data_4ZGI # _entry.id 4ZGI # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.397 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4ZGI pdb_00004zgi 10.2210/pdb4zgi/pdb WWPDB D_1000207733 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-10-14 2 'Structure model' 1 1 2015-10-28 3 'Structure model' 1 2 2024-10-23 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 3 'Structure model' 'Structure summary' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' citation 4 3 'Structure model' database_2 5 3 'Structure model' pdbx_entry_details 6 3 'Structure model' pdbx_modification_feature 7 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_database_2.pdbx_DOI' 3 3 'Structure model' '_database_2.pdbx_database_accession' 4 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 4ZGI _pdbx_database_status.recvd_initial_deposition_date 2015-04-23 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site RCSB _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'complexed with phospho-threonine' _pdbx_database_related.db_id 4YM4 _pdbx_database_related.content_type unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Weng, J.H.' 1 'Wei, T.Y.W.' 2 'Hsieh, Y.C.' 3 'Huang, C.C.F.' 4 'Wu, P.Y.G.' 5 'Chen, E.S.W.' 6 'Huang, K.F.' 7 'Chen, C.J.' 8 'Tsai, M.D.' 9 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Biochemistry _citation.journal_id_ASTM BICHAW _citation.journal_id_CSD 0033 _citation.journal_id_ISSN 0006-2960 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 54 _citation.language ? _citation.page_first 6219 _citation.page_last 6229 _citation.title 'Uncovering the Mechanism of Forkhead-Associated Domain-Mediated TIFA Oligomerization That Plays a Central Role in Immune Responses.' _citation.year 2015 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1021/acs.biochem.5b00500 _citation.pdbx_database_id_PubMed 26389808 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Weng, J.H.' 1 ? primary 'Hsieh, Y.C.' 2 ? primary 'Huang, C.C.' 3 ? primary 'Wei, T.Y.' 4 ? primary 'Lim, L.H.' 5 ? primary 'Chen, Y.H.' 6 ? primary 'Ho, M.R.' 7 ? primary 'Wang, I.' 8 ? primary 'Huang, K.F.' 9 ? primary 'Chen, C.J.' 10 ? primary 'Tsai, M.D.' 11 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'TRAF-interacting protein with FHA domain-containing protein A' 16720.404 1 ? ? 'UNP RESIDUES 10-149' ? 2 water nat water 18.015 8 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Putative MAPK-activating protein PM14,Putative NF-kappa-B-activating protein 20,TRAF2-binding protein' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;EETVTCLQ(MSE)TVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSF EIKN(MSE)SKKTNLIVDSRELGYLNK(MSE)DLPYRC(MSE)VRFGEYQFL(MSE)EKEDGESLEFFETQFILSPRSLL ; _entity_poly.pdbx_seq_one_letter_code_can ;EETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKN MSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQFILSPRSLL ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLU n 1 2 GLU n 1 3 THR n 1 4 VAL n 1 5 THR n 1 6 CYS n 1 7 LEU n 1 8 GLN n 1 9 MSE n 1 10 THR n 1 11 VAL n 1 12 TYR n 1 13 HIS n 1 14 PRO n 1 15 GLY n 1 16 GLN n 1 17 LEU n 1 18 GLN n 1 19 CYS n 1 20 GLY n 1 21 ILE n 1 22 PHE n 1 23 GLN n 1 24 SER n 1 25 ILE n 1 26 SER n 1 27 PHE n 1 28 ASN n 1 29 ARG n 1 30 GLU n 1 31 LYS n 1 32 LEU n 1 33 PRO n 1 34 SER n 1 35 SER n 1 36 GLU n 1 37 VAL n 1 38 VAL n 1 39 LYS n 1 40 PHE n 1 41 GLY n 1 42 ARG n 1 43 ASN n 1 44 SER n 1 45 ASN n 1 46 ILE n 1 47 CYS n 1 48 HIS n 1 49 TYR n 1 50 THR n 1 51 PHE n 1 52 GLN n 1 53 ASP n 1 54 LYS n 1 55 GLN n 1 56 VAL n 1 57 SER n 1 58 ARG n 1 59 VAL n 1 60 GLN n 1 61 PHE n 1 62 SER n 1 63 LEU n 1 64 GLN n 1 65 LEU n 1 66 PHE n 1 67 LYS n 1 68 LYS n 1 69 PHE n 1 70 ASN n 1 71 SER n 1 72 SER n 1 73 VAL n 1 74 LEU n 1 75 SER n 1 76 PHE n 1 77 GLU n 1 78 ILE n 1 79 LYS n 1 80 ASN n 1 81 MSE n 1 82 SER n 1 83 LYS n 1 84 LYS n 1 85 THR n 1 86 ASN n 1 87 LEU n 1 88 ILE n 1 89 VAL n 1 90 ASP n 1 91 SER n 1 92 ARG n 1 93 GLU n 1 94 LEU n 1 95 GLY n 1 96 TYR n 1 97 LEU n 1 98 ASN n 1 99 LYS n 1 100 MSE n 1 101 ASP n 1 102 LEU n 1 103 PRO n 1 104 TYR n 1 105 ARG n 1 106 CYS n 1 107 MSE n 1 108 VAL n 1 109 ARG n 1 110 PHE n 1 111 GLY n 1 112 GLU n 1 113 TYR n 1 114 GLN n 1 115 PHE n 1 116 LEU n 1 117 MSE n 1 118 GLU n 1 119 LYS n 1 120 GLU n 1 121 ASP n 1 122 GLY n 1 123 GLU n 1 124 SER n 1 125 LEU n 1 126 GLU n 1 127 PHE n 1 128 PHE n 1 129 GLU n 1 130 THR n 1 131 GLN n 1 132 PHE n 1 133 ILE n 1 134 LEU n 1 135 SER n 1 136 PRO n 1 137 ARG n 1 138 SER n 1 139 LEU n 1 140 LEU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 140 _entity_src_gen.gene_src_common_name Human _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'TIFA, T2BP' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type plasmid _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET43.1 _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLU 1 10 10 GLU GLU A . n A 1 2 GLU 2 11 11 GLU GLU A . n A 1 3 THR 3 12 12 THR THR A . n A 1 4 VAL 4 13 13 VAL VAL A . n A 1 5 THR 5 14 14 THR THR A . n A 1 6 CYS 6 15 15 CYS CYS A . n A 1 7 LEU 7 16 16 LEU LEU A . n A 1 8 GLN 8 17 17 GLN GLN A . n A 1 9 MSE 9 18 18 MSE MSE A . n A 1 10 THR 10 19 19 THR THR A . n A 1 11 VAL 11 20 20 VAL VAL A . n A 1 12 TYR 12 21 21 TYR TYR A . n A 1 13 HIS 13 22 22 HIS HIS A . n A 1 14 PRO 14 23 23 PRO PRO A . n A 1 15 GLY 