data_4ZI0
# 
_entry.id   4ZI0 
# 
_audit_conform.dict_name       mmcif_pdbx.dic 
_audit_conform.dict_version    5.380 
_audit_conform.dict_location   http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic 
# 
loop_
_database_2.database_id 
_database_2.database_code 
_database_2.pdbx_database_accession 
_database_2.pdbx_DOI 
PDB   4ZI0         pdb_00004zi0 10.2210/pdb4zi0/pdb 
WWPDB D_1000209336 ?            ?                   
# 
loop_
_pdbx_database_related.db_name 
_pdbx_database_related.details 
_pdbx_database_related.db_id 
_pdbx_database_related.content_type 
PDB . 4YYL unspecified 
PDB . 4ZHZ unspecified 
# 
_pdbx_database_status.status_code                     REL 
_pdbx_database_status.status_code_sf                  REL 
_pdbx_database_status.status_code_mr                  ? 
_pdbx_database_status.entry_id                        4ZI0 
_pdbx_database_status.recvd_initial_deposition_date   2015-04-27 
_pdbx_database_status.SG_entry                        N 
_pdbx_database_status.deposit_site                    RCSB 
_pdbx_database_status.process_site                    PDBJ 
_pdbx_database_status.status_code_cs                  ? 
_pdbx_database_status.methods_development_category    ? 
_pdbx_database_status.pdb_format_compatible           Y 
_pdbx_database_status.status_code_nmr_data            ? 
# 
loop_
_audit_author.name 
_audit_author.pdbx_ordinal 
'Fudo, S.'     1 
'Yamamoto, N.' 2 
'Nukaga, M.'   3 
'Odagiri, T.'  4 
'Tashiro, M.'  5 
'Neya, S.'     6 
'Hoshino, T.'  7 
# 
_citation.abstract                  ? 
_citation.abstract_id_CAS           ? 
_citation.book_id_ISBN              ? 
_citation.book_publisher            ? 
_citation.book_publisher_city       ? 
_citation.book_title                ? 
_citation.coordinate_linkage        ? 
_citation.country                   US 
_citation.database_id_Medline       ? 
_citation.details                   ? 
_citation.id                        primary 
_citation.journal_abbrev            Biochemistry 
_citation.journal_id_ASTM           BICHAW 
_citation.journal_id_CSD            0033 
_citation.journal_id_ISSN           0006-2960 
_citation.journal_full              ? 
_citation.journal_issue             ? 
_citation.journal_volume            55 
_citation.language                  ? 
_citation.page_first                2646 
_citation.page_last                 2660 
_citation.title                     
'Two Distinctive Binding Modes of Endonuclease Inhibitors to the N-Terminal Region of Influenza Virus Polymerase Acidic Subunit' 
_citation.year                      2016 
_citation.database_id_CSD           ? 
_citation.pdbx_database_id_DOI      10.1021/acs.biochem.5b01087 
_citation.pdbx_database_id_PubMed   27088785 
_citation.unpublished_flag          ? 
# 
loop_
_citation_author.citation_id 
_citation_author.name 
_citation_author.ordinal 
_citation_author.identifier_ORCID 
primary 'Fudo, S.'     1 ? 
primary 'Yamamoto, N.' 2 ? 
primary 'Nukaga, M.'   3 ? 
primary 'Odagiri, T.'  4 ? 
primary 'Tashiro, M.'  5 ? 
primary 'Hoshino, T.'  6 ? 
# 
_cell.angle_alpha                  90.000 
_cell.angle_alpha_esd              ? 
_cell.angle_beta                   90.000 
_cell.angle_beta_esd               ? 
_cell.angle_gamma                  90.000 
_cell.angle_gamma_esd              ? 
_cell.entry_id                     4ZI0 
_cell.details                      ? 
_cell.formula_units_Z              ? 
_cell.length_a                     66.758 
_cell.length_a_esd                 ? 
_cell.length_b                     66.758 
_cell.length_b_esd                 ? 
_cell.length_c                     126.744 
_cell.length_c_esd                 ? 
_cell.volume                       ? 
_cell.volume_esd                   ? 
_cell.Z_PDB                        8 
_cell.reciprocal_angle_alpha       ? 
_cell.reciprocal_angle_beta        ? 
_cell.reciprocal_angle_gamma       ? 
_cell.reciprocal_angle_alpha_esd   ? 
_cell.reciprocal_angle_beta_esd    ? 
_cell.reciprocal_angle_gamma_esd   ? 
_cell.reciprocal_length_a          ? 
_cell.reciprocal_length_b          ? 
_cell.reciprocal_length_c          ? 
_cell.reciprocal_length_a_esd      ? 
_cell.reciprocal_length_b_esd      ? 
_cell.reciprocal_length_c_esd      ? 
_cell.pdbx_unique_axis             ? 
# 
_symmetry.entry_id                         4ZI0 
_symmetry.cell_setting                     ? 
_symmetry.Int_Tables_number                92 
_symmetry.space_group_name_Hall            ? 
_symmetry.space_group_name_H-M             'P 41 21 2' 
_symmetry.pdbx_full_space_group_name_H-M   ? 
# 
loop_
_entity.id 
_entity.type 
_entity.src_method 
_entity.pdbx_description 
_entity.formula_weight 
_entity.pdbx_number_of_molecules 
_entity.pdbx_ec 
_entity.pdbx_mutation 
_entity.pdbx_fragment 
_entity.details 
1 polymer     man 'Polymerase acidic protein'                                            22300.494 1   ? ? 
'endonuclease, residues 1-50, 73-196' ? 
2 non-polymer syn 'SULFATE ION'                                                          96.063    1   ? ? ? ? 
3 non-polymer syn 'MANGANESE (II) ION'                                                   54.938    2   ? ? ? ? 
4 non-polymer syn '4-{(E)-[2-(4-chlorophenyl)hydrazinylidene]methyl}benzene-1,2,3-triol' 278.691   1   ? ? ? ? 
5 water       nat water                                                                  18.015    203 ? ? ? ? 
# 
_entity_name_com.entity_id   1 
_entity_name_com.name        'RNA-directed RNA polymerase subunit P2' 
# 
_entity_poly.entity_id                      1 
_entity_poly.type                           'polypeptide(L)' 
_entity_poly.nstd_linkage                   no 
_entity_poly.nstd_monomer                   no 
_entity_poly.pdbx_seq_one_letter_code       
;GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHRFEIIEGRDRTMAWTVVNSIC
NTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRL
FTIRQEMASRGLWDSFRQSERGAAELALVPR
;
_entity_poly.pdbx_seq_one_letter_code_can   
;GPLGSMEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSDASKHRFEIIEGRDRTMAWTVVNSIC
NTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTGEEMATKADYTLDEESRARIKTRL
FTIRQEMASRGLWDSFRQSERGAAELALVPR
;
_entity_poly.pdbx_strand_id                 A 
_entity_poly.pdbx_target_identifier         ? 
# 
loop_
_entity_poly_seq.entity_id 
_entity_poly_seq.num 
_entity_poly_seq.mon_id 
_entity_poly_seq.hetero 
1 1   GLY n 
1 2   PRO n 
1 3   LEU n 
1 4   GLY n 
1 5   SER n 
1 6   MET n 
1 7   GLU n 
1 8   ASP n 
1 9   PHE n 
1 10  VAL n 
1 11  ARG n 
1 12  GLN n 
1 13  CYS n 
1 14  PHE n 
1 15  ASN n 
1 16  PRO n 
1 17  MET n 
1 18  ILE n 
1 19  VAL n 
1 20  GLU n 
1 21  LEU n 
1 22  ALA n 
1 23  GLU n 
1 24  LYS n 
1 25  THR n 
1 26  MET n 
1 27  LYS n 
1 28  GLU n 
1 29  TYR n 
1 30  GLY n 
1 31  GLU n 
1 32  ASP n 
1 33  LEU n 
1 34  LYS n 
1 35  ILE n 
1 36  GLU n 
1 37  THR n 
1 38  ASN n 
1 39  LYS n 
1 40  PHE n 
1 41  ALA n 
1 42  ALA n 
1 43  ILE n 
1 44  CYS n 
1 45  THR n 
1 46  HIS n 
1 47  LEU n 
1 48  GLU n 
1 49  VAL n 
1 50  CYS n 
1 51  PHE n 
1 52  MET n 
1 53  TYR n 
1 54  SER n 
1 55  ASP n 
1 56  ALA n 
1 57  SER n 
1 58  LYS n 
1 59  HIS n 
1 60  ARG n 
1 61  PHE n 
1 62  GLU n 
1 63  ILE n 
1 64  ILE n 
1 65  GLU n 
1 66  GLY n 
1 67  ARG n 
1 68  ASP n 
1 69  ARG n 
1 70  THR n 
1 71  MET n 
1 72  ALA n 
1 73  TRP n 
1 74  THR n 
1 75  VAL n 
1 76  VAL n 
1 77  ASN n 
1 78  SER n 
1 79  ILE n 
1 80  CYS n 
1 81  ASN n 
1 82  THR n 
1 83  THR n 
1 84  GLY n 
1 85  ALA n 
1 86  GLU n 
1 87  LYS n 
1 88  PRO n 
1 89  LYS n 
1 90  PHE n 
1 91  LEU n 
1 92  PRO n 
1 93  ASP n 
1 94  LEU n 
1 95  TYR n 
1 96  ASP n 
1 97  TYR n 
1 98  LYS n 
1 99  GLU n 
1 100 ASN n 
1 101 ARG n 
1 102 PHE n 
1 103 ILE n 
1 104 GLU n 
1 105 ILE n 
1 106 GLY n 
1 107 VAL n 
1 108 THR n 
1 109 ARG n 
1 110 ARG n 
1 111 GLU n 
1 112 VAL n 
1 113 HIS n 
1 114 ILE n 
1 115 TYR n 
1 116 TYR n 
1 117 LEU n 
1 118 GLU n 
1 119 LYS n 
1 120 ALA n 
1 121 ASN n 
1 122 LYS n 
1 123 ILE n 
1 124 LYS n 
1 125 SER n 
1 126 GLU n 
1 127 LYS n 
1 128 THR n 
1 129 HIS n 
1 130 ILE n 
1 131 HIS n 
1 132 ILE n 
1 133 PHE n 
1 134 SER n 
1 135 PHE n 
1 136 THR n 
1 137 GLY n 
1 138 GLU n 
1 139 GLU n 
1 140 MET n 
1 141 ALA n 
1 142 THR n 
1 143 LYS n 
1 144 ALA n 
1 145 ASP n 
1 146 TYR n 
1 147 THR n 
1 148 LEU n 
1 149 ASP n 
1 150 GLU n 
1 151 GLU n 
1 152 SER n 
1 153 ARG n 
1 154 ALA n 
1 155 ARG n 
1 156 ILE n 
1 157 LYS n 
1 158 THR n 
1 159 ARG n 
1 160 LEU n 
1 161 PHE n 
1 162 THR n 
1 163 ILE n 
1 164 ARG n 
1 165 GLN n 
1 166 GLU n 
1 167 MET n 
1 168 ALA n 
1 169 SER n 
1 170 ARG n 
1 171 GLY n 
1 172 LEU n 
1 173 TRP n 
1 174 ASP n 
1 175 SER n 
1 176 PHE n 
1 177 ARG n 
1 178 GLN n 
1 179 SER n 
1 180 GLU n 
1 181 ARG n 
1 182 GLY n 
1 183 ALA n 
1 184 ALA n 
1 185 GLU n 
1 186 LEU n 
1 187 ALA n 
1 188 LEU n 
1 189 VAL n 
1 190 PRO n 
1 191 ARG n 
# 
loop_
_entity_src_gen.entity_id 
_entity_src_gen.pdbx_src_id 
_entity_src_gen.pdbx_alt_source_flag 
_entity_src_gen.pdbx_seq_type 
_entity_src_gen.pdbx_beg_seq_num 
_entity_src_gen.pdbx_end_seq_num 
_entity_src_gen.gene_src_common_name 
_entity_src_gen.gene_src_genus 
_entity_src_gen.pdbx_gene_src_gene 
_entity_src_gen.gene_src_species 
_entity_src_gen.gene_src_strain 
_entity_src_gen.gene_src_tissue 
_entity_src_gen.gene_src_tissue_fraction 
_entity_src_gen.gene_src_details 
_entity_src_gen.pdbx_gene_src_fragment 
_entity_src_gen.pdbx_gene_src_scientific_name 
_entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 
_entity_src_gen.pdbx_gene_src_variant 
_entity_src_gen.pdbx_gene_src_cell_line 
_entity_src_gen.pdbx_gene_src_atcc 
_entity_src_gen.pdbx_gene_src_organ 
_entity_src_gen.pdbx_gene_src_organelle 
_entity_src_gen.pdbx_gene_src_cell 
_entity_src_gen.pdbx_gene_src_cellular_location 
_entity_src_gen.host_org_common_name 
_entity_src_gen.pdbx_host_org_scientific_name 
_entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 
_entity_src_gen.host_org_genus 
_entity_src_gen.pdbx_host_org_gene 
_entity_src_gen.pdbx_host_org_organ 
_entity_src_gen.host_org_species 
_entity_src_gen.pdbx_host_org_tissue 
_entity_src_gen.pdbx_host_org_tissue_fraction 
_entity_src_gen.pdbx_host_org_strain 
_entity_src_gen.pdbx_host_org_variant 
_entity_src_gen.pdbx_host_org_cell_line 
_entity_src_gen.pdbx_host_org_atcc 
_entity_src_gen.pdbx_host_org_culture_collection 
_entity_src_gen.pdbx_host_org_cell 
_entity_src_gen.pdbx_host_org_organelle 
_entity_src_gen.pdbx_host_org_cellular_location 
_entity_src_gen.pdbx_host_org_vector_type 
_entity_src_gen.pdbx_host_org_vector 
_entity_src_gen.host_org_details 
_entity_src_gen.expression_system_id 
_entity_src_gen.plasmid_name 
_entity_src_gen.plasmid_details 
_entity_src_gen.pdbx_description 
1 1 sample 'Biological sequence' 1  55  ? ? PA ? 'A/Puerto Rico/8/1934 H1N1' ? ? ? ? 
'Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)' 211044 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'Rosetta (DE3) pLysS' ? ? ? ? ? ? ? plasmid ? ? ? 'pET50b(+)' ? ? 
1 2 sample 'Biological sequence' 56 191 ? ? PA ? 'A/Puerto Rico/8/1934 H1N1' ? ? ? ? 
'Influenza A virus (strain A/Puerto Rico/8/1934 H1N1)' 211044 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? 
'Rosetta (DE3) pLysS' ? ? ? ? ? ? ? plasmid ? ? ? 'pET50b(+)' ? ? 
# 
loop_
_struct_ref.id 
_struct_ref.db_name 
_struct_ref.db_code 
_struct_ref.pdbx_db_accession 
_struct_ref.pdbx_db_isoform 
_struct_ref.entity_id 
_struct_ref.pdbx_seq_one_letter_code 
_struct_ref.pdbx_align_begin 
1 UNP PA_I34A1 P03433 ? 1 MEDFVRQCFNPMIVELAEKTMKEYGEDLKIETNKFAAICTHLEVCFMYSD 1  
2 UNP PA_I34A1 P03433 ? 1 
;KHRFEIIEGRDRTMAWTVVNSICNTTGAEKPKFLPDLYDYKENRFIEIGVTRREVHIYYLEKANKIKSEKTHIHIFSFTG
EEMATKADYTLDEESRARIKTRLFTIRQEMASRGLWDSFRQSERG
;
73 
# 
loop_
_struct_ref_seq.align_id 
_struct_ref_seq.ref_id 
_struct_ref_seq.pdbx_PDB_id_code 
_struct_ref_seq.pdbx_strand_id 
_struct_ref_seq.seq_align_beg 
_struct_ref_seq.pdbx_seq_align_beg_ins_code 
_struct_ref_seq.seq_align_end 
_struct_ref_seq.pdbx_seq_align_end_ins_code 
_struct_ref_seq.pdbx_db_accession 
_struct_ref_seq.db_align_beg 
_struct_ref_seq.pdbx_db_align_beg_ins_code 
_struct_ref_seq.db_align_end 
_struct_ref_seq.pdbx_db_align_end_ins_code 
_struct_ref_seq.pdbx_auth_seq_align_beg 
_struct_ref_seq.pdbx_auth_seq_align_end 
1 1 4ZI0 A 6  ? 55  ? P03433 1  ? 50  ? 1  50  
2 2 4ZI0 A 58 ? 182 ? P03433 73 ? 197 ? 73 197 
# 
loop_
_struct_ref_seq_dif.align_id 
_struct_ref_seq_dif.pdbx_pdb_id_code 
_struct_ref_seq_dif.mon_id 
_struct_ref_seq_dif.pdbx_pdb_strand_id 
_struct_ref_seq_dif.seq_num 
_struct_ref_seq_dif.pdbx_pdb_ins_code 
_struct_ref_seq_dif.pdbx_seq_db_name 
_struct_ref_seq_dif.pdbx_seq_db_accession_code 
_struct_ref_seq_dif.db_mon_id 
_struct_ref_seq_dif.pdbx_seq_db_seq_num 
_struct_ref_seq_dif.details 
_struct_ref_seq_dif.pdbx_auth_seq_num 
_struct_ref_seq_dif.pdbx_ordinal 
1 4ZI0 GLY A 1   ? UNP P03433 ? ? 'expression tag' -4  1  
1 4ZI0 PRO A 2   ? UNP P03433 ? ? 'expression tag' -3  2  
1 4ZI0 LEU A 3   ? UNP P03433 ? ? 'expression tag' -2  3  
1 4ZI0 GLY A 4   ? UNP P03433 ? ? 'expression tag' -1  4  
1 4ZI0 SER A 5   ? UNP P03433 ? ? 'expression tag' 0   5  
1 4ZI0 ALA A 56  ? UNP P03433 ? ? linker           51  6  
1 4ZI0 SER A 57  ? UNP P03433 ? ? linker           52  7  
2 4ZI0 ALA A 183 ? UNP P03433 ? ? 'expression tag' 198 8  
2 4ZI0 ALA A 184 ? UNP P03433 ? ? 'expression tag' 199 9  
2 4ZI0 GLU A 185 ? UNP P03433 ? ? 'expression tag' 200 10 
2 4ZI0 LEU A 186 ? UNP P03433 ? ? 'expression tag' 201 11 
2 4ZI0 ALA A 187 ? UNP P03433 ? ? 'expression tag' 202 12 
2 4ZI0 LEU A 188 ? UNP P03433 ? ? 'expression tag' 203 13 
2 4ZI0 VAL A 189 ? UNP P03433 ? ? 'expression tag' 204 14 
2 4ZI0 PRO A 190 ? UNP P03433 ? ? 'expression tag' 205 15 
2 4ZI0 ARG A 191 ? UNP P03433 ? ? 'expression tag' 206 16 
# 
loop_
_chem_comp.id 
_chem_comp.type 
_chem_comp.mon_nstd_flag 
_chem_comp.name 
_chem_comp.pdbx_synonyms 
_chem_comp.formula 
_chem_comp.formula_weight 
4P9 non-polymer         . '4-{(E)-[2-(4-chlorophenyl)hydrazinylidene]methyl}benzene-1,2,3-triol' ? 'C13 H11 Cl N2 O3' 278.691 
ALA 'L-peptide linking' y ALANINE                                                                ? 'C3 H7 N O2'       89.093  
ARG 'L-peptide linking' y ARGININE                                                               ? 'C6 H15 N4 O2 1'   175.209 
ASN 'L-peptide linking' y ASPARAGINE                                                             ? 'C4 H8 N2 O3'      132.118 
ASP 'L-peptide linking' y 'ASPARTIC ACID'                                                        ? 'C4 H7 N O4'       133.103 
CYS 'L-peptide linking' y CYSTEINE                                                               ? 'C3 H7 N O2 S'     121.158 
GLN 'L-peptide linking' y GLUTAMINE                                                              ? 'C5 H10 N2 O3'     146.144 
GLU 'L-peptide linking' y 'GLUTAMIC ACID'                                                        ? 'C5 H9 N O4'       147.129 
GLY 'peptide linking'   y GLYCINE                                                                ? 'C2 H5 N O2'       75.067  
HIS 'L-peptide linking' y HISTIDINE                                                              ? 'C6 H10 N3 O2 1'   156.162 
HOH non-polymer         . WATER                                                                  ? 'H2 O'             18.015  
ILE 'L-peptide linking' y ISOLEUCINE                                                             ? 'C6 H13 N O2'      131.173 
LEU 'L-peptide linking' y LEUCINE                                                                ? 'C6 H13 N O2'      131.173 
LYS 'L-peptide linking' y LYSINE                                                                 ? 'C6 H15 N2 O2 1'   147.195 
MET 'L-peptide linking' y METHIONINE                                                             ? 'C5 H11 N O2 S'    149.211 
MN  non-polymer         . 'MANGANESE (II) ION'                                                   ? 'Mn 2'             54.938  
PHE 'L-peptide linking' y PHENYLALANINE                                                          ? 'C9 H11 N O2'      165.189 
PRO 'L-peptide linking' y PROLINE                                                                ? 'C5 H9 N O2'       115.130 
SER 'L-peptide linking' y SERINE                                                                 ? 'C3 H7 N O3'       105.093 
SO4 non-polymer         . 'SULFATE ION'                                                          ? 'O4 S -2'          96.063  
THR 'L-peptide linking' y THREONINE                                                              ? 'C4 H9 N O3'       119.119 
TRP 'L-peptide linking' y TRYPTOPHAN                                                             ? 'C11 H12 N2 O2'    204.225 
TYR 'L-peptide linking' y TYROSINE                                                               ? 'C9 H11 N O3'      181.189 
VAL 'L-peptide linking' y VALINE                                                                 ? 'C5 H11 N O2'      117.146 
# 
_exptl.absorpt_coefficient_mu     ? 
_exptl.absorpt_correction_T_max   ? 
_exptl.absorpt_correction_T_min   ? 
_exptl.absorpt_correction_type    ? 
_exptl.absorpt_process_details    ? 
_exptl.entry_id                   4ZI0 
_exptl.crystals_number            1 
_exptl.details                    ? 
_exptl.method                     'X-RAY DIFFRACTION' 
_exptl.method_details             ? 
# 
_exptl_crystal.colour                      ? 
_exptl_crystal.density_diffrn              ? 
_exptl_crystal.density_Matthews            3.17 
_exptl_crystal.density_method              ? 
_exptl_crystal.density_percent_sol         61.15 
_exptl_crystal.description                 ? 
_exptl_crystal.F_000                       ? 
_exptl_crystal.id                          1 
_exptl_crystal.preparation                 ? 
_exptl_crystal.size_max                    ? 
_exptl_crystal.size_mid                    ? 
_exptl_crystal.size_min                    ? 
_exptl_crystal.size_rad                    ? 
_exptl_crystal.colour_lustre               ? 
_exptl_crystal.colour_modifier             ? 
_exptl_crystal.colour_primary              ? 
_exptl_crystal.density_meas                ? 
_exptl_crystal.density_meas_esd            ? 
_exptl_crystal.density_meas_gt             ? 
_exptl_crystal.density_meas_lt             ? 
_exptl_crystal.density_meas_temp           ? 
_exptl_crystal.density_meas_temp_esd       ? 
_exptl_crystal.density_meas_temp_gt        ? 
_exptl_crystal.density_meas_temp_lt        ? 
_exptl_crystal.pdbx_crystal_image_url      ? 
_exptl_crystal.pdbx_crystal_image_format   ? 
_exptl_crystal.pdbx_mosaicity              ? 
_exptl_crystal.pdbx_mosaicity_esd          ? 
# 
_exptl_crystal_grow.apparatus       ? 
_exptl_crystal_grow.atmosphere      ? 
_exptl_crystal_grow.crystal_id      1 
_exptl_crystal_grow.details         ? 
_exptl_crystal_grow.method          'VAPOR DIFFUSION, HANGING DROP' 
_exptl_crystal_grow.method_ref      ? 
_exptl_crystal_grow.pH              5.8 
_exptl_crystal_grow.pressure        ? 
_exptl_crystal_grow.pressure_esd    ? 
_exptl_crystal_grow.seeding         ? 
_exptl_crystal_grow.seeding_ref     ? 
_exptl_crystal_grow.temp            291 
_exptl_crystal_grow.temp_details    ? 
_exptl_crystal_grow.temp_esd        ? 
_exptl_crystal_grow.time            ? 
_exptl_crystal_grow.pdbx_details    '100 mM MES, 1.1 M ammonium sulfate, 0.1 M potassium chloride, 9 % trehalose' 
_exptl_crystal_grow.pdbx_pH_range   ? 
# 
_diffrn.ambient_environment    ? 
_diffrn.ambient_temp           100 
_diffrn.ambient_temp_details   ? 
_diffrn.ambient_temp_esd       ? 
_diffrn.crystal_id             1 
_diffrn.crystal_support        ? 
_diffrn.crystal_treatment      ? 
_diffrn.details                ? 
_diffrn.id                     1 
_diffrn.ambient_pressure       ? 
_diffrn.ambient_pressure_esd   ? 
_diffrn.ambient_pressure_gt    ? 
_diffrn.ambient_pressure_lt    ? 
_diffrn.ambient_temp_gt        ? 
_diffrn.ambient_temp_lt        ? 
# 
_diffrn_detector.details                      ? 
_diffrn_detector.detector                     CCD 
_diffrn_detector.diffrn_id                    1 
_diffrn_detector.type                         'ADSC QUANTUM 315r' 
_diffrn_detector.area_resol_mean              ? 
