 1 ? 11 HELX_P HELX_P4 AA4 SER A 66 ? ASN A 85 ? SER A 81 ASN A 100 1 ? 20 HELX_P HELX_P5 AA5 THR A 89 ? SER A 107 ? THR A 104 SER A 122 1 ? 19 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _struct_conn.id covale1 _struct_conn.conn_type_id covale _struct_conn.pdbx_leaving_atom_flag both _struct_conn.pdbx_PDB_id ? _struct_conn.ptnr1_label_asym_id B _struct_conn.ptnr1_label_comp_id GLY _struct_conn.ptnr1_label_seq_id 7 _struct_conn.ptnr1_label_atom_id C _struct_conn.pdbx_ptnr1_label_alt_id ? _struct_conn.pdbx_ptnr1_PDB_ins_code ? _struct_conn.pdbx_ptnr1_standard_comp_id ? _struct_conn.ptnr1_symmetry 1_555 _struct_conn.ptnr2_label_asym_id B _struct_conn.ptnr2_label_comp_id BTK _struct_conn.ptnr2_label_seq_id 8 _struct_conn.ptnr2_label_atom_id N _struct_conn.pdbx_ptnr2_label_alt_id ? _struct_conn.pdbx_ptnr2_PDB_ins_code ? _struct_conn.ptnr1_auth_asym_id B _struct_conn.ptnr1_auth_comp_id GLY _struct_conn.ptnr1_auth_seq_id 7 _struct_conn.ptnr2_auth_asym_id B _struct_conn.ptnr2_auth_comp_id BTK _struct_conn.ptnr2_auth_seq_id 8 _struct_conn.ptnr2_symmetry 1_555 _struct_conn.pdbx_ptnr3_label_atom_id ? _struct_conn.pdbx_ptnr3_label_seq_id ? _struct_conn.pdbx_ptnr3_label_comp_id ? _struct_conn.pdbx_ptnr3_label_asym_id ? _struct_conn.pdbx_ptnr3_label_alt_id ? _struct_conn.pdbx_ptnr3_PDB_ins_code ? _struct_conn.details ? _struct_conn.pdbx_dist_value 1.325 _struct_conn.pdbx_value_order ? _struct_conn.pdbx_role ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # _atom_sites.entry_id 4YYG _atom_sites.fract_transf_matrix[1][1] 0.028476 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] -0.000000 _atom_sites.fract_transf_matrix[2][2] 0.014322 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] -0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009564 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 16 ? ? ? A . n A 1 2 SER 2 17 ? ? ? A . n A 1 3 ALA 3 18 ? ? ? A . n A 1 4 GLU 4 19 ? ? ? A . n A 1 5 ASN 5 20 ? ? ? A . n A 1 6 GLU 6 21 ? ? ? A . n A 1 7 SER 7 22 ? ? ? A . n A 1 8 THR 8 23 23 THR THR A . n A 1 9 PRO 9 24 24 PRO PRO A . n A 1 10 ILE 10 25 25 ILE ILE A . n A 1 11 GLN 11 26 26 GLN GLN A . n A 1 12 GLN 12 27 27 GLN GLN A . n A 1 13 LEU 13 28 28 LEU LEU A . n A 1 14 LEU 14 29 29 LEU LEU A . n A 1 15 GLU 15 30 30 GLU GLU A . n A 1 16 HIS 16 31 31 HIS HIS A . n A 1 17 PHE 17 32 32 PHE PHE A . n A 1 18 LEU 18 33 33 LEU LEU A . n A 1 19 ARG 19 34 34 ARG ARG A . n A 1 20 GLN 20 35 35 GLN GLN A . n A 1 21 LEU 21 36 36 LEU LEU A . n A 1 22 GLN 22 37 37 GLN GLN A . n A 1 23 ARG 23 38 38 ARG ARG A . n A 1 24 LYS 24 39 39 LYS LYS A . n A 1 25 ASP 25 40 40 ASP ASP A . n A 1 26 PRO 26 41 41 PRO PRO A . n A 1 27 HIS 27 42 42 HIS HIS A . n A 1 28 GLY 28 43 43 GLY GLY A . n A 1 29 PHE 29 44 44 PHE PHE A . n A 1 30 PHE 30 45 45 PHE PHE A . n A 1 31 ALA 31 46 46 ALA ALA A . n A 1 32 PHE 32 47 47 PHE PHE A . n A 1 33 PRO 33 48 48 PRO PRO A . n A 1 34 VAL 34 49 49 VAL VAL A . n A 1 35 THR 35 50 50 THR THR A . n A 1 36 