15 24 24 GLY GLY A . n A 1 16 GLN 16 25 25 GLN GLN A . n A 1 17 LEU 17 26 26 LEU LEU A . n A 1 18 GLN 18 27 27 GLN GLN A . n A 1 19 CYS 19 28 28 CYS CYS A . n A 1 20 GLY 20 29 29 GLY GLY A . n A 1 21 ILE 21 30 30 ILE ILE A . n A 1 22 PHE 22 31 31 PHE PHE A . n A 1 23 GLN 23 32 32 GLN GLN A . n A 1 24 SER 24 33 33 SER SER A . n A 1 25 ILE 25 34 34 ILE ILE A . n A 1 26 SER 26 35 35 SER SER A . n A 1 27 PHE 27 36 36 PHE PHE A . n A 1 28 ASN 28 37 37 ASN ASN A . n A 1 29 ARG 29 38 38 ARG ARG A . n A 1 30 GLU 30 39 39 GLU GLU A . n A 1 31 LYS 31 40 40 LYS LYS A . n A 1 32 LEU 32 41 41 LEU LEU A . n A 1 33 PRO 33 42 42 PRO PRO A . n A 1 34 SER 34 43 43 SER SER A . n A 1 35 SER 35 44 44 SER SER A . n A 1 36 GLU 36 45 45 GLU GLU A . n A 1 37 VAL 37 46 46 VAL VAL A . n A 1 38 VAL 38 47 47 VAL VAL A . n A 1 39 LYS 39 48 48 LYS LYS A . n A 1 40 PHE 40 49 49 PHE PHE A . n A 1 41 GLY 41 50 50 GLY GLY A . n A 1 42 ARG 42 51 51 ARG ARG A . n A 1 43 ASN 43 52 52 ASN ASN A . n A 1 44 SER 44 53 53 SER SER A . n A 1 45 ASN 45 54 54 ASN ASN A . n A 1 46 ILE 46 55 55 ILE ILE A . n A 1 47 CYS 47 56 56 CYS CYS A . n A 1 48 HIS 48 57 57 HIS HIS A . n A 1 49 TYR 49 58 58 TYR TYR A . n A 1 50 THR 50 59 59 THR THR A . n A 1 51 PHE 51 60 60 PHE PHE A . n A 1 52 GLN 52 61 61 GLN GLN A . n A 1 53 ASP 53 62 62 ASP ASP A . n A 1 54 LYS 54 63 63 LYS LYS A . n A 1 55 GLN 55 64 64 GLN GLN A . n A 1 56 VAL 56 65 65 VAL VAL A . n A 1 57 SER 57 66 66 SER SER A . n A 1 58 ARG 58 67 67 ARG ARG A . n A 1 59 VAL 59 68 68 VAL VAL A . n A 1 60 GLN 60 69 69 GLN GLN A . n A 1 61 PHE 61 70 70 PHE PHE A . n A 1 62 SER 62 71 71 SER SER A . n A 1 63 LEU 63 72 72 LEU LEU A . n A 1 64 GLN 64 73 73 GLN GLN A . n A 1 65 LEU 65 74 74 LEU LEU A . n A 1 66 PHE 66 75 75 PHE PHE A . n A 1 67 LYS 67 76 76 LYS LYS A . n A 1 68 LYS 68 77 77 LYS LYS A . n A 1 69 PHE 69 78 78 PHE PHE A . n A 1 70 ASN 70 79 79 ASN ASN A . n A 1 71 SER 71 80 80 SER SER A . n A 1 72 SER 72 81 81 SER SER A . n A 1 73 VAL 73 82 82 VAL VAL A . n A 1 74 LEU 74 83 83 LEU LEU A . n A 1 75 SER 75 84 84 SER SER A . n A 1 76 PHE 76 85 85 PHE PHE A . n A 1 77 GLU 77 86 86 GLU GLU A . n A 1 78 ILE 78 87 87 ILE ILE A . n A 1 79 LYS 79 88 88 LYS LYS A . n A 1 80 ASN 80 89 89 ASN ASN A . n A 1 81 MSE 81 90 90 MSE MSE A . n A 1 82 SER 82 91 91 SER SER A . n A 1 83 LYS 83 92 92 LYS LYS A . n A 1 84 LYS 84 93 93 LYS LYS A . n A 1 85 THR 85 94 94 THR THR A . n A 1 86 ASN 86 95 95 ASN ASN A . n A 1 87 LEU 87 96 96 LEU LEU A . n A 1 88 ILE 88 97 97 ILE ILE A . n A 1 89 VAL 89 98 98 VAL VAL A . n A 1 90 ASP 90 99 99 ASP ASP A . n A 1 91 SER 91 100 100 SER SER A . n A 1 92 ARG 92 101 101 ARG ARG A . n A 1 93 GLU 93 102 102 GLU GLU A . n A 1 94 LEU 94 103 103 LEU LEU A . n A 1 95 GLY 95 104 104 GLY GLY A . n A 1 96 TYR 96 105 105 TYR TYR A . n A 1 97 LEU 97 106 106 LEU LEU A . n A 1 98 ASN 98 107 107 ASN ASN A . n A 1 99 LYS 99 108 108 LYS LYS A . n A 1 100 MSE 100 109 109 MSE MSE A . n A 1 101 ASP 101 110 110 ASP ASP A . n A 1 102 LEU 102 111 111 LEU LEU A . n A 1 103 PRO 103 112 112 PRO PRO A . n A 1 104 TYR 104 113 113 TYR TYR A . n A 1 105 ARG 105 114 114 ARG ARG A . n A 1 106 CYS 106 115 115 CYS CYS A . n A 1 107 MSE 107 116 116 MSE MSE A . n A 1 108 VAL 108 117 117 VAL VAL A . n A 1 109 ARG 109 118 118 ARG ARG A . n A 1 110 PHE 110 119 119 PHE PHE A . n A 1 111 GLY 111 120 120 GLY GLY A . n A 1 112 GLU 112 121 121 GLU GLU A . n A 1 113 TYR 113 122 122 TYR TYR A . n A 1 114 GLN 114 123 123 GLN GLN A . n A 1 115 PHE 115 124 124 PHE PHE A . n A 1 116 LEU 116 125 125 LEU LEU A . n A 1 117 MSE 117 126 126 MSE MSE A . n A 1 118 GLU 118 127 127 GLU GLU A . n A 1 119 LYS 119 128 128 LYS LYS A . n A 1 120 GLU 120 129 129 GLU GLU A . n A 1 121 ASP 121 130 130 ASP ASP A . n A 1 122 GLY 122 131 131 GLY GLY A . n A 1 123 GLU 123 132 132 GLU GLU A . n A 1 124 SER 124 133 133 SER SER A . n A 1 125 LEU 125 134 134 LEU LEU A . n A 1 126 GLU 126 135 135 GLU GLU A . n A 1 127 PHE 127 136 136 PHE PHE A . n A 1 128 PHE 128 137 137 PHE PHE A . n A 1 129 GLU 129 138 138 GLU GLU A . n A 1 130 THR 130 139 139 THR THR A . n A 1 131 GLN 131 140 140 GLN GLN A . n A 1 132 PHE 132 141 141 PHE PHE A . n A 1 133 ILE 133 142 142 ILE ILE A . n A 1 134 LEU 134 143 143 LEU LEU A . n A 1 135 SER 135 144 144 SER SER A . n A 1 136 PRO 136 145 145 PRO PRO A . n A 1 137 ARG 137 146 146 ARG ARG A . n A 1 138 SER 138 147 147 SER SER A . n A 1 139 LEU 139 148 148 LEU LEU A . n A 1 140 LEU 140 149 149 LEU LEU A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 201 10 HOH HOH A . B 2 HOH 2 202 1 HOH HOH A . B 2 HOH 3 203 11 HOH HOH A . B 2 HOH 4 204 6 HOH HOH A . B 2 HOH 5 205 15 HOH HOH A . B 2 HOH 6 206 8 HOH HOH A . B 2 HOH 7 207 14 HOH HOH A . B 2 HOH 8 208 12 HOH HOH A . # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 1 ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.8.4_1496 2 ? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15 3 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 5 # _cell.angle_alpha 90.000 _cell.angle_alpha_esd ? _cell.angle_beta 90.000 _cell.angle_beta_esd ? _cell.angle_gamma 120.000 _cell.angle_gamma_esd ? _cell.entry_id 4ZGI _cell.details ? _cell.formula_units_Z ? _cell.length_a 39.009 _cell.length_a_esd ? _cell.length_b 39.009 _cell.length_b_esd ? _cell.length_c 178.459 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 4ZGI _symmetry.cell_setting ? _symmetry.Int_Tables_number 154 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 32 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 4ZGI _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.34 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 47.53 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '80mM LiCl, 0.2M trimethylamine N-oxide, 15% PEG 3350, 100mM HEPES' _exptl_crystal_grow.pdbx_pH_range 6.5-7.5 # _diffrn.ambient_environment ? _diffrn.ambient_temp 110 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2014-10-26 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol MAD _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # loop_ _diffrn_radiation_wavelength.id _diffrn_radiation_wavelength.wavelength _diffrn_radiation_wavelength.wt 1 0.9791 1.0 2 0.9640 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSRRC BEAMLINE BL13B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list '0.9791, 0.9640' _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL13B1 _diffrn_source.pdbx_synchrotron_site NSRRC # _reflns.B_iso_Wilson_estimate 37.770 _reflns.entry_id 4ZGI _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.700 _reflns.d_resolution_low 20.000 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 4730 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.300 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 8.800 _reflns.pdbx_Rmerge_I_obs 0.064 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI 29.857 _reflns.pdbx_netI_over_sigmaI 9.800 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared 0.859 _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all 0.068 _reflns.pdbx_Rpim_I_all 0.023 _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all 41786 _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # loop_ _reflns_shell.d_res_high _reflns_shell.d_res_low _reflns_shell.meanI_over_sigI_all _reflns_shell.meanI_over_sigI_obs _reflns_shell.number_measured_all _reflns_shell.number_measured_obs _reflns_shell.number_possible _reflns_shell.number_unique_all _reflns_shell.number_unique_obs _reflns_shell.percent_possible_all _reflns_shell.percent_possible_obs _reflns_shell.Rmerge_F_all _reflns_shell.Rmerge_F_obs _reflns_shell.Rmerge_I_all _reflns_shell.Rmerge_I_obs _reflns_shell.meanI_over_sigI_gt _reflns_shell.meanI_over_uI_all _reflns_shell.meanI_over_uI_gt _reflns_shell.number_measured_gt _reflns_shell.number_unique_gt _reflns_shell.percent_possible_gt _reflns_shell.Rmerge_F_gt _reflns_shell.Rmerge_I_gt _reflns_shell.pdbx_redundancy _reflns_shell.pdbx_Rsym_value _reflns_shell.pdbx_chi_squared _reflns_shell.pdbx_netI_over_sigmaI_all _reflns_shell.pdbx_netI_over_sigmaI_obs _reflns_shell.pdbx_Rrim_I_all _reflns_shell.pdbx_Rpim_I_all _reflns_shell.pdbx_rejects _reflns_shell.pdbx_ordinal _reflns_shell.pdbx_diffrn_id _reflns_shell.pdbx_CC_half _reflns_shell.pdbx_R_split 2.700 2.800 ? ? ? ? ? 457 ? 96.600 ? ? ? ? 0.548 ? ? ? ? ? ? ? ? 6.400 ? 0.765 ? ? 0.596 0.224 0 1 1 0.918 ? 2.800 2.910 ? ? ? ? ? 439 ? 98.700 ? ? ? ? 0.416 ? ? ? ? ? ? ? ? 7.900 ? 0.744 ? ? 0.445 0.154 0 2 1 0.970 ? 2.910 3.040 ? ? ? ? ? 463 ? 98.100 ? ? ? ? 0.384 ? ? ? ? ? ? ? ? 8.900 ? 0.777 ? ? 0.407 0.134 0 3 1 0.985 ? 3.040 3.200 ? ? ? ? ? 465 ? 98.700 ? ? ? ? 0.260 ? ? ? ? ? ? ? ? 9.600 ? 0.864 ? ? 0.274 0.087 0 4 1 0.991 ? 3.200 3.400 ? ? ? ? ? 447 ? 98.700 ? ? ? ? 0.179 ? ? ? ? ? ? ? ? 9.700 ? 0.936 ? ? 0.189 0.060 0 5 1 0.994 ? 3.400 3.660 ? ? ? ? ? 474 ? 98.800 ? ? ? ? 0.115 ? ? ? ? ? ? ? ? 9.700 ? 1.010 ? ? 0.122 0.039 0 6 1 0.996 ? 3.660 4.030 ? ? ? ? ? 465 ? 99.100 ? ? ? ? 0.071 ? ? ? ? ? ? ? ? 9.600 ? 0.937 ? ? 0.075 0.025 0 7 1 0.998 ? 4.030 4.600 ? ? ? ? ? 478 ? 98.800 ? ? ? ? 0.048 ? ? ? ? ? ? ? ? 9.500 ? 0.898 ? ? 0.051 0.016 0 8 1 0.998 ? 4.600 5.770 ? ? ? ? ? 503 ? 98.400 ? ? ? ? 0.040 ? ? ? ? ? ? ? ? 9.000 ? 0.918 ? ? 0.042 0.014 0 9 1 0.998 ? 5.770 20.000 ? ? ? ? ? 539 ? 96.900 ? ? ? ? 0.025 ? ? ? ? ? ? ? ? 8.000 ? 0.654 ? ? 0.026 0.009 0 10 1 0.999 ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max 89.630 _refine.B_iso_mean 40.6200 _refine.B_iso_min 16.710 _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 4ZGI _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.7010 _refine.ls_d_res_low 19.8290 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 3602 _refine.ls_number_reflns_R_free 694 _refine.ls_number_reflns_R_work 6299 _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 84.0200 _refine.ls_percent_reflns_R_free 9.9200 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2300 _refine.ls_R_factor_R_free 0.2644 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2263 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.360 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.1100 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.9000 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 25.2200 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.3700 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set 0.7958 _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.cycle_id final _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.d_res_high 2.7010 _refine_hist.d_res_low 19.8290 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 8 _refine_hist.number_atoms_total 1163 _refine_hist.pdbx_number_residues_total 140 _refine_hist.pdbx_B_iso_mean_solvent 33.09 _refine_hist.pdbx_number_atoms_protein 1155 _refine_hist.pdbx_number_atoms_nucleic_acid 0 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.012 ? 