_diffrn_detector.dtime                        ? 
_diffrn_detector.pdbx_frames_total            ? 
_diffrn_detector.pdbx_collection_time_total   ? 
_diffrn_detector.pdbx_collection_date         2014-11-17 
# 
_diffrn_radiation.collimation                      ? 
_diffrn_radiation.diffrn_id                        1 
_diffrn_radiation.filter_edge                      ? 
_diffrn_radiation.inhomogeneity                    ? 
_diffrn_radiation.monochromator                    'Numerical link type Si(111) double crystal monochromator, direct water cooling' 
_diffrn_radiation.polarisn_norm                    ? 
_diffrn_radiation.polarisn_ratio                   ? 
_diffrn_radiation.probe                            ? 
_diffrn_radiation.type                             ? 
_diffrn_radiation.xray_symbol                      ? 
_diffrn_radiation.wavelength_id                    1 
_diffrn_radiation.pdbx_monochromatic_or_laue_m_l   M 
_diffrn_radiation.pdbx_wavelength_list             ? 
_diffrn_radiation.pdbx_wavelength                  ? 
_diffrn_radiation.pdbx_diffrn_protocol             'SINGLE WAVELENGTH' 
_diffrn_radiation.pdbx_analyzer                    ? 
_diffrn_radiation.pdbx_scattering_type             x-ray 
# 
_diffrn_radiation_wavelength.id           1 
_diffrn_radiation_wavelength.wavelength   1.000 
_diffrn_radiation_wavelength.wt           1.0 
# 
_diffrn_source.current                     ? 
_diffrn_source.details                     ? 
_diffrn_source.diffrn_id                   1 
_diffrn_source.power                       ? 
_diffrn_source.size                        ? 
_diffrn_source.source                      SYNCHROTRON 
_diffrn_source.target                      ? 
_diffrn_source.type                        'PHOTON FACTORY BEAMLINE BL-5A' 
_diffrn_source.voltage                     ? 
_diffrn_source.take-off_angle              ? 
_diffrn_source.pdbx_wavelength_list        1.000 
_diffrn_source.pdbx_wavelength             ? 
_diffrn_source.pdbx_synchrotron_beamline   BL-5A 
_diffrn_source.pdbx_synchrotron_site       'Photon Factory' 
# 
_reflns.B_iso_Wilson_estimate            37.590 
_reflns.entry_id                         4ZI0 
_reflns.data_reduction_details           ? 
_reflns.data_reduction_method            ? 
_reflns.d_resolution_high                1.800 
_reflns.d_resolution_low                 50.000 
_reflns.details                          ? 
_reflns.limit_h_max                      ? 
_reflns.limit_h_min                      ? 
_reflns.limit_k_max                      ? 
_reflns.limit_k_min                      ? 
_reflns.limit_l_max                      ? 
_reflns.limit_l_min                      ? 
_reflns.number_all                       ? 
_reflns.number_obs                       27032 
_reflns.observed_criterion               ? 
_reflns.observed_criterion_F_max         ? 
_reflns.observed_criterion_F_min         ? 
_reflns.observed_criterion_I_max         ? 
_reflns.observed_criterion_I_min         ? 
_reflns.observed_criterion_sigma_F       ? 
_reflns.observed_criterion_sigma_I       ? 
_reflns.percent_possible_obs             98.900 
_reflns.R_free_details                   ? 
_reflns.Rmerge_F_all                     ? 
_reflns.Rmerge_F_obs                     ? 
_reflns.Friedel_coverage                 ? 
_reflns.number_gt                        ? 
_reflns.threshold_expression             ? 
_reflns.pdbx_redundancy                  13.800 
_reflns.pdbx_Rmerge_I_obs                0.060 
_reflns.pdbx_Rmerge_I_all                ? 
_reflns.pdbx_Rsym_value                  ? 
_reflns.pdbx_netI_over_av_sigmaI         36.194 
_reflns.pdbx_netI_over_sigmaI            16.800 
_reflns.pdbx_res_netI_over_av_sigmaI_2   ? 
_reflns.pdbx_res_netI_over_sigmaI_2      ? 
_reflns.pdbx_chi_squared                 1.031 
_reflns.pdbx_scaling_rejects             ? 
_reflns.pdbx_d_res_high_opt              ? 
_reflns.pdbx_d_res_low_opt               ? 
_reflns.pdbx_d_res_opt_method            ? 
_reflns.phase_calculation_details        ? 
_reflns.pdbx_Rrim_I_all                  0.063 
_reflns.pdbx_Rpim_I_all                  0.017 
_reflns.pdbx_d_opt                       ? 
_reflns.pdbx_number_measured_all         374092 
_reflns.pdbx_diffrn_id                   1 
_reflns.pdbx_ordinal                     1 
_reflns.pdbx_CC_half                     ? 
_reflns.pdbx_R_split                     ? 
# 
loop_
_reflns_shell.d_res_high 
_reflns_shell.d_res_low 
_reflns_shell.meanI_over_sigI_all 
_reflns_shell.meanI_over_sigI_obs 
_reflns_shell.number_measured_all 
_reflns_shell.number_measured_obs 
_reflns_shell.number_possible 
_reflns_shell.number_unique_all 
_reflns_shell.number_unique_obs 
_reflns_shell.percent_possible_all 
_reflns_shell.percent_possible_obs 
_reflns_shell.Rmerge_F_all 
_reflns_shell.Rmerge_F_obs 
_reflns_shell.Rmerge_I_all 
_reflns_shell.Rmerge_I_obs 
_reflns_shell.meanI_over_sigI_gt 
_reflns_shell.meanI_over_uI_all 
_reflns_shell.meanI_over_uI_gt 
_reflns_shell.number_measured_gt 
_reflns_shell.number_unique_gt 
_reflns_shell.percent_possible_gt 
_reflns_shell.Rmerge_F_gt 
_reflns_shell.Rmerge_I_gt 
_reflns_shell.pdbx_redundancy 
_reflns_shell.pdbx_Rsym_value 
_reflns_shell.pdbx_chi_squared 
_reflns_shell.pdbx_netI_over_sigmaI_all 
_reflns_shell.pdbx_netI_over_sigmaI_obs 
_reflns_shell.pdbx_Rrim_I_all 
_reflns_shell.pdbx_Rpim_I_all 
_reflns_shell.pdbx_rejects 
_reflns_shell.pdbx_ordinal 
_reflns_shell.pdbx_diffrn_id 
_reflns_shell.pdbx_CC_half 
_reflns_shell.pdbx_R_split 
1.800 1.830  ? ? ? ? ? 1333 ? 100.000 ? ? ? ? ?     ? ? ? ? ? ? ? ? 14.200 ? 1.015 ? ? ?     0.328 0 1  1 0.820 ? 
1.830 1.860  ? ? ? ? ? 1341 ? 100.000 ? ? ? ? 0.911 ? ? ? ? ? ? ? ? 14.100 ? 1.013 ? ? 0.944 0.248 0 2  1 0.844 ? 
1.860 1.900  ? ? ? ? ? 1336 ? 100.000 ? ? ? ? 0.818 ? ? ? ? ? ? ? ? 14.200 ? 1.060 ? ? 0.848 0.223 0 3  1 0.894 ? 
1.900 1.940  ? ? ? ? ? 1341 ? 100.000 ? ? ? ? 0.648 ? ? ? ? ? ? ? ? 14.100 ? 1.080 ? ? 0.672 0.178 0 4  1 0.925 ? 
1.940 1.980  ? ? ? ? ? 1321 ? 100.000 ? ? ? ? 0.464 ? ? ? ? ? ? ? ? 14.200 ? 1.043 ? ? 0.481 0.127 0 5  1 0.964 ? 
1.980 2.030  ? ? ? ? ? 1349 ? 100.000 ? ? ? ? 0.354 ? ? ? ? ? ? ? ? 14.300 ? 1.012 ? ? 0.367 0.096 0 6  1 0.975 ? 
2.030 2.080  ? ? ? ? ? 1344 ? 100.000 ? ? ? ? 0.293 ? ? ? ? ? ? ? ? 13.900 ? 1.041 ? ? 0.304 0.081 0 7  1 0.983 ? 
2.080 2.130  ? ? ? ? ? 1343 ? 100.000 ? ? ? ? 0.214 ? ? ? ? ? ? ? ? 14.300 ? 1.009 ? ? 0.222 0.058 0 8  1 0.991 ? 
2.130 2.200  ? ? ? ? ? 1350 ? 100.000 ? ? ? ? 0.156 ? ? ? ? ? ? ? ? 14.300 ? 0.985 ? ? 0.162 0.042 0 9  1 0.993 ? 
2.200 2.270  ? ? ? ? ? 1341 ? 100.000 ? ? ? ? 0.138 ? ? ? ? ? ? ? ? 14.100 ? 1.066 ? ? 0.143 0.038 0 10 1 0.995 ? 
2.270 2.350  ? ? ? ? ? 1350 ? 100.000 ? ? ? ? 0.119 ? ? ? ? ? ? ? ? 14.200 ? 0.974 ? ? 0.123 0.032 0 11 1 0.996 ? 
2.350 2.440  ? ? ? ? ? 1359 ? 100.000 ? ? ? ? 0.102 ? ? ? ? ? ? ? ? 14.200 ? 1.020 ? ? 0.106 0.028 0 12 1 0.997 ? 
2.440 2.550  ? ? ? ? ? 1362 ? 100.000 ? ? ? ? 0.085 ? ? ? ? ? ? ? ? 14.100 ? 1.045 ? ? 0.088 0.023 0 13 1 0.998 ? 
2.550 2.690  ? ? ? ? ? 1351 ? 99.900  ? ? ? ? 0.077 ? ? ? ? ? ? ? ? 14.000 ? 0.996 ? ? 0.080 0.021 0 14 1 0.998 ? 
2.690 2.860  ? ? ? ? ? 1370 ? 100.000 ? ? ? ? 0.067 ? ? ? ? ? ? ? ? 14.000 ? 1.025 ? ? 0.069 0.018 0 15 1 0.998 ? 
2.860 3.080  ? ? ? ? ? 1371 ? 99.900  ? ? ? ? 0.063 ? ? ? ? ? ? ? ? 13.900 ? 1.086 ? ? 0.065 0.017 0 16 1 0.999 ? 
3.080 3.390  ? ? ? ? ? 1386 ? 99.800  ? ? ? ? 0.061 ? ? ? ? ? ? ? ? 13.700 ? 0.973 ? ? 0.063 0.017 0 17 1 0.998 ? 
3.390 3.880  ? ? ? ? ? 1374 ? 97.900  ? ? ? ? 0.053 ? ? ? ? ? ? ? ? 13.100 ? 1.079 ? ? 0.056 0.016 0 18 1 0.999 ? 
3.880 4.880  ? ? ? ? ? 1333 ? 93.500  ? ? ? ? 0.039 ? ? ? ? ? ? ? ? 12.000 ? 1.048 ? ? 0.040 0.012 0 19 1 0.999 ? 
4.880 50.000 ? ? ? ? ? 1377 ? 88.700  ? ? ? ? 0.035 ? ? ? ? ? ? ? ? 12.000 ? 1.054 ? ? 0.037 0.010 0 20 1 0.999 ? 
# 
_refine.aniso_B[1][1]                            ? 
_refine.aniso_B[1][2]                            ? 
_refine.aniso_B[1][3]                            ? 
_refine.aniso_B[2][2]                            ? 
_refine.aniso_B[2][3]                            ? 
_refine.aniso_B[3][3]                            ? 
_refine.B_iso_max                                106.380 
_refine.B_iso_mean                               44.6700 
_refine.B_iso_min                                24.060 
_refine.correlation_coeff_Fo_to_Fc               ? 
_refine.correlation_coeff_Fo_to_Fc_free          ? 
_refine.details                                  ? 
_refine.diff_density_max                         ? 
_refine.diff_density_max_esd                     ? 
_refine.diff_density_min                         ? 
_refine.diff_density_min_esd                     ? 
_refine.diff_density_rms                         ? 
_refine.diff_density_rms_esd                     ? 
_refine.entry_id                                 4ZI0 
_refine.pdbx_refine_id                           'X-RAY DIFFRACTION' 
_refine.ls_abs_structure_details                 ? 
_refine.ls_abs_structure_Flack                   ? 
_refine.ls_abs_structure_Flack_esd               ? 
_refine.ls_abs_structure_Rogers                  ? 
_refine.ls_abs_structure_Rogers_esd              ? 
_refine.ls_d_res_high                            1.8020 
_refine.ls_d_res_low                             32.2780 
_refine.ls_extinction_coef                       ? 
_refine.ls_extinction_coef_esd                   ? 
_refine.ls_extinction_expression                 ? 
_refine.ls_extinction_method                     ? 
_refine.ls_goodness_of_fit_all                   ? 
_refine.ls_goodness_of_fit_all_esd               ? 
_refine.ls_goodness_of_fit_obs                   ? 