ASP 36 51 51 ASP ASP A . n A 1 37 ALA 37 52 52 ALA ALA A . n A 1 38 ILE 38 53 53 ILE ILE A . n A 1 39 ALA 39 54 54 ALA ALA A . n A 1 40 PRO 40 55 55 PRO PRO A . n A 1 41 GLY 41 56 56 GLY GLY A . n A 1 42 TYR 42 57 57 TYR TYR A . n A 1 43 SER 43 58 58 SER SER A . n A 1 44 MET 44 59 59 MET MET A . n A 1 45 ILE 45 60 60 ILE ILE A . n A 1 46 ILE 46 61 61 ILE ILE A . n A 1 47 LYS 47 62 62 LYS LYS A . n A 1 48 HIS 48 63 63 HIS HIS A . n A 1 49 PRO 49 64 64 PRO PRO A . n A 1 50 MET 50 65 65 MET MET A . n A 1 51 ASP 51 66 66 ASP ASP A . n A 1 52 PHE 52 67 67 PHE PHE A . n A 1 53 GLY 53 68 68 GLY GLY A . n A 1 54 THR 54 69 69 THR THR A . n A 1 55 MET 55 70 70 MET MET A . n A 1 56 LYS 56 71 71 LYS LYS A . n A 1 57 ASP 57 72 72 ASP ASP A . n A 1 58 LYS 58 73 73 LYS LYS A . n A 1 59 ILE 59 74 74 ILE ILE A . n A 1 60 VAL 60 75 75 VAL VAL A . n A 1 61 ALA 61 76 76 ALA ALA A . n A 1 62 ASN 62 77 77 ASN ASN A . n A 1 63 GLU 63 78 78 GLU GLU A . n A 1 64 TYR 64 79 79 TYR TYR A . n A 1 65 LYS 65 80 80 LYS LYS A . n A 1 66 SER 66 81 81 SER SER A . n A 1 67 VAL 67 82 82 VAL VAL A . n A 1 68 THR 68 83 83 THR THR A . n A 1 69 GLU 69 84 84 GLU GLU A . n A 1 70 PHE 70 85 85 PHE PHE A . n A 1 71 LYS 71 86 86 LYS LYS A . n A 1 72 ALA 72 87 87 ALA ALA A . n A 1 73 ASP 73 88 88 ASP ASP A . n A 1 74 PHE 74 89 89 PHE PHE A . n A 1 75 LYS 75 90 90 LYS LYS A . n A 1 76 LEU 76 91 91 LEU LEU A . n A 1 77 MET 77 92 92 MET MET A . n A 1 78 CYS 78 93 93 CYS CYS A . n A 1 79 ASP 79 94 94 ASP ASP A . n A 1 80 ASN 80 95 95 ASN ASN A . n A 1 81 ALA 81 96 96 ALA ALA A . n A 1 82 MET 82 97 97 MET MET A . n A 1 83 THR 83 98 98 THR THR A . n A 1 84 TYR 84 99 99 TYR TYR A . n A 1 85 ASN 85 100 100 ASN ASN A . n A 1 86 ARG 86 101 101 ARG ARG A . n A 1 87 PRO 87 102 102 PRO PRO A . n A 1 88 ASP 88 103 103 ASP ASP A . n A 1 89 THR 89 104 104 THR THR A . n A 1 90 VAL 90 105 105 VAL VAL A . n A 1 91 TYR 91 106 106 TYR TYR A . n A 1 92 TYR 92 107 107 TYR TYR A . n A 1 93 LYS 93 108 108 LYS LYS A . n A 1 94 LEU 94 109 109 LEU LEU A . n A 1 95 ALA 95 110 110 ALA ALA A . n A 1 96 LYS 96 111 111 LYS LYS A . n A 1 97 LYS 97 112 112 LYS LYS A . n A 1 98 ILE 98 113 113 ILE ILE A . n A 1 99 LEU 99 114 114 LEU LEU A . n A 1 100 HIS 100 115 115 HIS HIS A . n A 1 101 ALA 101 116 116 ALA ALA A . n A 1 102 GLY 102 117 117 GLY GLY A . n A 1 103 PHE 103 118 118 PHE PHE A . n A 1 104 LYS 104 119 119 LYS LYS A . n A 1 105 MET 105 120 120 MET MET A . n A 1 106 MET 106 121 121 MET MET A . n A 1 107 SER 107 122 122 SER SER A . n A 1 108 LYS 108 123 ? ? ? A . n B 2 1 SER 1 1 ? ? ? B . n B 2 2 GLY 2 2 ? ? ? B . n B 2 3 ARG 3 3 ? ? ? B . n B 2 4 GLY 4 4 ? ? ? B . n B 2 5 BTK 5 5 ? ? ? B . n B 2 6 GLY 6 6 6 GLY GLY B . n B 2 7 GLY 7 7 7 GLY GLY B . n B 2 8 BTK 8 8 8 BTK KBU B . n B 2 9 GLY 9 9 ? ? ? B . n B 2 10 LEU 10 10 ? ? ? B . n B 2 11 GLY 11 11 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 3 HOH 1 201 1 HOH HOH A . C 3 HOH 2 202 13 HOH HOH A . C 3 HOH 3 203 18 HOH HOH A . C 3 HOH 