1178 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 1.165 ? 1579 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.057 ? 170 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.006 ? 203 ? f_plane_restr ? ? 'X-RAY DIFFRACTION' ? 19.051 ? 450 ? f_dihedral_angle_d ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.7013 2.9093 714 . 74 640 43.0000 . . . 0.2999 . 0.3026 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 2.9093 3.2010 1341 . 144 1197 80.0000 . . . 0.3416 . 0.2969 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.2010 3.6616 1623 . 146 1477 99.0000 . . . 0.3044 . 0.2419 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 3.6616 4.6037 1645 . 168 1477 100.0000 . . . 0.2322 . 0.1999 . . . . . . 5 . . . 'X-RAY DIFFRACTION' 4.6037 19.8293 1670 . 162 1508 99.0000 . . . 0.2286 . 0.2019 . . . . . . 5 . . . # _struct.entry_id 4ZGI _struct.title 'Structure of Truncated Human TIFA' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 4ZGI _struct_keywords.text 'FHA domian, adaptor, SIGNALING PROTEIN' _struct_keywords.pdbx_keywords 'SIGNALING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code TIFA_HUMAN _struct_ref.pdbx_db_accession Q96CG3 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;EETVTCLQMTVYHPGQLQCGIFQSISFNREKLPSSEVVKFGRNSNICHYTFQDKQVSRVQFSLQLFKKFNSSVLSFEIKN MSKKTNLIVDSRELGYLNKMDLPYRCMVRFGEYQFLMEKEDGESLEFFETQFILSPRSLL ; _struct_ref.pdbx_align_begin 10 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4ZGI _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 140 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q96CG3 _struct_ref_seq.db_align_beg 10 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 149 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 10 _struct_ref_seq.pdbx_auth_seq_align_end 149 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 1820 ? 1 MORE -2 ? 1 'SSA (A^2)' 13510 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 6_555 -x,-x+y,-z+2/3 -0.5000000000 -0.8660254038 0.0000000000 0.0000000000 -0.8660254038 0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 118.9726666667 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id AA1 _struct_conf.beg_label_comp_id HIS _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 13 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id GLN _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 18 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id HIS _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 22 _struct_conf.end_auth_comp_id GLN _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 27 _struct_conf.pdbx_PDB_helix_class 5 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 6 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role covale1 covale both ? A GLN 8 C ? ? ? 1_555 A MSE 9 N ? ? A GLN 17 A MSE 18 1_555 ? ? ? ? ? ? ? 1.317 ? ? covale2 covale both ? A MSE 9 C ? ? ? 1_555 A THR 10 N ? ? A MSE 18 A THR 19 1_555 ? ? ? ? ? ? ? 1.311 ? ? covale3 covale both ? A ASN 80 C ? ? ? 1_555 A MSE 81 N ? ? A ASN 89 A MSE 90 1_555 ? ? ? ? ? ? ? 1.311 ? ? covale4 covale both ? A MSE 81 C ? ? ? 1_555 A SER 82 N ? ? A MSE 90 A SER 91 1_555 ? ? ? ? ? ? ? 1.309 ? ? covale5 covale both ? A LYS 99 C ? ? ? 1_555 A MSE 100 N ? ? A LYS 108 A MSE 109 1_555 ? ? ? ? ? ? ? 1.316 ? ? covale6 covale both ? A MSE 100 C ? ? ? 1_555 A ASP 101 N ? ? A MSE 109 A ASP 110 1_555 ? ? ? ? ? ? ? 1.318 ? ? covale7 covale both ? A CYS 106 C ? ? ? 1_555 A MSE 107 N ? ? A CYS 115 A MSE 116 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale8 covale both ? A MSE 107 C ? ? ? 1_555 A VAL 108 N ? ? A MSE 116 A VAL 117 1_555 ? ? ? ? ? ? ? 1.332 ? ? covale9 covale both ? A LEU 116 C ? ? ? 1_555 A MSE 117 N ? ? A LEU 125 A MSE 126 1_555 ? ? ? ? ? ? ? 1.329 ? ? covale10 covale both ? A MSE 117 C ? ? ? 1_555 A GLU 118 N ? ? A MSE 126 A GLU 127 1_555 ? ? ? ? ? ? ? 1.333 ? ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_modification_feature.ordinal _pdbx_modification_feature.label_comp_id _pdbx_modification_feature.label_asym_id _pdbx_modification_feature.label_seq_id _pdbx_modification_feature.label_alt_id _pdbx_modification_feature.modified_residue_label_comp_id _pdbx_modification_feature.modified_residue_label_asym_id _pdbx_modification_feature.modified_residue_label_seq_id _pdbx_modification_feature.modified_residue_label_alt_id _pdbx_modification_feature.auth_comp_id _pdbx_modification_feature.auth_asym_id _pdbx_modification_feature.auth_seq_id _pdbx_modification_feature.PDB_ins_code _pdbx_modification_feature.symmetry _pdbx_modification_feature.modified_residue_auth_comp_id _pdbx_modification_feature.modified_residue_auth_asym_id _pdbx_modification_feature.modified_residue_auth_seq_id _pdbx_modification_feature.modified_residue_PDB_ins_code _pdbx_modification_feature.modified_residue_symmetry _pdbx_modification_feature.comp_id_linking_atom _pdbx_modification_feature.modified_residue_id_linking_atom _pdbx_modification_feature.modified_residue_id _pdbx_modification_feature.ref_pcm_id _pdbx_modification_feature.ref_comp_id _pdbx_modification_feature.type _pdbx_modification_feature.category 1 MSE A 9 ? . . . . MSE A 18 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 2 MSE A 81 ? . . . . MSE A 90 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 3 MSE A 100 ? . . . . MSE A 109 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 4 MSE A 107 ? . . . . MSE A 116 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' 5 MSE A 117 ? . . . . MSE A 126 ? 