_refine.ls_goodness_of_fit_obs_esd               ? 
_refine.ls_hydrogen_treatment                    ? 
_refine.ls_matrix_type                           ? 
_refine.ls_number_constraints                    ? 
_refine.ls_number_parameters                     ? 
_refine.ls_number_reflns_all                     ? 
_refine.ls_number_reflns_obs                     26966 
_refine.ls_number_reflns_R_free                  1354 
_refine.ls_number_reflns_R_work                  25612 
_refine.ls_number_restraints                     ? 
_refine.ls_percent_reflns_obs                    98.8600 
_refine.ls_percent_reflns_R_free                 5.0200 
_refine.ls_R_factor_all                          ? 
_refine.ls_R_factor_obs                          0.2011 
_refine.ls_R_factor_R_free                       0.2247 
_refine.ls_R_factor_R_free_error                 ? 
_refine.ls_R_factor_R_free_error_details         ? 
_refine.ls_R_factor_R_work                       0.1998 
_refine.ls_R_Fsqd_factor_obs                     ? 
_refine.ls_R_I_factor_obs                        ? 
_refine.ls_redundancy_reflns_all                 ? 
_refine.ls_redundancy_reflns_obs                 ? 
_refine.ls_restrained_S_all                      ? 
_refine.ls_restrained_S_obs                      ? 
_refine.ls_shift_over_esd_max                    ? 
_refine.ls_shift_over_esd_mean                   ? 
_refine.ls_structure_factor_coef                 ? 
_refine.ls_weighting_details                     ? 
_refine.ls_weighting_scheme                      ? 
_refine.ls_wR_factor_all                         ? 
_refine.ls_wR_factor_obs                         ? 
_refine.ls_wR_factor_R_free                      ? 
_refine.ls_wR_factor_R_work                      ? 
_refine.occupancy_max                            ? 
_refine.occupancy_min                            ? 
_refine.solvent_model_details                    'FLAT BULK SOLVENT MODEL' 
_refine.solvent_model_param_bsol                 ? 
_refine.solvent_model_param_ksol                 ? 
_refine.ls_R_factor_gt                           ? 
_refine.ls_goodness_of_fit_gt                    ? 
_refine.ls_goodness_of_fit_ref                   ? 
_refine.ls_shift_over_su_max                     ? 
_refine.ls_shift_over_su_max_lt                  ? 
_refine.ls_shift_over_su_mean                    ? 
_refine.ls_shift_over_su_mean_lt                 ? 
_refine.pdbx_ls_sigma_I                          ? 
_refine.pdbx_ls_sigma_F                          1.340 
_refine.pdbx_ls_sigma_Fsqd                       ? 
_refine.pdbx_data_cutoff_high_absF               ? 
_refine.pdbx_data_cutoff_high_rms_absF           ? 
_refine.pdbx_data_cutoff_low_absF                ? 
_refine.pdbx_isotropic_thermal_model             ? 
_refine.pdbx_ls_cross_valid_method               'FREE R-VALUE' 
_refine.pdbx_method_to_determine_struct          'MOLECULAR REPLACEMENT' 
_refine.pdbx_starting_model                      4M5Q 
_refine.pdbx_stereochemistry_target_values       ML 
_refine.pdbx_R_Free_selection_details            ? 
_refine.pdbx_stereochem_target_val_spec_case     ? 
_refine.pdbx_overall_ESU_R                       ? 
_refine.pdbx_overall_ESU_R_Free                  ? 
_refine.pdbx_solvent_vdw_probe_radii             1.1100 
_refine.pdbx_solvent_ion_probe_radii             ? 
_refine.pdbx_solvent_shrinkage_radii             0.9000 
_refine.pdbx_real_space_R                        ? 
_refine.pdbx_density_correlation                 ? 
_refine.pdbx_pd_number_of_powder_patterns        ? 
_refine.pdbx_pd_number_of_points                 ? 
_refine.pdbx_pd_meas_number_of_points            ? 
_refine.pdbx_pd_proc_ls_prof_R_factor            ? 
_refine.pdbx_pd_proc_ls_prof_wR_factor           ? 
_refine.pdbx_pd_Marquardt_correlation_coeff      ? 
_refine.pdbx_pd_Fsqrd_R_factor                   ? 
_refine.pdbx_pd_ls_matrix_band_width             ? 
_refine.pdbx_overall_phase_error                 23.7700 
_refine.pdbx_overall_SU_R_free_Cruickshank_DPI   ? 
_refine.pdbx_overall_SU_R_free_Blow_DPI          ? 
_refine.pdbx_overall_SU_R_Blow_DPI               ? 
_refine.pdbx_TLS_residual_ADP_flag               ? 
_refine.pdbx_diffrn_id                           1 
_refine.overall_SU_B                             ? 
_refine.overall_SU_ML                            0.1800 
_refine.overall_SU_R_Cruickshank_DPI             ? 
_refine.overall_SU_R_free                        ? 
_refine.overall_FOM_free_R_set                   ? 
_refine.overall_FOM_work_R_set                   0.8247 
_refine.pdbx_average_fsc_overall                 ? 
_refine.pdbx_average_fsc_work                    ? 
_refine.pdbx_average_fsc_free                    ? 
# 
_refine_hist.cycle_id                         final 
_refine_hist.pdbx_refine_id                   'X-RAY DIFFRACTION' 
_refine_hist.d_res_high                       1.8020 
_refine_hist.d_res_low                        32.2780 
_refine_hist.pdbx_number_atoms_ligand         26 
_refine_hist.number_atoms_solvent             203 
_refine_hist.number_atoms_total               1722 
_refine_hist.pdbx_number_residues_total       181 
_refine_hist.pdbx_B_iso_mean_ligand           56.51 
_refine_hist.pdbx_B_iso_mean_solvent          55.15 
_refine_hist.pdbx_number_atoms_protein        1493 
_refine_hist.pdbx_number_atoms_nucleic_acid   0 
# 
loop_
_refine_ls_restr.pdbx_refine_id 
_refine_ls_restr.criterion 
_refine_ls_restr.dev_ideal 
_refine_ls_restr.dev_ideal_target 
_refine_ls_restr.number 
_refine_ls_restr.rejects 
_refine_ls_restr.type 
_refine_ls_restr.weight 
_refine_ls_restr.pdbx_restraint_function 
'X-RAY DIFFRACTION' ? 0.013  ? 1547 ? f_bond_d           ? ? 
'X-RAY DIFFRACTION' ? 1.435  ? 2077 ? f_angle_d          ? ? 
'X-RAY DIFFRACTION' ? 0.096  ? 218  ? f_chiral_restr     ? ? 
'X-RAY DIFFRACTION' ? 0.006  ? 265  ? f_plane_restr      ? ? 
'X-RAY DIFFRACTION' ? 15.157 ? 585  ? f_dihedral_angle_d ? ? 
# 
loop_
_refine_ls_shell.pdbx_refine_id 
_refine_ls_shell.d_res_high 
_refine_ls_shell.d_res_low 
_refine_ls_shell.number_reflns_all 
_refine_ls_shell.number_reflns_obs 
_refine_ls_shell.number_reflns_R_free 
_refine_ls_shell.number_reflns_R_work 
_refine_ls_shell.percent_reflns_obs 
_refine_ls_shell.percent_reflns_R_free 
_refine_ls_shell.R_factor_all 
_refine_ls_shell.R_factor_obs 
_refine_ls_shell.R_factor_R_free 
_refine_ls_shell.R_factor_R_free_error 
_refine_ls_shell.R_factor_R_work 
_refine_ls_shell.redundancy_reflns_all 
_refine_ls_shell.redundancy_reflns_obs 
_refine_ls_shell.wR_factor_all 
_refine_ls_shell.wR_factor_obs 
_refine_ls_shell.wR_factor_R_free 
_refine_ls_shell.wR_factor_R_work 
_refine_ls_shell.pdbx_total_number_of_bins_used 
_refine_ls_shell.pdbx_phase_error 
_refine_ls_shell.pdbx_fsc_work 
_refine_ls_shell.pdbx_fsc_free 
'X-RAY DIFFRACTION' 1.8016 1.8659  2658 . 128 2530 99.0000  . . . 0.2950 . 0.2821 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 1.8659 1.9406  2673 . 122 2551 100.0000 . . . 0.3151 . 0.2721 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 1.9406 2.0290  2668 . 147 2521 100.0000 . . . 0.2596 . 0.2575 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.0290 2.1359  2686 . 122 2564 100.0000 . . . 0.2829 . 0.2374 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.1359 2.2697  2684 . 141 2543 100.0000 . . . 0.2782 . 0.2211 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.2697 2.4449  2709 . 137 2572 100.0000 . . . 0.2482 . 0.2263 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.4449 2.6908  2708 . 141 2567 100.0000 . . . 0.2409 . 0.2122 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 2.6908 3.0799  2739 . 148 2591 100.0000 . . . 0.2417 . 0.2008 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.0799 3.8793  2750 . 134 2616 99.0000  . . . 0.2045 . 0.1765 . . . . . . 10 . . . 
'X-RAY DIFFRACTION' 3.8793 32.2836 2691 . 134 2557 91.0000  . . . 0.1918 . 0.1836 . . . . . . 10 . . . 
# 
_struct.entry_id                     4ZI0 
_struct.title                        
;Endonuclease inhibitor bound to influenza strain H1N1 polymerase acidic subunit N-terminal region without a chelation to the metal ions in the active site
;
_struct.pdbx_model_details           'RNA binding protein' 
_struct.pdbx_formula_weight          ? 
_struct.pdbx_formula_weight_method   ? 
_struct.pdbx_model_type_details      ? 
_struct.pdbx_CASP_flag               ? 
# 
_struct_keywords.entry_id        4ZI0 
_struct_keywords.text            'Hydrolase-Hydrolase Inhibitor complex' 
_struct_keywords.pdbx_keywords   'HYDROLASE/HYDROLASE INHIBITOR' 
# 
loop_
_struct_asym.id 
_struct_asym.pdbx_blank_PDB_chainid_flag 
_struct_asym.pdbx_modified 
_struct_asym.entity_id 
_struct_asym.details 
A N N 1 ? 
B N N 2 ? 
C N N 3 ? 
D N N 3 ? 
E N N 4 ? 
F N N 5 ? 
# 
loop_
_struct_conf.conf_type_id 
_struct_conf.id 
_struct_conf.pdbx_PDB_helix_id 
_struct_conf.beg_label_comp_id 
_struct_conf.beg_label_asym_id 
_struct_conf.beg_label_seq_id 
_struct_conf.pdbx_beg_PDB_ins_code 
_struct_conf.end_label_comp_id 
_struct_conf.end_label_asym_id 
_struct_conf.end_label_seq_id 
_struct_conf.pdbx_end_PDB_ins_code 
_struct_conf.beg_auth_comp_id 
_struct_conf.beg_auth_asym_id 
_struct_conf.beg_auth_seq_id 
_struct_conf.end_auth_comp_id 
_struct_conf.end_auth_asym_id 
_struct_conf.end_auth_seq_id 
_struct_conf.pdbx_PDB_helix_class 
_struct_conf.details 
_struct_conf.pdbx_PDB_helix_length 
HELX_P HELX_P1 AA1 SER A 5   ? PHE A 14  ? SER A 0   PHE A 9   1 ? 10 
HELX_P HELX_P2 AA2 ASN A 15  ? TYR A 29  ? ASN A 10  TYR A 24  1 ? 15 
HELX_P HELX_P3 AA3 GLU A 36  ? ALA A 56  ? GLU A 31  ALA A 51  1 ? 21 
HELX_P HELX_P4 AA4 ASP A 68  ? GLY A 84  ? ASP A 83  GLY A 99  1 ? 17 
HELX_P HELX_P5 AA5 GLU A 111 ? LYS A 124 ? GLU A 126 LYS A 139 1 ? 14 
HELX_P HELX_P6 AA6 LYS A 143 ? ASP A 145 ? LYS A 158 ASP A 160 5 ? 3  
HELX_P HELX_P7 AA7 ASP A 149 ? ARG A 170 ? ASP A 164 ARG A 185 1 ? 22 
HELX_P HELX_P8 AA8 LEU A 172 ? GLU A 180 ? LEU A 187 GLU A 195 1 ? 9  
# 
_struct_conf_type.id          HELX_P 
_struct_conf_type.criteria    ? 
_struct_conf_type.reference   ? 