4 204 11 HOH HOH A . C 3 HOH 5 205 2 HOH HOH A . C 3 HOH 6 206 4 HOH HOH A . C 3 HOH 7 207 3 HOH HOH A . C 3 HOH 8 208 8 HOH HOH A . C 3 HOH 9 209 5 HOH HOH A . C 3 HOH 10 210 20 HOH HOH A . C 3 HOH 11 211 19 HOH HOH A . C 3 HOH 12 212 21 HOH HOH A . C 3 HOH 13 213 6 HOH HOH A . C 3 HOH 14 214 14 HOH HOH A . C 3 HOH 15 215 10 HOH HOH A . C 3 HOH 16 216 9 HOH HOH A . C 3 HOH 17 217 12 HOH HOH A . C 3 HOH 18 218 16 HOH HOH A . C 3 HOH 19 219 7 HOH HOH A . C 3 HOH 20 220 17 HOH HOH A . D 3 HOH 1 101 15 HOH HOH B . # _pdbx_struct_mod_residue.id 1 _pdbx_struct_mod_residue.label_asym_id B _pdbx_struct_mod_residue.label_comp_id BTK _pdbx_struct_mod_residue.label_seq_id 8 _pdbx_struct_mod_residue.auth_asym_id B _pdbx_struct_mod_residue.auth_comp_id BTK _pdbx_struct_mod_residue.auth_seq_id 8 _pdbx_struct_mod_residue.PDB_ins_code ? _pdbx_struct_mod_residue.parent_comp_id LYS _pdbx_struct_mod_residue.details 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-09-16 2 'Structure model' 1 1 2015-09-30 3 'Structure model' 1 2 2015-10-14 4 'Structure model' 1 3 2016-03-09 5 'Structure model' 1 4 2023-09-27 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Experimental preparation' 4 5 'Structure model' 'Data collection' 5 5 'Structure model' 'Database references' 6 5 'Structure model' 'Derived calculations' 7 5 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 5 'Structure model' chem_comp_atom 2 5 'Structure model' chem_comp_bond 3 5 'Structure model' database_2 4 5 'Structure model' pdbx_initial_refinement_model 5 5 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 5 'Structure model' '_database_2.pdbx_DOI' 2 5 'Structure model' '_database_2.pdbx_database_accession' 3 5 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _pdbx_refine_tls.id 1 _pdbx_refine_tls.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls.details ? _pdbx_refine_tls.method refined _pdbx_refine_tls.origin_x -8.5773 _pdbx_refine_tls.origin_y -11.8912 _pdbx_refine_tls.origin_z -13.0198 _pdbx_refine_tls.T[1][1] 0.0621 _pdbx_refine_tls.T[1][1]_esd ? _pdbx_refine_tls.T[1][2] 0.0135 _pdbx_refine_tls.T[1][2]_esd ? _pdbx_refine_tls.T[1][3] 0.0106 _pdbx_refine_tls.T[1][3]_esd ? _pdbx_refine_tls.T[2][2] 0.0187 _pdbx_refine_tls.T[2][2]_esd ? _pdbx_refine_tls.T[2][3] 0.0017 _pdbx_refine_tls.T[2][3]_esd ? _pdbx_refine_tls.T[3][3] 0.0109 _pdbx_refine_tls.T[3][3]_esd ? _pdbx_refine_tls.L[1][1] 2.0131 _pdbx_refine_tls.L[1][1]_esd ? _pdbx_refine_tls.L[1][2] -0.0101 _pdbx_refine_tls.L[1][2]_esd ? _pdbx_refine_tls.L[1][3] 0.5694 _pdbx_refine_tls.L[1][3]_esd ? _pdbx_refine_tls.L[2][2] 0.3727 _pdbx_refine_tls.L[2][2]_esd ? _pdbx_refine_tls.L[2][3] -0.2416 _pdbx_refine_tls.L[2][3]_esd ? _pdbx_refine_tls.L[3][3] 2.1428 _pdbx_refine_tls.L[3][3]_esd ? _pdbx_refine_tls.S[1][1] -0.0159 _pdbx_refine_tls.S[1][1]_esd ? _pdbx_refine_tls.S[1][2] -0.0338 _pdbx_refine_tls.S[1][2]_esd ? _pdbx_refine_tls.S[1][3] 0.1083 _pdbx_refine_tls.S[1][3]_esd ? _pdbx_refine_tls.S[2][1] -0.0802 _pdbx_refine_tls.S[2][1]_esd ? _pdbx_refine_tls.S[2][2] -0.0747 _pdbx_refine_tls.S[2][2]_esd ? _pdbx_refine_tls.S[2][3] -0.0317 _pdbx_refine_tls.S[2][3]_esd ? _pdbx_refine_tls.S[3][1] 0.0299 _pdbx_refine_tls.S[3][1]_esd ? _pdbx_refine_tls.S[3][2] 0.0027 _pdbx_refine_tls.S[3][2]_esd ? _pdbx_refine_tls.S[3][3] 0.0906 _pdbx_refine_tls.S[3][3]_esd ? # _pdbx_refine_tls_group.id 1 _pdbx_refine_tls_group.pdbx_refine_id 'X-RAY DIFFRACTION' _pdbx_refine_tls_group.refine_tls_id 1 _pdbx_refine_tls_group.beg_label_asym_id ? _pdbx_refine_tls_group.beg_label_seq_id ? _pdbx_refine_tls_group.beg_auth_asym_id A _pdbx_refine_tls_group.beg_auth_seq_id 23 _pdbx_refine_tls_group.end_label_asym_id ? _pdbx_refine_tls_group.end_label_seq_id ? _pdbx_refine_tls_group.end_auth_asym_id A _pdbx_refine_tls_group.end_auth_seq_id 122 _pdbx_refine_tls_group.selection ? _pdbx_refine_tls_group.selection_details ? # _phasing.method MR # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 3 ? refinement ? ? ? ? ? ? ? ? ? ? ? REFMAC ? ? ? 5.8.0069 4 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 5 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 40 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi -119.82 _pdbx_validate_torsion.psi 66.17 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 16 ? A GLY 1 2 1 Y 1 A SER 17 ? A SER 2 3 1 Y 1 A ALA 18 ? A ALA 3 4 1 Y 1 A GLU 19 ? A GLU 4 5 1 Y 1 A ASN 20 ? A ASN 5 6 1 Y 1 A GLU 21 ? A GLU 6 7 1 Y 1 A SER 22 ? A SER 7 8 1 Y 1 A LYS 123 ? A LYS 108 9 1 Y 1 B SER 1 ? B SER 1 10 1 Y 1 B GLY 2 ? B GLY 2 11 1 Y 1 B ARG 3 ? B ARG 3 12 1 Y 1 B GLY 4 ? B GLY 4 13 1 Y 1 B BTK 5 ? B BTK 5 14 1 Y 1 B GLY 9 ? B GLY 9 15 1 Y 1 B LEU 10 ? B LEU 10 16 1 Y 1 B GLY 11 ? B GLY 11 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 BTK C C N N 74 BTK N N N N 75 BTK O O N N 76 BTK CA C N S 77 BTK CB C N N 78 BTK CD C N N 79 BTK CE C N N 80 BTK CG C N N 81 BTK NZ N N N 82 BTK CAA C N N 83 BTK OAD O N N 84 BTK CAF C N N 85 BTK CAJ C N N 86 BTK CAN C N N 87 BTK OXT O N N 88 BTK H H N N 89 BTK H2 H N N 90 BTK HA H N N 91 BTK HB2 H N N 92 BTK HB3 H N N 93 BTK HD2 H N N 94 BTK HD3 H N N 95 BTK HE2 H N N 96 BTK HE3 H N N 97 BTK HG2 H N N 98 BTK HG3 H N N 99 BTK HNZ H N N 100 BTK HAA H N N 101 BTK HAAA H N N 102 BTK HAAB H N N 103 BTK HAF H N N 104 BTK HAFA H N N 105 BTK HAJ H N N 106 BTK HAJA H N N 107 BTK HXT H N N 108 CYS N N N N 109 CYS CA C N R 110 CYS C C N N 111 CYS O O N N 112 CYS CB C N N 113 CYS SG S N N 114 CYS OXT O N N 115 CYS H H N N 116 CYS H2 H N N 117 CYS HA H N N 118 CYS HB2 H N N 119 CYS HB3 H N N 120 CYS HG H N N 121 CYS HXT H N N 122 GLN N N N N 123 GLN CA C N S 124 GLN C C N N 125 GLN O O N N 126 GLN CB C N N 127 GLN CG C N N 128 GLN CD C N N 129 GLN OE1 O N N 130 GLN NE2 N N N 131 GLN OXT O N N 132 GLN H H N N 133 GLN H2 H N N 134 GLN HA H N N 135 GLN HB2 H N N 136 GLN HB3 H N N 137 GLN HG2 H N N 138 GLN HG3 H N N 139 GLN HE21 H N N 140 GLN HE22 H N N 141 GLN HXT H N N 142 GLU N N N N 143 GLU