1_555 . . . . . . . MET 1 MSE Selenomethionine 'Named protein modification' # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 7 ? AA2 ? 5 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA1 5 6 ? anti-parallel AA1 6 7 ? anti-parallel AA2 1 2 ? parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 ARG A 29 ? PRO A 33 ? ARG A 38 PRO A 42 AA1 2 PHE A 127 ? LEU A 134 ? PHE A 136 LEU A 143 AA1 3 THR A 5 ? TYR A 12 ? THR A 14 TYR A 21 AA1 4 TYR A 113 ? GLU A 120 ? TYR A 122 GLU A 129 AA1 5 ARG A 105 ? PHE A 110 ? ARG A 114 PHE A 119 AA1 6 LEU A 87 ? VAL A 89 ? LEU A 96 VAL A 98 AA1 7 ARG A 92 ? LEU A 94 ? ARG A 101 LEU A 103 AA2 1 TYR A 49 ? THR A 50 ? TYR A 58 THR A 59 AA2 2 VAL A 38 ? GLY A 41 ? VAL A 47 GLY A 50 AA2 3 PHE A 61 ? LYS A 67 ? PHE A 70 LYS A 76 AA2 4 LEU A 74 ? ASN A 80 ? LEU A 83 ASN A 89 AA2 5 LYS A 99 ? ASP A 101 ? LYS A 108 ASP A 110 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 32 ? N LEU A 41 O PHE A 128 ? O PHE A 137 AA1 2 3 O GLU A 129 ? O GLU A 138 N THR A 5 ? N THR A 14 AA1 3 4 N GLN A 8 ? N GLN A 17 O GLU A 118 ? O GLU A 127 AA1 4 5 O PHE A 115 ? O PHE A 124 N VAL A 108 ? N VAL A 117 AA1 5 6 O ARG A 109 ? O ARG A 118 N ILE A 88 ? N ILE A 97 AA1 6 7 N LEU A 87 ? N LEU A 96 O LEU A 94 ? O LEU A 103 AA2 1 2 O TYR A 49 ? O TYR A 58 N LYS A 39 ? N LYS A 48 AA2 2 3 N PHE A 40 ? N PHE A 49 O PHE A 61 ? O PHE A 70 AA2 3 4 N PHE A 66 ? N PHE A 75 O SER A 75 ? O SER A 84 AA2 4 5 N ILE A 78 ? N ILE A 87 O MSE A 100 ? O MSE A 109 # _pdbx_entry_details.entry_id 4ZGI _pdbx_entry_details.compound_details ? _pdbx_entry_details.source_details ? _pdbx_entry_details.nonpolymer_details ? _pdbx_entry_details.sequence_details ? _pdbx_entry_details.has_ligand_of_interest ? _pdbx_entry_details.has_protein_modification Y # _pdbx_validate_close_contact.id 1 _pdbx_validate_close_contact.PDB_model_num 1 _pdbx_validate_close_contact.auth_atom_id_1 OE1 _pdbx_validate_close_contact.auth_asym_id_1 A _pdbx_validate_close_contact.auth_comp_id_1 GLU _pdbx_validate_close_contact.auth_seq_id_1 127 _pdbx_validate_close_contact.PDB_ins_code_1 ? _pdbx_validate_close_contact.label_alt_id_1 ? _pdbx_validate_close_contact.auth_atom_id_2 O _pdbx_validate_close_contact.auth_asym_id_2 A _pdbx_validate_close_contact.auth_comp_id_2 HOH _pdbx_validate_close_contact.auth_seq_id_2 201 _pdbx_validate_close_contact.PDB_ins_code_2 ? _pdbx_validate_close_contact.label_alt_id_2 ? _pdbx_validate_close_contact.dist 1.57 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 OE1 A GLU 11 ? ? 1_555 CG A ASN 79 ? ? 6_655 1.66 2 1 OE1 A GLU 11 ? ? 1_555 OD1 A ASN 79 ? ? 6_655 1.69 3 1 OE1 A GLU 11 ? ? 1_555 ND2 A ASN 79 ? ? 6_655 1.80 # _pdbx_validate_torsion.id 1 _pdbx_validate_torsion.PDB_model_num 1 _pdbx_validate_torsion.auth_comp_id ASP _pdbx_validate_torsion.auth_asym_id A _pdbx_validate_torsion.auth_seq_id 99 _pdbx_validate_torsion.PDB_ins_code ? _pdbx_validate_torsion.label_alt_id ? _pdbx_validate_torsion.phi 54.17 _pdbx_validate_torsion.psi -114.63 # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 9 A MSE 18 ? MET 'modified residue' 2 A MSE 81 A MSE 90 ? MET 'modified residue' 3 A MSE 100 A MSE 109 ? MET 'modified residue' 4 A MSE 107 A MSE 116 ? MET 'modified residue' 5 A MSE 117 A MSE 126 ? MET 'modified residue' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 4.8738 13.7772 74.8133 0.4446 ? -0.1418 ? -0.1128 ? 0.5550 ? -0.1201 ? 0.4700 ? 4.4608 ? 1.2583 ? -0.9890 ? 3.2446 ? -0.7438 ? 3.5020 ? -0.5158 ? 0.3751 ? -0.5238 ? -0.2580 ? 0.4903 ? -0.8940 ? 0.1046 ? 0.5019 ? -0.0466 ? 2 'X-RAY DIFFRACTION' ? refined -0.1630 1.1896 75.4647 0.3693 ? -0.0906 ? -0.1019 ? 0.3185 ? -0.0864 ? 0.4212 ? 2.1547 ? -0.4863 ? 0.0137 ? 0.3233 ? -0.7503 ? 4.2991 ? 0.1442 ? -0.0807 ? -0.3040 ? 0.2280 ? 0.1840 ? -0.2590 ? 1.3622 ? 0.1578 ? -0.2140 ? 3 'X-RAY DIFFRACTION' ? refined -9.8093 -3.0477 75.1776 0.6751 ? -0.3264 ? -0.1417 ? 0.5356 ? 0.1028 ? 0.2769 ? 1.9819 ? 0.9855 ? 0.4632 ? 7.7493 ? -6.4140 ? 8.8723 ? -0.2800 ? 0.0741 ? -1.1965 ? 0.1923 ? -0.2780 ? 0.2676 ? 0.9856 ? -0.6433 ? 0.0692 ? 4 'X-RAY DIFFRACTION' ? refined -2.9468 12.2497 64.2933 0.1005 ? -0.2522 ? -0.4691 ? 0.3827 ? -0.0922 ? -0.0934 ? 2.0115 ? 2.8738 ? -1.9445 ? 5.4921 ? -4.1619 ? 3.2658 ? 0.1811 ? 0.5786 ? 0.6474 ? -1.1526 ? 0.1692 ? -0.5381 ? -0.4180 ? -0.0776 ? 0.0655 ? 5 'X-RAY DIFFRACTION' ? refined -3.1087 18.0944 63.1369 0.3959 ? -0.1135 ? -0.2877 ? 0.2868 ? -0.0658 ? 0.4738 ? 2.3335 ? -0.0194 ? -0.6890 ? 3.0482 ? -0.9258 ? 3.0003 ? -0.3321 ? 0.3442 ? 1.6193 ? -0.6421 ? -0.0060 ? 0.5753 ? -1.2027 ? -1.0275 ? 0.3914 ? 6 'X-RAY DIFFRACTION' ? refined -15.8587 9.0840 71.8104 0.1709 ? -0.0037 ? -0.0985 ? 0.6979 ? -0.0449 ? 0.3093 ? 3.7680 ? -1.0314 ? -1.1753 ? 4.3160 ? 3.3459 ? 5.6505 ? -0.0248 ? -0.2628 ? 0.4350 ? -0.9197 ? 0.0942 ? 0.3746 ? 0.1822 ? -0.7251 ? 0.2570 ? 7 'X-RAY DIFFRACTION' ? refined -10.7277 13.9410 67.1155 -0.1170 ? -0.0519 ? -0.0843 ? 0.7329 ? -0.0175 ? 0.3174 ? 2.2866 ? 2.4141 ? 1.2407 ? 2.5375 ? 0.8042 ? 1.2501 ? 0.1289 ? 0.7721 ? 0.7620 ? 0.6600 ? 0.2099 ? 