# 
loop_
_struct_conn.id 
_struct_conn.conn_type_id 
_struct_conn.pdbx_leaving_atom_flag 
_struct_conn.pdbx_PDB_id 
_struct_conn.ptnr1_label_asym_id 
_struct_conn.ptnr1_label_comp_id 
_struct_conn.ptnr1_label_seq_id 
_struct_conn.ptnr1_label_atom_id 
_struct_conn.pdbx_ptnr1_label_alt_id 
_struct_conn.pdbx_ptnr1_PDB_ins_code 
_struct_conn.pdbx_ptnr1_standard_comp_id 
_struct_conn.ptnr1_symmetry 
_struct_conn.ptnr2_label_asym_id 
_struct_conn.ptnr2_label_comp_id 
_struct_conn.ptnr2_label_seq_id 
_struct_conn.ptnr2_label_atom_id 
_struct_conn.pdbx_ptnr2_label_alt_id 
_struct_conn.pdbx_ptnr2_PDB_ins_code 
_struct_conn.ptnr1_auth_asym_id 
_struct_conn.ptnr1_auth_comp_id 
_struct_conn.ptnr1_auth_seq_id 
_struct_conn.ptnr2_auth_asym_id 
_struct_conn.ptnr2_auth_comp_id 
_struct_conn.ptnr2_auth_seq_id 
_struct_conn.ptnr2_symmetry 
_struct_conn.pdbx_ptnr3_label_atom_id 
_struct_conn.pdbx_ptnr3_label_seq_id 
_struct_conn.pdbx_ptnr3_label_comp_id 
_struct_conn.pdbx_ptnr3_label_asym_id 
_struct_conn.pdbx_ptnr3_label_alt_id 
_struct_conn.pdbx_ptnr3_PDB_ins_code 
_struct_conn.details 
_struct_conn.pdbx_dist_value 
_struct_conn.pdbx_value_order 
_struct_conn.pdbx_role 
metalc1  metalc ? ? A HIS 46  NE2 ? ? ? 1_555 C MN  . MN ? ? A HIS 41  A MN  302 1_555 ? ? ? ? ? ? ? 2.370 ? ? 
metalc2  metalc ? ? A GLU 65  OE1 ? ? ? 1_555 D MN  . MN ? ? A GLU 80  A MN  303 1_555 ? ? ? ? ? ? ? 2.241 ? ? 
metalc3  metalc ? ? A ASP 93  OD2 ? ? ? 1_555 C MN  . MN ? ? A ASP 108 A MN  302 1_555 ? ? ? ? ? ? ? 2.190 ? ? 
metalc4  metalc ? ? A ASP 93  OD1 ? ? ? 1_555 D MN  . MN ? ? A ASP 108 A MN  303 1_555 ? ? ? ? ? ? ? 2.188 ? ? 
metalc5  metalc ? ? A GLU 104 OE2 ? ? ? 1_555 C MN  . MN ? ? A GLU 119 A MN  302 1_555 ? ? ? ? ? ? ? 2.170 ? ? 
metalc6  metalc ? ? A ILE 105 O   ? ? ? 1_555 C MN  . MN ? ? A ILE 120 A MN  302 1_555 ? ? ? ? ? ? ? 2.327 ? ? 
metalc7  metalc ? ? C MN  .   MN  ? ? ? 1_555 F HOH . O  ? ? A MN  302 A HOH 508 1_555 ? ? ? ? ? ? ? 2.423 ? ? 
metalc8  metalc ? ? C MN  .   MN  ? ? ? 1_555 F HOH . O  ? ? A MN  302 A HOH 524 1_555 ? ? ? ? ? ? ? 2.198 ? ? 
metalc9  metalc ? ? D MN  .   MN  ? ? ? 1_555 F HOH . O  ? ? A MN  303 A HOH 435 1_555 ? ? ? ? ? ? ? 1.967 ? ? 
metalc10 metalc ? ? D MN  .   MN  ? ? ? 1_555 F HOH . O  ? ? A MN  303 A HOH 481 1_555 ? ? ? ? ? ? ? 2.282 ? ? 
metalc11 metalc ? ? D MN  .   MN  ? ? ? 1_555 F HOH . O  ? ? A MN  303 A HOH 524 1_555 ? ? ? ? ? ? ? 2.106 ? ? 
metalc12 metalc ? ? D MN  .   MN  ? ? ? 1_555 F HOH . O  ? ? A MN  303 A HOH 537 1_555 ? ? ? ? ? ? ? 2.260 ? ? 
# 
_struct_conn_type.id          metalc 
_struct_conn_type.criteria    ? 
_struct_conn_type.reference   ? 
# 
_struct_sheet.id               AA1 
_struct_sheet.type             ? 
_struct_sheet.number_strands   5 
_struct_sheet.details          ? 
# 
loop_
_struct_sheet_order.sheet_id 
_struct_sheet_order.range_id_1 
_struct_sheet_order.range_id_2 
_struct_sheet_order.offset 
_struct_sheet_order.sense 
AA1 1 2 ? anti-parallel 
AA1 2 3 ? anti-parallel 
AA1 3 4 ? parallel      
AA1 4 5 ? anti-parallel 
# 
loop_
_struct_sheet_range.sheet_id 
_struct_sheet_range.id 
_struct_sheet_range.beg_label_comp_id 
_struct_sheet_range.beg_label_asym_id 
_struct_sheet_range.beg_label_seq_id 
_struct_sheet_range.pdbx_beg_PDB_ins_code 
_struct_sheet_range.end_label_comp_id 
_struct_sheet_range.end_label_asym_id 
_struct_sheet_range.end_label_seq_id 
_struct_sheet_range.pdbx_end_PDB_ins_code 
_struct_sheet_range.beg_auth_comp_id 
_struct_sheet_range.beg_auth_asym_id 
_struct_sheet_range.beg_auth_seq_id 
_struct_sheet_range.end_auth_comp_id 
_struct_sheet_range.end_auth_asym_id 
_struct_sheet_range.end_auth_seq_id 
AA1 1 PHE A 61  ? ILE A 63  ? PHE A 76  ILE A 78  
AA1 2 LEU A 94  ? ASP A 96  ? LEU A 109 ASP A 111 
AA1 3 ARG A 101 ? THR A 108 ? ARG A 116 THR A 123 
AA1 4 HIS A 129 ? SER A 134 ? HIS A 144 SER A 149 
AA1 5 GLU A 139 ? ALA A 141 ? GLU A 154 ALA A 156 
# 
loop_
_pdbx_struct_sheet_hbond.sheet_id 
_pdbx_struct_sheet_hbond.range_id_1 
_pdbx_struct_sheet_hbond.range_id_2 
_pdbx_struct_sheet_hbond.range_1_label_atom_id 
_pdbx_struct_sheet_hbond.range_1_label_comp_id 
_pdbx_struct_sheet_hbond.range_1_label_asym_id 
_pdbx_struct_sheet_hbond.range_1_label_seq_id 
_pdbx_struct_sheet_hbond.range_1_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_1_auth_atom_id 
_pdbx_struct_sheet_hbond.range_1_auth_comp_id 
_pdbx_struct_sheet_hbond.range_1_auth_asym_id 
_pdbx_struct_sheet_hbond.range_1_auth_seq_id 
_pdbx_struct_sheet_hbond.range_2_label_atom_id 
_pdbx_struct_sheet_hbond.range_2_label_comp_id 
_pdbx_struct_sheet_hbond.range_2_label_asym_id 
_pdbx_struct_sheet_hbond.range_2_label_seq_id 
_pdbx_struct_sheet_hbond.range_2_PDB_ins_code 
_pdbx_struct_sheet_hbond.range_2_auth_atom_id 
_pdbx_struct_sheet_hbond.range_2_auth_comp_id 
_pdbx_struct_sheet_hbond.range_2_auth_asym_id 
_pdbx_struct_sheet_hbond.range_2_auth_seq_id 
AA1 1 2 N GLU A 62  ? N GLU A 77  O TYR A 95  ? O TYR A 110 
AA1 2 3 N ASP A 96  ? N ASP A 111 O ARG A 101 ? O ARG A 116 
AA1 3 4 N GLU A 104 ? N GLU A 119 O HIS A 129 ? O HIS A 144 
AA1 4 5 N ILE A 132 ? N ILE A 147 O MET A 140 ? O MET A 155 
# 
loop_
_struct_site.id 
_struct_site.pdbx_evidence_code 
_struct_site.pdbx_auth_asym_id 
_struct_site.pdbx_auth_comp_id 
_struct_site.pdbx_auth_seq_id 
_struct_site.pdbx_auth_ins_code 
_struct_site.pdbx_num_residues 
_struct_site.details 
AC1 Software A SO4 301 ? 4  'binding site for residue SO4 A 301' 
AC2 Software A MN  302 ? 6  'binding site for residue MN A 302'  
AC3 Software A MN  303 ? 6  'binding site for residue MN A 303'  
AC4 Software A 4P9 304 ? 10 'binding site for residue 4P9 A 304' 