CA C N S 144 GLU C C N N 145 GLU O O N N 146 GLU CB C N N 147 GLU CG C N N 148 GLU CD C N N 149 GLU OE1 O N N 150 GLU OE2 O N N 151 GLU OXT O N N 152 GLU H H N N 153 GLU H2 H N N 154 GLU HA H N N 155 GLU HB2 H N N 156 GLU HB3 H N N 157 GLU HG2 H N N 158 GLU HG3 H N N 159 GLU HE2 H N N 160 GLU HXT H N N 161 GLY N N N N 162 GLY CA C N N 163 GLY C C N N 164 GLY O O N N 165 GLY OXT O N N 166 GLY H H N N 167 GLY H2 H N N 168 GLY HA2 H N N 169 GLY HA3 H N N 170 GLY HXT H N N 171 HIS N N N N 172 HIS CA C N S 173 HIS C C N N 174 HIS O O N N 175 HIS CB C N N 176 HIS CG C Y N 177 HIS ND1 N Y N 178 HIS CD2 C Y N 179 HIS CE1 C Y N 180 HIS NE2 N Y N 181 HIS OXT O N N 182 HIS H H N N 183 HIS H2 H N N 184 HIS HA H N N 185 HIS HB2 H N N 186 HIS HB3 H N N 187 HIS HD1 H N N 188 HIS HD2 H N N 189 HIS HE1 H N N 190 HIS HE2 H N N 191 HIS HXT H N N 192 HOH O O N N 193 HOH H1 H N N 194 HOH H2 H N N 195 ILE N N N N 196 ILE CA C N S 197 ILE C C N N 198 ILE O O N N 199 ILE CB C N S 200 ILE CG1 C N N 201 ILE CG2 C N N 202 ILE CD1 C N N 203 ILE OXT O N N 204 ILE H H N N 205 ILE H2 H N N 206 ILE HA H N N 207 ILE HB H N N 208 ILE HG12 H N N 209 ILE HG13 H N N 210 ILE HG21 H N N 211 ILE HG22 H N N 212 ILE HG23 H N N 213 ILE HD11 H N N 214 ILE HD12 H N N 215 ILE HD13 H N N 216 ILE HXT H N N 217 LEU N N N N 218 LEU CA C N S 219 LEU C C N N 220 LEU O O N N 221 LEU CB C N N 222 LEU CG C N N 223 LEU CD1 C N N 224 LEU CD2 C N N 225 LEU OXT O N N 226 LEU H H N N 227 LEU H2 H N N 228 LEU HA H N N 229 LEU HB2 H N N 230 LEU HB3 H N N 231 LEU HG H N N 232 LEU HD11 H N N 233 LEU HD12 H N N 234 LEU HD13 H N N 235 LEU HD21 H N N 236 LEU HD22 H N N 237 LEU HD23 H N N 238 LEU HXT H N N 239 LYS N N N N 240 LYS CA C N S 241 LYS C C N N 242 LYS O O N N 243 LYS CB C N N 244 LYS CG C N N 245 LYS CD C N N 246 LYS CE C N N 247 LYS NZ N N N 248 LYS OXT O N N 249 LYS H H N N 250 LYS H2 H N N 251 LYS HA H N N 252 LYS HB2 H N N 253 LYS HB3 H N N 254 LYS HG2 H N N 255 LYS HG3 H N N 256 LYS HD2 H N N 257 LYS HD3 H N N 258 LYS HE2 H N N 259 LYS HE3 H N N 260 LYS HZ1 H N N 261 LYS HZ2 H N N 262 LYS HZ3 H N N 263 LYS HXT H N N 264 MET N N N N 265 MET CA C N S 266 MET C C N N 267 MET O O N N 268 MET CB C N N 269 MET CG C N N 270 MET SD S N N 271 MET CE C N N 272 MET OXT O N N 273 MET H H N N 274 MET H2 H N N 275 MET HA H N N 276 MET HB2 H N N 277 MET HB3 H N N 278 MET HG2 H N N 279 MET HG3 H N N 280 MET HE1 H N N 281 MET HE2 H N N 282 MET HE3 H N N 283 MET HXT H N N 284 PHE N N N N 285 PHE CA C N S 286 PHE C C N N 287 PHE O O N N 288 PHE CB C N N 289 PHE CG C Y N 290 PHE CD1 C Y N 291 PHE CD2 C Y N 292 PHE CE1 C Y N 293 PHE CE2 C Y N 294 PHE CZ C Y N 295 PHE OXT O N N 296 PHE H H N N 297 PHE H2 H N N 298 PHE HA H N N 299 PHE HB2 H N N 300 PHE HB3 H N N 301 PHE HD1 H N N 302 PHE HD2 H N N 303 PHE HE1 H N N 304 PHE HE2 H N N 305 PHE HZ H N N 306 PHE HXT H N N 307 PRO N N N N 308 PRO CA C N S 309 PRO C C N N 310 PRO O O N N 311 PRO CB C N N 312 PRO CG C N N 313 PRO CD C N N 314 PRO