0.4752 ? -2.0134 ? -0.7796 ? 0.0441 ? 8 'X-RAY DIFFRACTION' ? refined -10.1599 11.7866 79.6417 0.3503 ? 0.0141 ? -0.0175 ? 0.6110 ? -0.0386 ? 0.3273 ? 4.7729 ? 2.1125 ? -1.5794 ? 8.9271 ? -4.1420 ? 6.2845 ? 0.0665 ? -1.2310 ? 0.3604 ? 1.4582 ? 0.2147 ? 0.7908 ? -0.6885 ? -0.6134 ? -0.0980 ? 9 'X-RAY DIFFRACTION' ? refined -3.4280 12.9149 78.2454 0.4964 ? -0.1485 ? -0.0415 ? 0.6045 ? -0.0897 ? 0.3549 ? 3.0706 ? 3.6510 ? -3.5019 ? 4.0840 ? -3.8157 ? 4.5449 ? -0.2525 ? -0.7072 ? 0.3521 ? 0.0982 ? 0.1103 ? -0.4778 ? -0.2808 ? -0.0486 ? -0.0005 ? 10 'X-RAY DIFFRACTION' ? refined 3.3120 12.5671 76.0715 -0.0142 ? -0.3284 ? -0.2753 ? 0.3536 ? -0.1261 ? 0.3141 ? 1.1583 ? -0.0054 ? -0.4988 ? 1.5613 ? 0.5373 ? 4.6582 ? -0.2149 ? -0.2386 ? 0.4926 ? 0.8555 ? 0.8212 ? 0.1178 ? -0.3706 ? 1.0420 ? -0.1687 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? 'chain A and (resid 10 through 21 )' 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 22 through 59 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 60 through 69 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 70 through 76 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 77 through 89 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 90 through 103 ) ; 7 'X-RAY DIFFRACTION' 7 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 104 through 113 ) ; 8 'X-RAY DIFFRACTION' 8 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 114 through 121 ) ; 9 'X-RAY DIFFRACTION' 9 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 122 through 129 ) ; 10 'X-RAY DIFFRACTION' 10 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 130 through 149 ) ; # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ARG N N N N 1 ARG CA C N S 2 ARG C C N N 3 ARG O O N N 4 ARG CB C N N 5 ARG CG C N N 6 ARG CD C N N 7 ARG NE N N N 8 ARG CZ C N N 9 ARG NH1 N N N 10 ARG NH2 N N N 11 ARG OXT O N N 12 ARG H H N N 13 ARG H2 H N N 14 ARG HA H N N 15 ARG HB2 H N N 16 ARG HB3 H N N 17 ARG HG2 H N N 18 ARG HG3 H N N 19 ARG HD2 H N N 20 ARG HD3 H N N 21 ARG HE H N N 22 ARG HH11 H N N 23 ARG HH12 H N N 24 ARG HH21 H N N 25 ARG HH22 H N N 26 ARG HXT H N N 27 ASN N N N N 28 ASN CA C N S 29 ASN C C N N 30 ASN O O N N 31 ASN CB C N N 32 ASN CG C N N 33 ASN OD1 O N N 34 ASN ND2 N N N 35 ASN OXT O N N 36 ASN H H N N 37 ASN H2 H N N 38 ASN HA H N N 39 ASN HB2 H N N 40 ASN HB3 H N N 41 ASN HD21 H N N 42 ASN HD22 H N N 43 ASN HXT H N N 44 ASP N N N N 45 ASP CA C N S 46 ASP C C N N 47 ASP O O N N 48 ASP CB C N N 49 ASP CG C N N 50 ASP OD1 O N N 51 ASP OD2 O N N 52 ASP OXT O N N 53 ASP H H N N 54 ASP H2 H N N 55 ASP HA H N N 56 ASP HB2 H N N 57 ASP HB3 H N N 58 ASP HD2 H N N 59 ASP HXT H N N 60 CYS N N N N 61 CYS CA C N R 62 CYS C C N N 63 CYS O O N N 64 CYS CB C N N 65 CYS SG S N N 66 CYS OXT O N N 67 CYS H H N N 68 CYS H2 H N N 69 CYS HA H N N 70 CYS HB2 H N N 71 CYS HB3 H N N 72 CYS HG H N N 73 CYS HXT H N N 74 GLN N N N N 75 GLN CA C N S 76 GLN C C N N 77 GLN O O N N 78 GLN CB C N N 79 GLN CG C N N 80 GLN CD C N N 81 GLN OE1 O N N 82 GLN NE2 N N N 83 GLN OXT O N N 84 GLN H H N N 85 GLN H2 H N N 86 GLN HA H N N 87 GLN HB2 H N N 88 GLN HB3 H N N 89 GLN HG2 H N N 90 GLN HG3 H N N 91 GLN HE21 H N N 92 GLN HE22 H N N 93 GLN HXT H N N 94 GLU N N N N 95 GLU CA C N S 96 GLU C C N N 97 GLU O O N N 98 GLU CB C N N 99 GLU CG C N N 100 GLU CD C N N 101 GLU OE1 O N N 102 GLU OE2 O N N 103 GLU OXT O N N 104 GLU H H N N 105 GLU H2 H N N 106 GLU HA H N N 107 GLU HB2 H N N 108 GLU HB3 H N N 109 GLU HG2 H N N 110 GLU HG3 H N N 111 GLU HE2 H N N 112 GLU HXT H N N 113 GLY N N N N 114 GLY CA C N N 115 GLY C C N N 116 GLY O O N N 117 GLY OXT O N N 118 GLY H H N N 119 GLY H2 H N N 120 GLY HA2 H N N 121 GLY HA3 H N N 122 GLY HXT H N N 123 HIS N N N N 124 HIS CA C N S 125 HIS C C N N 126 HIS O O N N 127 HIS CB C N N 128 HIS CG C Y N 129 HIS ND1 N Y N 130 HIS CD2 C Y N 131 HIS CE1 C Y N 132 HIS NE2 N Y N 133 HIS OXT O N N 134 HIS H H N N 135 HIS H2 H N N 136 HIS HA H N N 137 HIS HB2 H N N 138 HIS HB3 H N N 139 HIS HD1 H N N 140 HIS HD2 H N N 141 HIS HE1 H N N 142 HIS HE2 H N N 143 HIS HXT H N N 144 HOH O O N N 145 HOH H1 H N N 146 HOH H2 H N N 147 ILE N N N N 148 ILE CA C N S 149 ILE C C N N 150 ILE O O N N 151 ILE CB C N S 152 ILE CG1 C N N 153 ILE CG2 C N N 154 ILE CD1 C N N 155 ILE OXT O N N 156 ILE H H N N 157 ILE H2 H N N 158 ILE HA H N N 159 ILE HB H N N 160 ILE HG12 H N N 161 ILE HG13 H N N 162 ILE HG21 H N N 163 ILE HG22 H N N 164 ILE HG23 H N N 165 ILE HD11 H N N 166 ILE HD12 H N N 167 ILE HD13 H N N 168 ILE HXT H N N 169 LEU N N N N 170 LEU CA C N S 171 LEU C C N N 172 LEU O O N N 173 LEU CB C N N 174 LEU CG C N N 175 LEU CD1 C N N 176 LEU CD2 C N N 177 LEU OXT O N N 178 LEU H H N N 179 LEU H2 H N N 180 LEU HA H N N 181 LEU HB2 H N N 182 LEU HB3 H N N 183 LEU HG H N N 184 LEU HD11 H N N 185 LEU HD12 H N N 186 LEU HD13 H N N 187 LEU HD21 H N N 188 LEU HD22 H N N 189 LEU HD23 H N N 190 LEU HXT H N N 191 LYS N N N N 192 LYS CA C N S 193 LYS C C N N 194 LYS O O N N 195 LYS CB C N N 196 LYS CG C N N 197 LYS CD C N N 198 LYS CE C N N 199 LYS NZ N N N 200 LYS OXT O N N 201 LYS H H N N 202 LYS H2 H N N 203 LYS HA H N N 204 LYS HB2 H N N 205 LYS HB3 H N N 206 LYS HG2 H N N 207 LYS HG3 H N N 208 LYS HD2 H N N 209 LYS HD3 H N N 210 LYS HE2 H N N 211 LYS HE3 H N N 212 LYS HZ1 H N N 213 LYS HZ2 H N N 214 LYS HZ3 H N N 215 LYS HXT H N