# 
loop_
_struct_site_gen.id 
_struct_site_gen.site_id 
_struct_site_gen.pdbx_num_res 
_struct_site_gen.label_comp_id 
_struct_site_gen.label_asym_id 
_struct_site_gen.label_seq_id 
_struct_site_gen.pdbx_auth_ins_code 
_struct_site_gen.auth_comp_id 
_struct_site_gen.auth_asym_id 
_struct_site_gen.auth_seq_id 
_struct_site_gen.label_atom_id 
_struct_site_gen.label_alt_id 
_struct_site_gen.symmetry 
_struct_site_gen.details 
1  AC1 4  ARG A 109 ? ARG A 124 . ? 1_555 ? 
2  AC1 4  ARG A 164 ? ARG A 179 . ? 1_555 ? 
3  AC1 4  TRP A 173 ? TRP A 188 . ? 1_555 ? 
4  AC1 4  ARG A 177 ? ARG A 192 . ? 1_555 ? 
5  AC2 6  HIS A 46  ? HIS A 41  . ? 1_555 ? 
6  AC2 6  ASP A 93  ? ASP A 108 . ? 1_555 ? 
7  AC2 6  GLU A 104 ? GLU A 119 . ? 1_555 ? 
8  AC2 6  ILE A 105 ? ILE A 120 . ? 1_555 ? 
9  AC2 6  HOH F .   ? HOH A 508 . ? 1_555 ? 
10 AC2 6  HOH F .   ? HOH A 524 . ? 1_555 ? 
11 AC3 6  GLU A 65  ? GLU A 80  . ? 1_555 ? 
12 AC3 6  ASP A 93  ? ASP A 108 . ? 1_555 ? 
13 AC3 6  HOH F .   ? HOH A 435 . ? 1_555 ? 
14 AC3 6  HOH F .   ? HOH A 481 . ? 1_555 ? 
15 AC3 6  HOH F .   ? HOH A 524 . ? 1_555 ? 
16 AC3 6  HOH F .   ? HOH A 537 . ? 1_555 ? 
17 AC4 10 GLU A 36  ? GLU A 31  . ? 1_555 ? 
18 AC4 10 LYS A 39  ? LYS A 34  . ? 1_555 ? 
19 AC4 10 ALA A 42  ? ALA A 37  . ? 1_555 ? 
20 AC4 10 THR A 108 ? THR A 123 . ? 1_555 ? 
21 AC4 10 ARG A 109 ? ARG A 124 . ? 1_555 ? 
22 AC4 10 PHE A 135 ? PHE A 150 . ? 1_555 ? 
23 AC4 10 PHE A 176 ? PHE A 191 . ? 1_555 ? 
24 AC4 10 SER A 179 ? SER A 194 . ? 1_555 ? 
25 AC4 10 GLU A 180 ? GLU A 195 . ? 1_555 ? 
26 AC4 10 HOH F .   ? HOH A 411 . ? 1_555 ? 
# 
_atom_sites.entry_id                    4ZI0 
_atom_sites.fract_transf_matrix[1][1]   0.014979 
_atom_sites.fract_transf_matrix[1][2]   0.000000 
_atom_sites.fract_transf_matrix[1][3]   0.000000 
_atom_sites.fract_transf_matrix[2][1]   0.000000 
_atom_sites.fract_transf_matrix[2][2]   0.014979 
_atom_sites.fract_transf_matrix[2][3]   0.000000 
_atom_sites.fract_transf_matrix[3][1]   0.000000 
_atom_sites.fract_transf_matrix[3][2]   0.000000 
_atom_sites.fract_transf_matrix[3][3]   0.007890 
_atom_sites.fract_transf_vector[1]      0.000000 
_atom_sites.fract_transf_vector[2]      0.000000 
_atom_sites.fract_transf_vector[3]      0.000000 
# 
loop_
_atom_type.symbol 
C  
CL 
MN 
N  
O  
S  
# 
loop_
_pdbx_poly_seq_scheme.asym_id 
_pdbx_poly_seq_scheme.entity_id 
_pdbx_poly_seq_scheme.seq_id 
_pdbx_poly_seq_scheme.mon_id 
_pdbx_poly_seq_scheme.ndb_seq_num 
_pdbx_poly_seq_scheme.pdb_seq_num 
_pdbx_poly_seq_scheme.auth_seq_num 
_pdbx_poly_seq_scheme.pdb_mon_id 
_pdbx_poly_seq_scheme.auth_mon_id 
_pdbx_poly_seq_scheme.pdb_strand_id 
_pdbx_poly_seq_scheme.pdb_ins_code 
_pdbx_poly_seq_scheme.hetero 
A 1 1   GLY 1   -4  -4  GLY GLY A . n 
A 1 2   PRO 2   -3  -3  PRO PRO A . n 
A 1 3   LEU 3   -2  -2  LEU LEU A . n 
A 1 4   GLY 4   -1  -1  GLY GLY A . n 
A 1 5   SER 5   0   0   SER SER A . n 
A 1 6   MET 6   1   1   MET MET A . n 
A 1 7   GLU 7   2   2   GLU GLU A . n 
A 1 8   ASP 8   3   3   ASP ASP A . n 
A 1 9   PHE 9   4   4   PHE PHE A . n 
A 1 10  VAL 10  5   5   VAL VAL A . n 
A 1 11  ARG 11  6   6   ARG ARG A . n 
A 1 12  GLN 12  7   7   GLN GLN A . n 
A 1 13  CYS 13  8   8   CYS CYS A . n 
A 1 14  PHE 14  9   9   PHE PHE A . n 
A 1 15  ASN 15  10  10  ASN ASN A . n 
A 1 16  PRO 16  11  11  PRO PRO A . n 
A 1 17  MET 17  12  12  MET MET A . n 
A 1 18  ILE 18  13  13  ILE ILE A . n 
A 1 19  VAL 19  14  14  VAL VAL A . n 
A 1 20  GLU 20  15  15  GLU GLU A . n 
A 1 21  LEU 21  16  16  LEU LEU A . n 
A 1 22  ALA 22  17  17  ALA ALA A . n 
A 1 23  GLU 23  18  18  GLU GLU A . n 
A 1 24  LYS 24  19  19  LYS LYS A . n 
A 1 25  THR 25  20  20  THR THR A . n 
A 1 26  MET 26  21  21  MET MET A . n 
A 1 27  LYS 27  22  22  LYS LYS A . n 
A 1 28  GLU 28  23  23  GLU GLU A . n 
A 1 29  TYR 29  24  24  TYR TYR A . n 
A 1 30  GLY 30  25  25  GLY GLY A . n 
A 1 31  GLU 31  26  26  GLU GLU A . n 
A 1 32  ASP 32  27  27  ASP ASP A . n 
A 1 33  LEU 33  28  28  LEU LEU A . n 
A 1 34  LYS 34  29  29  LYS LYS A . n 
A 1 35  ILE 35  30  30  ILE ILE A . n 
A 1 36  GLU 36  31  31  GLU GLU A . n 
A 1 37  THR 37  32  32  THR THR A . n 
A 1 38  ASN 38  33  33  ASN ASN A . n 
A 1 39  LYS 39  34  34  LYS LYS A . n 
A 1 40  PHE 40  35  35  PHE PHE A . n 
A 1 41  ALA 41  36  36  ALA ALA A . n 
A 1 42  ALA 42  37  37  ALA ALA A . n 
A 1 43  ILE 43  38  38  ILE ILE A . n 
A 1 44  CYS 44  39  39  CYS CYS A . n 
A 1 45  THR 45  40  40  THR THR A . n 
A 1 46  HIS 46  41  41  HIS HIS A . n 
A 1 47  LEU 47  42  42  LEU LEU A . n 
A 1 48  GLU 48  43  43  GLU GLU A . n 
A 1 49  VAL 49  44  44  VAL VAL A . n 
A 1 50  CYS 50  45  45  CYS CYS A . n 
A 1 51  PHE 51  46  46  PHE PHE A . n 
A 1 52  MET 52  47  47  MET MET A . n 
A 1 53  TYR 53  48  48  TYR TYR A . n 
A 1 54  SER 54  49  49  SER SER A . n 
A 1 55  ASP 55  50  50  ASP ASP A . n 
A 1 56  ALA 56  51  51  ALA ALA A . n 
A 1 57  SER 57  52  52  SER SER A . n 
A 1 58  LYS 58  73  73  LYS LYS A . n 
A 1 59  HIS 59  74  74  HIS HIS A . n 
A 1 60  ARG 60  75  75  ARG ARG A . n 
A 1 61  PHE 61  76  76  PHE PHE A . n 
A 1 62  GLU 62  77  77  GLU GLU A . n 
A 1 63  ILE 63  78  78  ILE ILE A . n 
A 1 64  ILE 64  79  79  ILE ILE A . n 
A 1 65  GLU 65  80  80  GLU GLU A . n 
A 1 66  GLY 66  81  81  GLY GLY A . n 
A 1 67  ARG 67  82  82  ARG ARG A . n 
A 1 68  ASP 68  83  83  ASP ASP A . n 
A 1 69  ARG 69  84  84  ARG ARG A . n 
A 1 70  THR 70  85  85  THR THR A . n 
A 1 71  MET 71  86  86  MET MET A . n 
A 1 72  ALA 72  87  87  ALA ALA A . n 
A 1 73  TRP 73  88  88  TRP TRP A . n 
A 1 74  THR 74  89  89  THR THR A . n 
A 1 75  VAL 75  90  90  VAL VAL A . n 
A 1 76  VAL 76  91  91  VAL VAL A . n 
A 1 77  ASN 77  92  92  ASN ASN A . n 
A 1 78  SER 78  93  93  SER SER A . n 
A 1 79  ILE 79  94  94  ILE ILE A . n 
A 1 80  CYS 80  95  95  CYS CYS A . n 
A 1 81  ASN 81  96  96  ASN ASN A . n 
A 1 82  THR 82  97  97  THR THR A . n 
A 1 83  THR 83  98  98  THR THR A . n 
A 1 84  GLY 84  99  99  GLY GLY A . n 
A 1 85  ALA 85  100 100 ALA ALA A . n 
A 1 86  GLU 86  101 101 GLU GLU A . n 
A 1 87  LYS 87  102 102 LYS LYS A . n 
A 1 88  PRO 88  103 103 PRO PRO A . n 
A 1 89  LYS 89  104 104 LYS LYS A . n 
A 1 90  PHE 90  105 105 PHE PHE A . n 
A 1 91  LEU 91  106 106 LEU LEU A . n 
A 1 92  PRO 92  107 107 PRO PRO A . n 
A 1 93  ASP 93  108 108 ASP ASP A . n 
A 1 94  LEU 94  109 109 LEU LEU A . n 
A 1 95  TYR 95  110 110 TYR TYR A . n 
A 1 96  ASP 96  111 111 ASP ASP A . n 
A 1 97  TYR 97  112 112 TYR TYR A . n 
A 1 98  LYS 98  113 113 LYS LYS A . n 
A 1 99  GLU 99  114 114 GLU GLU A . n 
A 1 100 ASN 100 115 115 ASN ASN A . n 
A 1 101 ARG 101 116 116 ARG ARG A . n 
A 1 102 PHE 102 117 117 PHE PHE A . n 
A 1 103 ILE 103 118 118 ILE ILE A . n 
A 1 104 GLU 104 119 119 GLU GLU A . n 
A 1 105 ILE 105 120 120 ILE ILE A . n 
A 1 106 GLY 106 121 121 GLY GLY A . n 
A 1 107 VAL 107 122 122 VAL VAL A . n 
A 1 108 THR 108 123 123 THR THR A . n 
A 1 109 ARG 109 124 124 ARG ARG A . n 
A 1 110 ARG 110 125 125 ARG ARG A . n 
A 1 111 GLU 111 126 126 GLU GLU A . n 
A 1 112 VAL 112 127 127 VAL VAL A . n 
A 1 113 HIS 113 128 128 HIS HIS A . n 
A 1 114 ILE 114 129 129 ILE ILE A . n 
A 1 115 TYR 115 130 130 TYR TYR A . n 
A 1 116 TYR 116 131 131 TYR TYR A . n 
A 1 117 LEU 117 132 132 LEU LEU A . n 
A 1 118 GLU 118 133 133 GLU GLU A . n 
A 1 119 LYS 119 134 134 LYS LYS A . n 
A 1 120 ALA 120 135 135 ALA ALA A . n 
A 1 121 ASN 121 136 136 ASN ASN A . n 
A 1 122 LYS 122 137 137 LYS LYS A . n 
A 1 123 ILE 123 138 138 ILE ILE A . n 
A 1 124 LYS 124 139 139 LYS LYS A . n 
A 1 125 SER 125 140 140 SER SER A . n 
A 1 126 GLU 126 141 141 GLU GLU A . n 
A 1 127 LYS 127 142 142 LYS LYS A . n 
A 1 128 THR 128 143 143 THR THR A . n 
A 1 129 HIS 129 144 144 HIS HIS A . n 
A 1 130 ILE 130 145 145 ILE ILE A . n 
A 1 131 HIS 131 146 146 HIS HIS A . n 
A 1 132 ILE 132 147 147 ILE ILE A . n 
A 1 133 PHE 133 148 148 PHE PHE A . n 
A 1 134 SER 134 149 149 SER SER A . n 
A 1 135 PHE 135 150 150 PHE PHE A . n 
A 1 136 THR 136 151 151 THR THR A . n 
A 1 137 GLY 137 152 152 GLY GLY A . n 
A 1 138 GLU 138 153 153 GLU GLU A . n 
A 1 139 GLU 139 154 154 GLU GLU A . n 
A 1 140 MET 140 155 155 MET MET A . n 
A 1 141 ALA 141 156 156 ALA ALA A . n 
A 1 142 THR 142 157 157 THR THR A . n 
A 1 143 LYS 143 158 158 LYS LYS A . n 
A 1 144 ALA 144 159 159 ALA ALA A . n 
A 1 145 ASP 145 160 160 ASP ASP A . n 
A 1 146 TYR 146 161 161 TYR TYR A . n 
A 1 147 THR 147 162 162 THR THR A . n 
A 1 148 LEU 148 163 163 LEU LEU A . n 
A 1 149 ASP 149 164 164 ASP ASP A . n 
A 1 150 GLU 150 165 165 GLU GLU A . n 
A 1 151 GLU 151 166 166 GLU GLU A . n 
A 1 152 SER 152 167 167 SER SER A . n 
A 1 153 ARG 153 168 168 ARG ARG A . n 
A 1 154 ALA 154 169 169 ALA ALA A . n 
A 1 155 ARG 155 170 170 ARG ARG A . n 
A 1 156 ILE 156 171 171 ILE ILE A . n 
A 1 157 LYS 157 172 172 LYS LYS A . n 
A 1 158 THR 158 173 173 THR THR A . n 
A 1 159 ARG 159 174 174 ARG ARG A . n 
A 1 160 LEU 160 175 175 LEU LEU A . n 
A 1 161 PHE 161 176 176 PHE PHE A . n 
A 1 162 THR 162 177 177 THR THR A . n 
A 1 163 ILE 163 178 178 ILE ILE A . n 
A 1 164 ARG 164 179 179 ARG ARG A . n 
A 1 165 GLN 165 180 180 GLN GLN A . n 
A 1 166 GLU 166 181 181 GLU GLU A . n 
A 1 167 MET 167 182 182 MET MET A . n 
A 1 168 ALA 168 183 183 ALA ALA A . n 
A 1 169 SER 169 184 184 SER SER A . n 
A 1 170 ARG 170 185 185 ARG ARG A . n 
A 1 171 GLY 171 186 186 GLY GLY A . n 
A 1 172 LEU 172 187 187 LEU LEU A . n 
A 1 173 TRP 173 188 188 TRP TRP A . n 
A 1 174 ASP 174 189 189 ASP ASP A . n 
A 1 175 SER 175 190 190 SER SER A . n 
A 1 176 PHE 176 191 191 PHE PHE A . n 
A 1 177 ARG 177 192 192 ARG ARG A . n 
A 1 178 GLN 178 193 193 GLN GLN A . n 
A 1 179 SER 179 194 194 SER SER A . n 
A 1 180 GLU 180 195 195 GLU GLU A . n 
A 1 181 ARG 181 196 196 ARG ARG A . n 
A 1 182 GLY 182 197 ?   ?   ?   A . n 
A 1 183 ALA 183 198 ?   ?   ?   A . n 
A 1 184 ALA 184 199 ?   ?   ?   A . n 
A 1 185 GLU 185 200 ?   ?   ?   A . n 
A 1 186 LEU 186 201 ?   ?   ?   A . n 
A 1 187 ALA 187 202 ?   ?   ?   A . n 
A 1 188 LEU 188 203 ?   ?   ?   A . n 
A 1 189 VAL 189 204 ?   ?   ?   A . n 
A 1 190 PRO 190 205 ?   ?   ?   A . n 
A 1 191 ARG 191 206 ?   ?   ?   A . n 
# 
loop_
_pdbx_nonpoly_scheme.asym_id 
_pdbx_nonpoly_scheme.entity_id 
_pdbx_nonpoly_scheme.mon_id 
_pdbx_nonpoly_scheme.ndb_seq_num 
_pdbx_nonpoly_scheme.pdb_seq_num 
_pdbx_nonpoly_scheme.auth_seq_num 
_pdbx_nonpoly_scheme.pdb_mon_id 
_pdbx_nonpoly_scheme.auth_mon_id 
_pdbx_nonpoly_scheme.pdb_strand_id 
_pdbx_nonpoly_scheme.pdb_ins_code 
B 2 SO4 1   301 1   SO4 SO4 A . 