OXT O N N 315 PRO H H N N 316 PRO HA H N N 317 PRO HB2 H N N 318 PRO HB3 H N N 319 PRO HG2 H N N 320 PRO HG3 H N N 321 PRO HD2 H N N 322 PRO HD3 H N N 323 PRO HXT H N N 324 SER N N N N 325 SER CA C N S 326 SER C C N N 327 SER O O N N 328 SER CB C N N 329 SER OG O N N 330 SER OXT O N N 331 SER H H N N 332 SER H2 H N N 333 SER HA H N N 334 SER HB2 H N N 335 SER HB3 H N N 336 SER HG H N N 337 SER HXT H N N 338 THR N N N N 339 THR CA C N S 340 THR C C N N 341 THR O O N N 342 THR CB C N R 343 THR OG1 O N N 344 THR CG2 C N N 345 THR OXT O N N 346 THR H H N N 347 THR H2 H N N 348 THR HA H N N 349 THR HB H N N 350 THR HG1 H N N 351 THR HG21 H N N 352 THR HG22 H N N 353 THR HG23 H N N 354 THR HXT H N N 355 TYR N N N N 356 TYR CA C N S 357 TYR C C N N 358 TYR O O N N 359 TYR CB C N N 360 TYR CG C Y N 361 TYR CD1 C Y N 362 TYR CD2 C Y N 363 TYR CE1 C Y N 364 TYR CE2 C Y N 365 TYR CZ C Y N 366 TYR OH O N N 367 TYR OXT O N N 368 TYR H H N N 369 TYR H2 H N N 370 TYR HA H N N 371 TYR HB2 H N N 372 TYR HB3 H N N 373 TYR HD1 H N N 374 TYR HD2 H N N 375 TYR HE1 H N N 376 TYR HE2 H N N 377 TYR HH H N N 378 TYR HXT H N N 379 VAL N N N N 380 VAL CA C N S 381 VAL C C N N 382 VAL O O N N 383 VAL CB C N N 384 VAL CG1 C N N 385 VAL CG2 C N N 386 VAL OXT O N N 387 VAL H H N N 388 VAL H2 H N N 389 VAL HA H N N 390 VAL HB H N N 391 VAL HG11 H N N 392 VAL HG12 H N N 393 VAL HG13 H N N 394 VAL HG21 H N N 395 VAL HG22 H N N 396 VAL HG23 H N N 397 VAL HXT H N N 398 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 BTK C O doub N N 70 BTK C CA sing N N 71 BTK C OXT sing N N 72 BTK N CA sing N N 73 BTK N H sing N N 74 BTK N H2 sing N N 75 BTK CA CB sing N N 76 BTK CA HA sing N N 77 BTK CB CG sing N N 78 BTK CB HB2 sing N N 79 BTK CB HB3 sing N N 80 BTK CD CE sing N N 81 BTK CD CG sing N N 82 BTK CD HD2 sing N N 83 BTK CD HD3 sing N N 84 BTK CE NZ sing N N 85 BTK CE HE2 sing N N 86 BTK CE HE3 sing N N 87 BTK CG HG2 sing N N 88 BTK CG HG3 sing N N 89 BTK NZ CAN sing N N 90 BTK NZ HNZ sing N N 91 BTK CAA CAF sing N N 92 BTK CAA HAA sing N N 93 BTK CAA HAAA sing N N 94 BTK CAA HAAB sing N N 95 BTK OAD CAN doub N N 96 BTK CAF CAJ sing N N 97 BTK CAF HAF sing N N 98 BTK CAF HAFA sing N N 99 BTK CAJ CAN sing N N 100 BTK CAJ HAJ sing N N 101 BTK CAJ HAJA sing N N 102 BTK OXT HXT sing N N 103 CYS N CA sing N N 104 CYS N H sing N N 105 CYS N H2 sing N N 106 CYS CA C sing N N 107 CYS CA CB sing N N 108 CYS CA HA sing N N 109 CYS C O doub N N 110 CYS C OXT sing N N 111 CYS CB SG sing N N 112 CYS CB HB2 sing N N 113 CYS CB HB3 sing N N 114 CYS SG HG sing N N 115 CYS OXT HXT sing N N 116 GLN N CA sing N N 117 GLN N H sing N N 118 GLN N H2 sing N N 119 GLN CA C sing N N 120 GLN CA CB sing N N 121 GLN CA HA sing N N 122 GLN C O doub N N 123 GLN C OXT sing N N 124 GLN CB CG sing N N 125 GLN CB HB2 sing N N 126 GLN CB HB3 sing N N 127 GLN CG CD sing N N 128 GLN CG HG2 sing N N 129 GLN CG HG3 sing N N 130 GLN CD OE1 doub N N 131 GLN CD NE2 sing N N 132 GLN NE2 HE21 