N 216 MSE N N N N 217 MSE CA C N S 218 MSE C C N N 219 MSE O O N N 220 MSE OXT O N N 221 MSE CB C N N 222 MSE CG C N N 223 MSE SE SE N N 224 MSE CE C N N 225 MSE H H N N 226 MSE H2 H N N 227 MSE HA H N N 228 MSE HXT H N N 229 MSE HB2 H N N 230 MSE HB3 H N N 231 MSE HG2 H N N 232 MSE HG3 H N N 233 MSE HE1 H N N 234 MSE HE2 H N N 235 MSE HE3 H N N 236 PHE N N N N 237 PHE CA C N S 238 PHE C C N N 239 PHE O O N N 240 PHE CB C N N 241 PHE CG C Y N 242 PHE CD1 C Y N 243 PHE CD2 C Y N 244 PHE CE1 C Y N 245 PHE CE2 C Y N 246 PHE CZ C Y N 247 PHE OXT O N N 248 PHE H H N N 249 PHE H2 H N N 250 PHE HA H N N 251 PHE HB2 H N N 252 PHE HB3 H N N 253 PHE HD1 H N N 254 PHE HD2 H N N 255 PHE HE1 H N N 256 PHE HE2 H N N 257 PHE HZ H N N 258 PHE HXT H N N 259 PRO N N N N 260 PRO CA C N S 261 PRO C C N N 262 PRO O O N N 263 PRO CB C N N 264 PRO CG C N N 265 PRO CD C N N 266 PRO OXT O N N 267 PRO H H N N 268 PRO HA H N N 269 PRO HB2 H N N 270 PRO HB3 H N N 271 PRO HG2 H N N 272 PRO HG3 H N N 273 PRO HD2 H N N 274 PRO HD3 H N N 275 PRO HXT H N N 276 SER N N N N 277 SER CA C N S 278 SER C C N N 279 SER O O N N 280 SER CB C N N 281 SER OG O N N 282 SER OXT O N N 283 SER H H N N 284 SER H2 H N N 285 SER HA H N N 286 SER HB2 H N N 287 SER HB3 H N N 288 SER HG H N N 289 SER HXT H N N 290 THR N N N N 291 THR CA C N S 292 THR C C N N 293 THR O O N N 294 THR CB C N R 295 THR OG1 O N N 296 THR CG2 C N N 297 THR OXT O N N 298 THR H H N N 299 THR H2 H N N 300 THR HA H N N 301 THR HB H N N 302 THR HG1 H N N 303 THR HG21 H N N 304 THR HG22 H N N 305 THR HG23 H N N 306 THR HXT H N N 307 TYR N N N N 308 TYR CA C N S 309 TYR C C N N 310 TYR O O N N 311 TYR CB C N N 312 TYR CG C Y N 313 TYR CD1 C Y N 314 TYR CD2 C Y N 315 TYR CE1 C Y N 316 TYR CE2 C Y N 317 TYR CZ C Y N 318 TYR OH O N N 319 TYR OXT O N N 320 TYR H H N N 321 TYR H2 H N N 322 TYR HA H N N 323 TYR HB2 H N N 324 TYR HB3 H N N 325 TYR HD1 H N N 326 TYR HD2 H N N 327 TYR HE1 H N N 328 TYR HE2 H N N 329 TYR HH H N N 330 TYR HXT H N N 331 VAL N N N N 332 VAL CA C N S 333 VAL C C N N 334 VAL O O N N 335 VAL CB C N N 336 VAL CG1 C N N 337 VAL CG2 C N N 338 VAL OXT O N N 339 VAL H H N N 340 VAL H2 H N N 341 VAL HA H N N 342 VAL HB H N N 343 VAL HG11 H N N 344 VAL HG12 H N N 345 VAL HG13 H N N 346 VAL HG21 H N N 347 VAL HG22 H N N 348 VAL HG23 H N N 349 VAL HXT H N N 350 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ARG N CA sing N N 1 ARG N H sing N N 2 ARG N H2 sing N N 3 ARG CA C sing N N 4 ARG CA CB sing N N 5 ARG CA HA sing N N 6 ARG C O doub N N 7 ARG C OXT sing N N 8 ARG CB CG sing N N 9 ARG CB HB2 sing N N 10 ARG CB HB3 sing N N 11 ARG CG CD sing N N 12 ARG CG HG2 sing N N 13 ARG CG HG3 sing N N 14 ARG CD NE sing N N 15 ARG CD HD2 sing N N 16 ARG CD HD3 sing N N 17 ARG NE CZ sing N N 18 ARG NE HE sing N N 19 ARG CZ NH1 sing N N 20 ARG CZ NH2 doub N N 21 ARG NH1 HH11 sing N N 22 ARG NH1 HH12 sing N N 23 ARG NH2 HH21 sing N N 24 ARG NH2 HH22 sing N N 25 ARG OXT HXT sing N N 26 ASN N CA sing N N 27 ASN N H sing N N 28 ASN N H2 sing N N 29 ASN CA C sing N N 30 ASN CA CB sing N N 31 ASN CA HA sing N N 32 ASN C O doub N N 33 ASN C OXT sing N N 34 ASN CB CG sing N N 35 ASN CB HB2 sing N N 36 ASN CB HB3 sing N N 37 ASN CG OD1 doub N N 38 ASN CG ND2 sing N N 39 ASN ND2 HD21 sing N N 40 ASN ND2 HD22 sing N N 41 ASN OXT HXT sing N N 42 ASP N CA sing N N 43 ASP N H sing N N 44 ASP N H2 sing N N 45 ASP CA C sing N N 46 ASP CA CB sing N N 47 ASP CA HA sing N N 48 ASP C O doub N N 49 ASP C OXT sing N N 50 ASP CB CG sing N N 51 ASP CB HB2 sing N N 52 ASP CB HB3 sing N N 53 ASP CG OD1 doub N N 54 ASP CG OD2 sing N N 55 ASP OD2 HD2 sing N N 56 ASP OXT HXT sing N N 57 CYS N CA sing N N 58 CYS N H sing N N 59 CYS N H2 sing N N 60 CYS CA C sing N N 61 CYS CA CB sing N N 62 CYS CA HA sing N N 63 CYS C O doub N N 64 CYS C OXT sing N N 65 CYS CB SG sing N N 66 CYS CB HB2 sing N N 67 CYS CB HB3 sing N N 68 CYS SG HG sing N N 69 CYS OXT HXT sing N N 70 GLN N CA sing N N 71 GLN N H sing N N 72 GLN N H2 sing N N 73 GLN CA C sing N N 74 GLN CA CB sing N N 75 GLN CA HA sing N N 76 GLN C O doub N N 77 GLN C OXT sing N N 78 GLN CB CG sing N N 79 GLN CB HB2 sing N N 80 GLN CB HB3 sing N N 81 GLN CG CD sing N N 82 GLN CG HG2 sing N N 83 GLN CG HG3 sing N N 84 GLN CD OE1 doub N N 85 GLN CD NE2 sing N N 86 GLN NE2 HE21 sing N N 87 GLN NE2 HE22 sing N N 88 GLN OXT HXT sing N N 89 GLU N CA sing N N 90 GLU N H sing N N 91 GLU N H2 sing N N 92 GLU CA C sing N N 93 GLU CA CB sing N N 94 GLU CA HA sing N N 95 GLU C O doub N N 96 GLU C OXT sing N N 97 GLU CB CG sing N N 98 GLU CB HB2 sing N N 99 GLU CB HB3 sing N N 100 GLU CG CD sing N N 101 GLU CG HG2 sing N N 102 GLU CG HG3 sing N N 103 GLU CD OE1 doub N N 104 GLU CD OE2 sing N N 105 GLU OE2 HE2 sing N N 106 GLU OXT HXT sing N N 107 GLY N CA sing N N 108 GLY N H sing N N 109 GLY N H2 sing N N 110 GLY CA C sing N N 111 GLY CA HA2 sing N N 112 GLY CA HA3 sing N N 113 GLY C O doub N N 114 GLY C OXT sing N N 115 GLY OXT HXT sing N N 116 HIS N CA sing N N 117 HIS N H sing N N 118 HIS N H2 sing N N 119 HIS CA C sing N N 120 HIS CA CB sing N N 121 HIS CA HA sing N N 122 HIS C O doub N N 123 HIS C OXT sing N N 124 HIS CB CG sing N N 125 HIS CB HB2 sing N N 126 HIS CB HB3 sing N N 127 HIS CG ND1 sing Y N 128 HIS CG CD2 doub Y N 129 HIS ND1 CE1 doub Y N 130 HIS ND1 HD1 sing N N 131 HIS CD2 NE2 sing