C 3 MN  1   302 1   MN  MN  A . 
D 3 MN  1   303 2   MN  MN  A . 
E 4 4P9 1   304 1   4P9 DRG A . 
F 5 HOH 1   401 199 HOH HOH A . 
F 5 HOH 2   402 166 HOH HOH A . 
F 5 HOH 3   403 183 HOH HOH A . 
F 5 HOH 4   404 165 HOH HOH A . 
F 5 HOH 5   405 162 HOH HOH A . 
F 5 HOH 6   406 161 HOH HOH A . 
F 5 HOH 7   407 143 HOH HOH A . 
F 5 HOH 8   408 5   HOH HOH A . 
F 5 HOH 9   409 62  HOH HOH A . 
F 5 HOH 10  410 26  HOH HOH A . 
F 5 HOH 11  411 51  HOH HOH A . 
F 5 HOH 12  412 115 HOH HOH A . 
F 5 HOH 13  413 138 HOH HOH A . 
F 5 HOH 14  414 64  HOH HOH A . 
F 5 HOH 15  415 197 HOH HOH A . 
F 5 HOH 16  416 142 HOH HOH A . 
F 5 HOH 17  417 154 HOH HOH A . 
F 5 HOH 18  418 184 HOH HOH A . 
F 5 HOH 19  419 191 HOH HOH A . 
F 5 HOH 20  420 77  HOH HOH A . 
F 5 HOH 21  421 43  HOH HOH A . 
F 5 HOH 22  422 127 HOH HOH A . 
F 5 HOH 23  423 106 HOH HOH A . 
F 5 HOH 24  424 19  HOH HOH A . 
F 5 HOH 25  425 102 HOH HOH A . 
F 5 HOH 26  426 70  HOH HOH A . 
F 5 HOH 27  427 93  HOH HOH A . 
F 5 HOH 28  428 148 HOH HOH A . 
F 5 HOH 29  429 33  HOH HOH A . 
F 5 HOH 30  430 163 HOH HOH A . 
F 5 HOH 31  431 38  HOH HOH A . 
F 5 HOH 32  432 12  HOH HOH A . 
F 5 HOH 33  433 167 HOH HOH A . 
F 5 HOH 34  434 28  HOH HOH A . 
F 5 HOH 35  435 113 HOH HOH A . 
F 5 HOH 36  436 67  HOH HOH A . 
F 5 HOH 37  437 58  HOH HOH A . 
F 5 HOH 38  438 52  HOH HOH A . 
F 5 HOH 39  439 202 HOH HOH A . 
F 5 HOH 40  440 23  HOH HOH A . 
F 5 HOH 41  441 45  HOH HOH A . 
F 5 HOH 42  442 139 HOH HOH A . 
F 5 HOH 43  443 10  HOH HOH A . 
F 5 HOH 44  444 203 HOH HOH A . 
F 5 HOH 45  445 110 HOH HOH A . 
F 5 HOH 46  446 66  HOH HOH A . 
F 5 HOH 47  447 60  HOH HOH A . 
F 5 HOH 48  448 100 HOH HOH A . 
F 5 HOH 49  449 46  HOH HOH A . 
F 5 HOH 50  450 125 HOH HOH A . 
F 5 HOH 51  451 171 HOH HOH A . 
F 5 HOH 52  452 20  HOH HOH A . 
F 5 HOH 53  453 186 HOH HOH A . 
F 5 HOH 54  454 3   HOH HOH A . 
F 5 HOH 55  455 83  HOH HOH A . 
F 5 HOH 56  456 68  HOH HOH A . 
F 5 HOH 57  457 1   HOH HOH A . 
F 5 HOH 58  458 76  HOH HOH A . 
F 5 HOH 59  459 2   HOH HOH A . 
F 5 HOH 60  460 32  HOH HOH A . 
F 5 HOH 61  461 112 HOH HOH A . 
F 5 HOH 62  462 140 HOH HOH A . 
F 5 HOH 63  463 74  HOH HOH A . 
F 5 HOH 64  464 21  HOH HOH A . 
F 5 HOH 65  465 34  HOH HOH A . 
F 5 HOH 66  466 175 HOH HOH A . 
F 5 HOH 67  467 81  HOH HOH A . 
F 5 HOH 68  468 114 HOH HOH A . 
F 5 HOH 69  469 17  HOH HOH A . 
F 5 HOH 70  470 169 HOH HOH A . 
F 5 HOH 71  471 117 HOH HOH A . 
F 5 HOH 72  472 44  HOH HOH A . 
F 5 HOH 73  473 9   HOH HOH A . 
F 5 HOH 74  474 16  HOH HOH A . 
F 5 HOH 75  475 132 HOH HOH A . 
F 5 HOH 76  476 87  HOH HOH A . 
F 5 HOH 77  477 137 HOH HOH A . 
F 5 HOH 78  478 8   HOH HOH A . 
F 5 HOH 79  479 49  HOH HOH A . 
F 5 HOH 80  480 36  HOH HOH A . 
F 5 HOH 81  481 54  HOH HOH A . 
F 5 HOH 82  482 90  HOH HOH A . 
F 5 HOH 83  483 61  HOH HOH A . 
F 5 HOH 84  484 18  HOH HOH A . 
F 5 HOH 85  485 53  HOH HOH A . 
F 5 HOH 86  486 201 HOH HOH A . 
F 5 HOH 87  487 35  HOH HOH A . 
F 5 HOH 88  488 4   HOH HOH A . 
F 5 HOH 89  489 129 HOH HOH A . 
F 5 HOH 90  490 121 HOH HOH A . 
F 5 HOH 91  491 41  HOH HOH A . 
F 5 HOH 92  492 98  HOH HOH A . 
F 5 HOH 93  493 40  HOH HOH A . 
F 5 HOH 94  494 24  HOH HOH A . 
F 5 HOH 95  495 56  HOH HOH A . 
F 5 HOH 96  496 156 HOH HOH A . 
F 5 HOH 97  497 182 HOH HOH A . 
F 5 HOH 98  498 13  HOH HOH A . 
F 5 HOH 99  499 72  HOH HOH A . 
F 5 HOH 100 500 196 HOH HOH A . 
F 5 HOH 101 501 22  HOH HOH A . 
F 5 HOH 102 502 103 HOH HOH A . 
F 5 HOH 103 503 55  HOH HOH A . 
F 5 HOH 104 504 59  HOH HOH A . 
F 5 HOH 105 505 6   HOH HOH A . 
F 5 HOH 106 506 14  HOH HOH A . 
F 5 HOH 107 507 42  HOH HOH A . 
F 5 HOH 108 508 88  HOH HOH A . 
F 5 HOH 109 509 29  HOH HOH A . 
F 5 HOH 110 510 144 HOH HOH A . 
F 5 HOH 111 511 25  HOH HOH A . 
F 5 HOH 112 512 7   HOH HOH A . 
F 5 HOH 113 513 145 HOH HOH A . 
F 5 HOH 114 514 91  HOH HOH A . 
F 5 HOH 115 515 84  HOH HOH A . 
F 5 HOH 116 516 119 HOH HOH A . 
F 5 HOH 117 517 111 HOH HOH A . 
F 5 HOH 118 518 192 HOH HOH A . 
F 5 HOH 119 519 11  HOH HOH A . 
F 5 HOH 120 520 128 HOH HOH A . 
F 5 HOH 121 521 180 HOH HOH A . 
F 5 HOH 122 522 15  HOH HOH A . 
F 5 HOH 123 523 89  HOH HOH A . 
F 5 HOH 124 524 65  HOH HOH A . 
F 5 HOH 125 525 141 HOH HOH A . 
F 5 HOH 126 526 155 HOH HOH A . 
F 5 HOH 127 527 159 HOH HOH A . 
F 5 HOH 128 528 116 HOH HOH A . 
F 5 HOH 129 529 30  HOH HOH A . 
F 5 HOH 130 530 146 HOH HOH A . 
F 5 HOH 131 531 181 HOH HOH A . 
F 5 HOH 132 532 85  HOH HOH A . 
F 5 HOH 133 533 151 HOH HOH A . 
F 5 HOH 134 534 188 HOH HOH A . 
F 5 HOH 135 535 120 HOH HOH A . 
F 5 HOH 136 536 63  HOH HOH A . 
F 5 HOH 137 537 57  HOH HOH A . 
F 5 HOH 138 538 160 HOH HOH A . 
F 5 HOH 139 539 118 HOH HOH A . 
F 5 HOH 140 540 189 HOH HOH A . 
F 5 HOH 141 541 133 HOH HOH A . 
F 5 HOH 142 542 187 HOH HOH A . 
F 5 HOH 143 543 101 HOH HOH A . 
F 5 HOH 144 544 195 HOH HOH A . 
F 5 HOH 145 545 149 HOH HOH A . 
F 5 HOH 146 546 194 HOH HOH A . 
F 5 HOH 147 547 73  HOH HOH A . 
F 5 HOH 148 548 96  HOH HOH A . 
F 5 HOH 149 549 99  HOH HOH A . 
F 5 HOH 150 550 108 HOH HOH A . 
F 5 HOH 151 551 173 HOH HOH A . 
F 5 HOH 152 552 105 HOH HOH A . 
F 5 HOH 153 553 130 HOH HOH A . 
F 5 HOH 154 554 126 HOH HOH A . 
F 5 HOH 155 555 200 HOH HOH A . 
F 5 HOH 156 556 124 HOH HOH A . 
F 5 HOH 157 557 134 HOH HOH A . 
F 5 HOH 158 558 69  HOH HOH A . 
F 5 HOH 159 559 135 HOH HOH A . 
F 5 HOH 160 560 170 HOH HOH A . 
F 5 HOH 161 561 104 HOH HOH A . 
F 5 HOH 162 562 79  HOH HOH A . 
F 5 HOH 163 563 94  HOH HOH A . 
F 5 HOH 164 564 109 HOH HOH A . 
F 5 HOH 165 565 131 HOH HOH A . 
F 5 HOH 166 566 190 HOH HOH A . 
F 5 HOH 167 567 157 HOH HOH A . 
F 5 HOH 168 568 27  HOH HOH A . 
F 5 HOH 169 569 193 HOH HOH A . 
F 5 HOH 170 570 152 HOH HOH A . 
F 5 HOH 171 571 31  HOH HOH A . 
F 5 HOH 172 572 123 HOH HOH A . 
F 5 HOH 173 573 153 HOH HOH A . 
F 5 HOH 174 574 172 HOH HOH A . 
F 5 HOH 175 575 47  HOH HOH A . 
F 5 HOH 176 576 179 HOH HOH A . 
F 5 HOH 177 577 178 HOH HOH A . 
F 5 HOH 178 578 122 HOH HOH A . 
F 5 HOH 179 579 97  HOH HOH A . 
F 5 HOH 180 580 50  HOH HOH A . 
F 5 HOH 181 581 185 HOH HOH A . 
F 5 HOH 182 582 136 HOH HOH A . 
F 5 HOH 183 583 164 HOH HOH A . 
F 5 HOH 184 584 168 HOH HOH A . 
F 5 HOH 185 585 86  HOH HOH A . 
F 5 HOH 186 586 37  HOH HOH A . 
F 5 HOH 187 587 174 HOH HOH A . 
F 5 HOH 188 588 177 HOH HOH A . 
F 5 HOH 189 589 176 HOH HOH A . 
F 5 HOH 190 590 75  HOH HOH A . 
F 5 HOH 191 591 198 HOH HOH A . 
F 5 HOH 192 592 158 HOH HOH A . 
F 5 HOH 193 593 39  HOH HOH A . 
F 5 HOH 194 594 80  HOH HOH A . 
F 5 HOH 195 595 78  HOH HOH A . 
F 5 HOH 196 596 71  HOH HOH A . 
F 5 HOH 197 597 107 HOH HOH A . 
F 5 HOH 198 598 48  HOH HOH A . 
F 5 HOH 199 599 95  HOH HOH A . 
F 5 HOH 200 600 82  HOH HOH A . 
F 5 HOH 201 601 150 HOH HOH A . 
F 5 HOH 202 602 92  HOH HOH A . 
F 5 HOH 203 603 147 HOH HOH A . 
# 
_pdbx_struct_assembly.id                   1 
_pdbx_struct_assembly.details              author_and_software_defined_assembly 
_pdbx_struct_assembly.method_details       PISA 
_pdbx_struct_assembly.oligomeric_details   monomeric 
_pdbx_struct_assembly.oligomeric_count     1 
# 
_pdbx_struct_assembly_gen.assembly_id       1 
_pdbx_struct_assembly_gen.oper_expression   1 
_pdbx_struct_assembly_gen.asym_id_list      A,B,C,D,E,F 
# 
loop_
_pdbx_struct_assembly_prop.biol_id 
_pdbx_struct_assembly_prop.type 
_pdbx_struct_assembly_prop.value 
_pdbx_struct_assembly_prop.details 
1 'ABSA (A^2)' 180  ? 