sing N N 133 GLN NE2 HE22 sing N N 134 GLN OXT HXT sing N N 135 GLU N CA sing N N 136 GLU N H sing N N 137 GLU N H2 sing N N 138 GLU CA C sing N N 139 GLU CA CB sing N N 140 GLU CA HA sing N N 141 GLU C O doub N N 142 GLU C OXT sing N N 143 GLU CB CG sing N N 144 GLU CB HB2 sing N N 145 GLU CB HB3 sing N N 146 GLU CG CD sing N N 147 GLU CG HG2 sing N N 148 GLU CG HG3 sing N N 149 GLU CD OE1 doub N N 150 GLU CD OE2 sing N N 151 GLU OE2 HE2 sing N N 152 GLU OXT HXT sing N N 153 GLY N CA sing N N 154 GLY N H sing N N 155 GLY N H2 sing N N 156 GLY CA C sing N N 157 GLY CA HA2 sing N N 158 GLY CA HA3 sing N N 159 GLY C O doub N N 160 GLY C OXT sing N N 161 GLY OXT HXT sing N N 162 HIS N CA sing N N 163 HIS N H sing N N 164 HIS N H2 sing N N 165 HIS CA C sing N N 166 HIS CA CB sing N N 167 HIS CA HA sing N N 168 HIS C O doub N N 169 HIS C OXT sing N N 170 HIS CB CG sing N N 171 HIS CB HB2 sing N N 172 HIS CB HB3 sing N N 173 HIS CG ND1 sing Y N 174 HIS CG CD2 doub Y N 175 HIS ND1 CE1 doub Y N 176 HIS ND1 HD1 sing N N 177 HIS CD2 NE2 sing Y N 178 HIS CD2 HD2 sing N N 179 HIS CE1 NE2 sing Y N 180 HIS CE1 HE1 sing N N 181 HIS NE2 HE2 sing N N 182 HIS OXT HXT sing N N 183 HOH O H1 sing N N 184 HOH O H2 sing N N 185 ILE N CA sing N N 186 ILE N H sing N N 187 ILE N H2 sing N N 188 ILE CA C sing N N 189 ILE CA CB sing N N 190 ILE CA HA sing N N 191 ILE C O doub N N 192 ILE C OXT sing N N 193 ILE CB CG1 sing N N 194 ILE CB CG2 sing N N 195 ILE CB HB sing N N 196 ILE CG1 CD1 sing N N 197 ILE CG1 HG12 sing N N 198 ILE CG1 HG13 sing N N 199 ILE CG2 HG21 sing N N 200 ILE CG2 HG22 sing N N 201 ILE CG2 HG23 sing N N 202 ILE CD1 HD11 sing N N 203 ILE CD1 HD12 sing N N 204 ILE CD1 HD13 sing N N 205 ILE OXT HXT sing N N 206 LEU N CA sing N N 207 LEU N H sing N N 208 LEU N H2 sing N N 209 LEU CA C sing N N 210 LEU CA CB sing N N 211 LEU CA HA sing N N 212 LEU C O doub N N 213 LEU C OXT sing N N 214 LEU CB CG sing N N 215 LEU CB HB2 sing N N 216 LEU CB HB3 sing N N 217 LEU CG CD1 sing N N 218 LEU CG CD2 sing N N 219 LEU CG HG sing N N 220 LEU CD1 HD11 sing N N 221 LEU CD1 HD12 sing N N 222 LEU CD1 HD13 sing N N 223 LEU CD2 HD21 sing N N 224 LEU CD2 HD22 sing N N 225 LEU CD2 HD23 sing N N 226 LEU OXT HXT sing N N 227 LYS N CA sing N N 228 LYS N H sing N N 229 LYS N H2 sing N N 230 LYS CA C sing N N 231 LYS CA CB sing N N 232 LYS CA HA sing N N 233 LYS C O doub N N 234 LYS C OXT sing N N 235 LYS CB CG sing N N 236 LYS CB HB2 sing N N 237 LYS CB HB3 sing N N 238 LYS CG CD sing N N 239 LYS CG HG2 sing N N 240 LYS CG HG3 sing N N 241 LYS CD CE sing N N 242 LYS CD HD2 sing N N 243 LYS CD HD3 sing N N 244 LYS CE NZ sing N N 245 LYS CE HE2 sing N N 246 LYS CE HE3 sing N N 247 LYS NZ HZ1 sing N N 248 LYS NZ HZ2 sing N N 249 LYS NZ HZ3 sing N N 250 LYS OXT HXT sing N N 251 MET N CA sing N N 252 MET N H sing N N 253 MET N H2 sing N N 254 MET CA C sing N N 255 MET CA CB sing N N 256 MET CA HA sing N N 257 MET C O doub N N 258 MET C OXT sing N N 259 MET CB