Y N 132 HIS CD2 HD2 sing N N 133 HIS CE1 NE2 sing Y N 134 HIS CE1 HE1 sing N N 135 HIS NE2 HE2 sing N N 136 HIS OXT HXT sing N N 137 HOH O H1 sing N N 138 HOH O H2 sing N N 139 ILE N CA sing N N 140 ILE N H sing N N 141 ILE N H2 sing N N 142 ILE CA C sing N N 143 ILE CA CB sing N N 144 ILE CA HA sing N N 145 ILE C O doub N N 146 ILE C OXT sing N N 147 ILE CB CG1 sing N N 148 ILE CB CG2 sing N N 149 ILE CB HB sing N N 150 ILE CG1 CD1 sing N N 151 ILE CG1 HG12 sing N N 152 ILE CG1 HG13 sing N N 153 ILE CG2 HG21 sing N N 154 ILE CG2 HG22 sing N N 155 ILE CG2 HG23 sing N N 156 ILE CD1 HD11 sing N N 157 ILE CD1 HD12 sing N N 158 ILE CD1 HD13 sing N N 159 ILE OXT HXT sing N N 160 LEU N CA sing N N 161 LEU N H sing N N 162 LEU N H2 sing N N 163 LEU CA C sing N N 164 LEU CA CB sing N N 165 LEU CA HA sing N N 166 LEU C O doub N N 167 LEU C OXT sing N N 168 LEU CB CG sing N N 169 LEU CB HB2 sing N N 170 LEU CB HB3 sing N N 171 LEU CG CD1 sing N N 172 LEU CG CD2 sing N N 173 LEU CG HG sing N N 174 LEU CD1 HD11 sing N N 175 LEU CD1 HD12 sing N N 176 LEU CD1 HD13 sing N N 177 LEU CD2 HD21 sing N N 178 LEU CD2 HD22 sing N N 179 LEU CD2 HD23 sing N N 180 LEU OXT HXT sing N N 181 LYS N CA sing N N 182 LYS N H sing N N 183 LYS N H2 sing N N 184 LYS CA C sing N N 185 LYS CA CB sing N N 186 LYS CA HA sing N N 187 LYS C O doub N N 188 LYS C OXT sing N N 189 LYS CB CG sing N N 190 LYS CB HB2 sing N N 191 LYS CB HB3 sing N N 192 LYS CG CD sing N N 193 LYS CG HG2 sing N N 194 LYS CG HG3 sing N N 195 LYS CD CE sing N N 196 LYS CD HD2 sing N N 197 LYS CD HD3 sing N N 198 LYS CE NZ sing N N 199 LYS CE HE2 sing N N 200 LYS CE HE3 sing N N 201 LYS NZ HZ1 sing N N 202 LYS NZ HZ2 sing N N 203 LYS NZ HZ3 sing N N 204 LYS OXT HXT sing N N 205 MSE N CA sing N N 206 MSE N H sing N N 207 MSE N H2 sing N N 208 MSE CA C sing N N 209 MSE CA CB sing N N 210 MSE CA HA sing N N 211 MSE C O doub N N 212 MSE C OXT sing N N 213 MSE OXT HXT sing N N 214 MSE CB CG sing N N 215 MSE CB HB2 sing N N 216 MSE CB HB3 sing N N 217 MSE CG SE sing N N 218 MSE CG HG2 sing N N 219 MSE CG HG3 sing N N 220 MSE SE CE sing N N 221 MSE CE HE1 sing N N 222 MSE CE HE2 sing N N 223 MSE CE HE3 sing N N 224 PHE N CA sing N N 225 PHE N H sing N N 226 PHE N H2 sing N N 227 PHE CA C sing N N 228 PHE CA CB sing N N 229 PHE CA HA sing N N 230 PHE C O doub N N 231 PHE C OXT sing N N 232 PHE CB CG sing N N 233 PHE CB HB2 sing N N 234 PHE CB HB3 sing N N 235 PHE CG CD1 doub Y N 236 PHE CG CD2 sing Y N 237 PHE CD1 CE1 sing Y N 238 PHE CD1 HD1 sing N N 239 PHE CD2 CE2 doub Y N 240 PHE CD2 HD2 sing N N 241 PHE CE1 CZ doub Y N 242 PHE CE1 HE1 sing N N 243 PHE CE2 CZ sing Y N 244 PHE CE2 HE2 sing N N 245 PHE CZ HZ sing N N 246 PHE OXT HXT sing N N 247 PRO N CA sing N N 248 PRO N CD sing N N 249 PRO N H sing N N 250 PRO CA C sing N N 251 PRO CA CB sing N N 252 PRO CA HA sing N N 253 PRO C O doub N N 254 PRO C OXT sing N N 255 PRO CB CG sing N N 256 PRO CB HB2 sing N N 257 PRO CB HB3 sing N N 258 PRO CG CD sing N N 259 PRO CG HG2 sing N N 260 PRO CG HG3 sing N N 261 PRO CD HD2 sing N N 262 PRO CD HD3 sing N N 263 PRO OXT HXT sing N N 264 SER N CA sing N N 265 SER N H sing N N 266 SER N H2 sing N N 267 SER CA C sing N N 268 SER CA CB sing N N 269 SER CA HA sing N N 270 SER C O doub N N 271 SER C OXT sing N N 272 SER CB OG sing N N 273 SER CB HB2 sing N N 274 SER CB HB3 sing N N 275 SER OG HG sing N N 276 SER OXT HXT sing N N 277 THR N CA sing N N 278 THR N H sing N N 279 THR N H2 sing N N 280 THR CA C sing N N 281 THR CA CB sing N N 282 THR CA HA sing N N 283 THR C O doub N N 284 THR C OXT sing N N 285 THR CB OG1 sing N N 286 THR CB CG2 sing N N 287 THR CB HB sing N N 288 THR OG1 HG1 sing N N 289 THR CG2 HG21 sing N N 290 THR CG2 HG22 sing N N 291 THR CG2 HG23 sing N N 292 THR OXT HXT sing N N 293 TYR N CA sing N N 294 TYR N H sing N N 295 TYR N H2 sing N N 296 TYR CA C sing N N 297 TYR CA CB sing N N 298 TYR CA HA sing N N 299 TYR C O doub N N 300 TYR C OXT sing N N 301 TYR CB CG sing N N 302 TYR CB HB2 sing N N 303 TYR CB HB3 sing N N 304 TYR CG CD1 doub Y N 305 TYR CG CD2 sing Y N 306 TYR CD1 CE1 sing Y N 307 TYR CD1 HD1 sing N N 308 TYR CD2 CE2 doub Y N 309 TYR CD2 HD2 sing N N 310 TYR CE1 CZ doub Y N 311 TYR CE1 HE1 sing N N 312 TYR CE2 CZ sing Y N 313 TYR CE2 HE2 sing N N 314 TYR CZ OH sing N N 315 TYR OH HH sing N N 316 TYR OXT HXT sing N N 317 VAL N CA sing N N 318 VAL N H sing N N 319 VAL N H2 sing N N 320 VAL CA C sing N N 321 VAL CA CB sing N N 322 VAL CA HA sing N N 323 VAL C O doub N N 324 VAL C OXT sing N N 325 VAL CB CG1 sing N N 326 VAL CB CG2 sing N N 327 VAL CB HB sing N N 328 VAL CG1 HG11 sing N N 329 VAL CG1 HG12 sing N N 330 VAL CG1 HG13 sing N N 331 VAL CG2 HG21 sing N N 332 VAL CG2 HG22 sing N N 333 VAL CG2 HG23 sing N N 334 VAL OXT HXT sing N N 335 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Academia Sinica' Taiwan ? 1 'National Health Research Institutes' Taiwan ? 2 # _atom_sites.entry_id 4ZGI _atom_sites.fract_transf_matrix[1][1] 0.025635 _atom_sites.fract_transf_matrix[1][2] 0.014800 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.029601 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.005604 _atom_sites.fract_transf_vector[1] 0.000000 _atom_sites.fract_transf_vector[2] 0.000000 _atom_sites.fract_transf_vector[3] 0.000000 # loop_ _atom_type.symbol C N O S SE # loop_