CG sing N N 260 MET CB HB2 sing N N 261 MET CB HB3 sing N N 262 MET CG SD sing N N 263 MET CG HG2 sing N N 264 MET CG HG3 sing N N 265 MET SD CE sing N N 266 MET CE HE1 sing N N 267 MET CE HE2 sing N N 268 MET CE HE3 sing N N 269 MET OXT HXT sing N N 270 PHE N CA sing N N 271 PHE N H sing N N 272 PHE N H2 sing N N 273 PHE CA C sing N N 274 PHE CA CB sing N N 275 PHE CA HA sing N N 276 PHE C O doub N N 277 PHE C OXT sing N N 278 PHE CB CG sing N N 279 PHE CB HB2 sing N N 280 PHE CB HB3 sing N N 281 PHE CG CD1 doub Y N 282 PHE CG CD2 sing Y N 283 PHE CD1 CE1 sing Y N 284 PHE CD1 HD1 sing N N 285 PHE CD2 CE2 doub Y N 286 PHE CD2 HD2 sing N N 287 PHE CE1 CZ doub Y N 288 PHE CE1 HE1 sing N N 289 PHE CE2 CZ sing Y N 290 PHE CE2 HE2 sing N N 291 PHE CZ HZ sing N N 292 PHE OXT HXT sing N N 293 PRO N CA sing N N 294 PRO N CD sing N N 295 PRO N H sing N N 296 PRO CA C sing N N 297 PRO CA CB sing N N 298 PRO CA HA sing N N 299 PRO C O doub N N 300 PRO C OXT sing N N 301 PRO CB CG sing N N 302 PRO CB HB2 sing N N 303 PRO CB HB3 sing N N 304 PRO CG CD sing N N 305 PRO CG HG2 sing N N 306 PRO CG HG3 sing N N 307 PRO CD HD2 sing N N 308 PRO CD HD3 sing N N 309 PRO OXT HXT sing N N 310 SER N CA sing N N 311 SER N H sing N N 312 SER N H2 sing N N 313 SER CA C sing N N 314 SER CA CB sing N N 315 SER CA HA sing N N 316 SER C O doub N N 317 SER C OXT sing N N 318 SER CB OG sing N N 319 SER CB HB2 sing N N 320 SER CB HB3 sing N N 321 SER OG HG sing N N 322 SER OXT HXT sing N N 323 THR N CA sing N N 324 THR N H sing N N 325 THR N H2 sing N N 326 THR CA C sing N N 327 THR CA CB sing N N 328 THR CA HA sing N N 329 THR C O doub N N 330 THR C OXT sing N N 331 THR CB OG1 sing N N 332 THR CB CG2 sing N N 333 THR CB HB sing N N 334 THR OG1 HG1 sing N N 335 THR CG2 HG21 sing N N 336 THR CG2 HG22 sing N N 337 THR CG2 HG23 sing N N 338 THR OXT HXT sing N N 339 TYR N CA sing N N 340 TYR N H sing N N 341 TYR N H2 sing N N 342 TYR CA C sing N N 343 TYR CA CB sing N N 344 TYR CA HA sing N N 345 TYR C O doub N N 346 TYR C OXT sing N N 347 TYR CB CG sing N N 348 TYR CB HB2 sing N N 349 TYR CB HB3 sing N N 350 TYR CG CD1 doub Y N 351 TYR CG CD2 sing Y N 352 TYR CD1 CE1 sing Y N 353 TYR CD1 HD1 sing N N 354 TYR CD2 CE2 doub Y N 355 TYR CD2 HD2 sing N N 356 TYR CE1 CZ doub Y N 357 TYR CE1 HE1 sing N N 358 TYR CE2 CZ sing Y N 359 TYR CE2 HE2 sing N N 360 TYR CZ OH sing N N 361 TYR OH HH sing N N 362 TYR OXT HXT sing N N 363 VAL N CA sing N N 364 VAL N H sing N N 365 VAL N H2 sing N N 366 VAL CA C sing N N 367 VAL CA CB sing N N 368 VAL CA HA sing N N 369 VAL C O doub N N 370 VAL C OXT sing N N 371 VAL CB CG1 sing N N 372 VAL CB CG2 sing N N 373 VAL CB HB sing N N 374 VAL CG1 HG11 sing N N 375 VAL CG1 HG12 sing N N 376 VAL CG1 HG13 sing N N 377 VAL CG2 HG21 sing N N 378 VAL CG2 HG22 sing N N 379 VAL CG2 HG23 sing N N 380 VAL OXT HXT sing N N 381 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3HME _pdbx_initial_refinement_model.details 'PDB entry 3HME' #