1 MORE         -13  ? 
1 'SSA (A^2)'  9770 ? 
# 
_pdbx_struct_oper_list.id                   1 
_pdbx_struct_oper_list.type                 'identity operation' 
_pdbx_struct_oper_list.name                 1_555 
_pdbx_struct_oper_list.symmetry_operation   x,y,z 
_pdbx_struct_oper_list.matrix[1][1]         1.0000000000 
_pdbx_struct_oper_list.matrix[1][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[1][3]         0.0000000000 
_pdbx_struct_oper_list.vector[1]            0.0000000000 
_pdbx_struct_oper_list.matrix[2][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[2][2]         1.0000000000 
_pdbx_struct_oper_list.matrix[2][3]         0.0000000000 
_pdbx_struct_oper_list.vector[2]            0.0000000000 
_pdbx_struct_oper_list.matrix[3][1]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][2]         0.0000000000 
_pdbx_struct_oper_list.matrix[3][3]         1.0000000000 
_pdbx_struct_oper_list.vector[3]            0.0000000000 
# 
loop_
_pdbx_struct_conn_angle.id 
_pdbx_struct_conn_angle.ptnr1_label_atom_id 
_pdbx_struct_conn_angle.ptnr1_label_alt_id 
_pdbx_struct_conn_angle.ptnr1_label_asym_id 
_pdbx_struct_conn_angle.ptnr1_label_comp_id 
_pdbx_struct_conn_angle.ptnr1_label_seq_id 
_pdbx_struct_conn_angle.ptnr1_auth_atom_id 
_pdbx_struct_conn_angle.ptnr1_auth_asym_id 
_pdbx_struct_conn_angle.ptnr1_auth_comp_id 
_pdbx_struct_conn_angle.ptnr1_auth_seq_id 
_pdbx_struct_conn_angle.ptnr1_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr1_symmetry 
_pdbx_struct_conn_angle.ptnr2_label_atom_id 
_pdbx_struct_conn_angle.ptnr2_label_alt_id 
_pdbx_struct_conn_angle.ptnr2_label_asym_id 
_pdbx_struct_conn_angle.ptnr2_label_comp_id 
_pdbx_struct_conn_angle.ptnr2_label_seq_id 
_pdbx_struct_conn_angle.ptnr2_auth_atom_id 
_pdbx_struct_conn_angle.ptnr2_auth_asym_id 
_pdbx_struct_conn_angle.ptnr2_auth_comp_id 
_pdbx_struct_conn_angle.ptnr2_auth_seq_id 
_pdbx_struct_conn_angle.ptnr2_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr2_symmetry 
_pdbx_struct_conn_angle.ptnr3_label_atom_id 
_pdbx_struct_conn_angle.ptnr3_label_alt_id 
_pdbx_struct_conn_angle.ptnr3_label_asym_id 
_pdbx_struct_conn_angle.ptnr3_label_comp_id 
_pdbx_struct_conn_angle.ptnr3_label_seq_id 
_pdbx_struct_conn_angle.ptnr3_auth_atom_id 
_pdbx_struct_conn_angle.ptnr3_auth_asym_id 
_pdbx_struct_conn_angle.ptnr3_auth_comp_id 
_pdbx_struct_conn_angle.ptnr3_auth_seq_id 
_pdbx_struct_conn_angle.ptnr3_PDB_ins_code 
_pdbx_struct_conn_angle.ptnr3_symmetry 
_pdbx_struct_conn_angle.value 
_pdbx_struct_conn_angle.value_esd 
1  NE2 ? A HIS 46  ? A HIS 41  ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OD2 ? A ASP 93  ? A ASP 108 ? 1_555 95.0  ? 
2  NE2 ? A HIS 46  ? A HIS 41  ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OE2 ? A GLU 104 ? A GLU 119 ? 1_555 169.6 ? 
3  OD2 ? A ASP 93  ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 OE2 ? A GLU 104 ? A GLU 119 ? 1_555 89.8  ? 
4  NE2 ? A HIS 46  ? A HIS 41  ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O   ? A ILE 105 ? A ILE 120 ? 1_555 76.0  ? 
5  OD2 ? A ASP 93  ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O   ? A ILE 105 ? A ILE 120 ? 1_555 89.1  ? 
6  OE2 ? A GLU 104 ? A GLU 119 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O   ? A ILE 105 ? A ILE 120 ? 1_555 94.8  ? 
7  NE2 ? A HIS 46  ? A HIS 41  ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O   ? F HOH .   ? A HOH 508 ? 1_555 88.9  ? 
8  OD2 ? A ASP 93  ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O   ? F HOH .   ? A HOH 508 ? 1_555 174.8 ? 
9  OE2 ? A GLU 104 ? A GLU 119 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O   ? F HOH .   ? A HOH 508 ? 1_555 85.8  ? 
10 O   ? A ILE 105 ? A ILE 120 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O   ? F HOH .   ? A HOH 508 ? 1_555 88.5  ? 
11 NE2 ? A HIS 46  ? A HIS 41  ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O   ? F HOH .   ? A HOH 524 ? 1_555 92.6  ? 
12 OD2 ? A ASP 93  ? A ASP 108 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O   ? F HOH .   ? A HOH 524 ? 1_555 102.2 ? 
13 OE2 ? A GLU 104 ? A GLU 119 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O   ? F HOH .   ? A HOH 524 ? 1_555 95.5  ? 
14 O   ? A ILE 105 ? A ILE 120 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O   ? F HOH .   ? A HOH 524 ? 1_555 164.7 ? 
15 O   ? F HOH .   ? A HOH 508 ? 1_555 MN ? C MN . ? A MN 302 ? 1_555 O   ? F HOH .   ? A HOH 524 ? 1_555 80.9  ? 
16 OE1 ? A GLU 65  ? A GLU 80  ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 OD1 ? A ASP 93  ? A ASP 108 ? 1_555 84.4  ? 
17 OE1 ? A GLU 65  ? A GLU 80  ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 435 ? 1_555 176.3 ? 
18 OD1 ? A ASP 93  ? A ASP 108 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 435 ? 1_555 93.3  ? 
19 OE1 ? A GLU 65  ? A GLU 80  ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 481 ? 1_555 81.5  ? 
20 OD1 ? A ASP 93  ? A ASP 108 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 481 ? 1_555 90.4  ? 
21 O   ? F HOH .   ? A HOH 435 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 481 ? 1_555 95.5  ? 
22 OE1 ? A GLU 65  ? A GLU 80  ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 524 ? 1_555 98.5  ? 
23 OD1 ? A ASP 93  ? A ASP 108 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 524 ? 1_555 92.6  ? 
24 O   ? F HOH .   ? A HOH 435 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 524 ? 1_555 84.5  ? 
25 O   ? F HOH .   ? A HOH 481 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 524 ? 1_555 177.0 ? 
26 OE1 ? A GLU 65  ? A GLU 80  ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 537 ? 1_555 92.7  ? 
27 OD1 ? A ASP 93  ? A ASP 108 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 537 ? 1_555 175.5 ? 
28 O   ? F HOH .   ? A HOH 435 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 537 ? 1_555 89.7  ? 
29 O   ? F HOH .   ? A HOH 481 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 537 ? 1_555 92.6  ? 
30 O   ? F HOH .   ? A HOH 524 ? 1_555 MN ? D MN . ? A MN 303 ? 1_555 O   ? F HOH .   ? A HOH 537 ? 1_555 84.4  ? 
# 
loop_
_pdbx_audit_revision_history.ordinal 
_pdbx_audit_revision_history.data_content_type 
_pdbx_audit_revision_history.major_revision 
_pdbx_audit_revision_history.minor_revision 
_pdbx_audit_revision_history.revision_date 
1 'Structure model' 1 0 2015-05-13 
2 'Structure model' 1 1 2016-05-25 
3 'Structure model' 1 2 2020-02-19 
4 'Structure model' 1 3 2023-11-08 
# 
_pdbx_audit_revision_details.ordinal             1 
_pdbx_audit_revision_details.revision_ordinal    1 
_pdbx_audit_revision_details.data_content_type   'Structure model' 
_pdbx_audit_revision_details.provider            repository 
_pdbx_audit_revision_details.type                'Initial release' 
_pdbx_audit_revision_details.description         ? 
_pdbx_audit_revision_details.details             ? 
# 
loop_
_pdbx_audit_revision_group.ordinal 
_pdbx_audit_revision_group.revision_ordinal 
_pdbx_audit_revision_group.data_content_type 
_pdbx_audit_revision_group.group 
1 2 'Structure model' 'Database references'    
2 3 'Structure model' 'Data collection'        
3 3 'Structure model' 'Database references'    
4 3 'Structure model' 'Derived calculations'   
5 4 'Structure model' 'Data collection'        
6 4 'Structure model' 'Database references'    
7 4 'Structure model' 'Derived calculations'   
8 4 'Structure model' 'Refinement description' 
# 
loop_
_pdbx_audit_revision_category.ordinal 
_pdbx_audit_revision_category.revision_ordinal 
_pdbx_audit_revision_category.data_content_type 
_pdbx_audit_revision_category.category 
1  3 'Structure model' citation                      
2  3 'Structure model' diffrn_source                 
3  3 'Structure model' pdbx_struct_oper_list         
4  4 'Structure model' chem_comp_atom                
5  4 'Structure model' chem_comp_bond                
6  4 'Structure model' database_2                    
7  4 'Structure model' diffrn_radiation_wavelength   
8  4 'Structure model' pdbx_initial_refinement_model 
9  4 'Structure model' pdbx_struct_conn_angle        
10 4 'Structure model' struct_conn                   
# 
loop_
_pdbx_audit_revision_item.ordinal 
_pdbx_audit_revision_item.revision_ordinal 
_pdbx_audit_revision_item.data_content_type 
_pdbx_audit_revision_item.item 
1  3 'Structure model' '_citation.journal_id_CSD'                  
2  3 'Structure model' '_diffrn_source.pdbx_synchrotron_site'      
3  3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 
4  4 'Structure model' '_database_2.pdbx_DOI'                      
5  4 'Structure model' '_database_2.pdbx_database_accession'       
6  4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 
7  4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 
8  4 'Structure model' '_pdbx_struct_conn_angle.value'             
9  4 'Structure model' '_struct_conn.pdbx_dist_value'              
10 4 'Structure model' '_struct_conn.ptnr1_label_atom_id'          
11 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id'            
12 4 'Structure model' '_struct_conn.ptnr2_label_asym_id'          
# 
loop_
_software.citation_id 
_software.classification 
_software.compiler_name 
_software.compiler_version 
_software.contact_author 
_software.contact_author_email 
_software.date 
_software.description 
_software.dependencies 
_software.hardware 
_software.language 
_software.location 
_software.mods 
_software.name 
_software.os 
_software.os_version 
_software.type 
_software.version 
_software.pdbx_ordinal 
? 'data collection' ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .          1 
? 'data scaling'    ? ? ? ? ? ? ? ? ? ? ? HKL-2000    ? ? ? .          2 
? phasing           ? ? ? ? ? ? ? ? ? ? ? MOLREP      ? ? ? 11.0.05    3 
? refinement        ? ? ? ? ? ? ? ? ? ? ? PHENIX      ? ? ? 1.8.1_1168 4 
? 'data extraction' ? ? ? ? ? ? ? ? ? ? ? PDB_EXTRACT ? ? ? 3.15       5 
# 
loop_
_pdbx_validate_close_contact.id 
_pdbx_validate_close_contact.PDB_model_num 
_pdbx_validate_close_contact.auth_atom_id_1 
_pdbx_validate_close_contact.auth_asym_id_1 
_pdbx_validate_close_contact.auth_comp_id_1 
_pdbx_validate_close_contact.auth_seq_id_1 
_pdbx_validate_close_contact.PDB_ins_code_1 
_pdbx_validate_close_contact.label_alt_id_1 
_pdbx_validate_close_contact.auth_atom_id_2 
_pdbx_validate_close_contact.auth_asym_id_2 
_pdbx_validate_close_contact.auth_comp_id_2 
_pdbx_validate_close_contact.auth_seq_id_2 
_pdbx_validate_close_contact.PDB_ins_code_2 
_pdbx_validate_close_contact.label_alt_id_2 
_pdbx_validate_close_contact.dist 
1 1 O A HOH 502 ? ? O A HOH 545 ? ? 2.11 
2 1 O A HOH 533 ? ? O A HOH 570 ? ? 2.12 
3 1 O A HOH 538 ? ? O A HOH 555 ? ? 2.16 
4 1 O A HOH 439 ? ? O A HOH 520 ? ? 2.19 
# 
loop_
_pdbx_validate_symm_contact.id 
_pdbx_validate_symm_contact.PDB_model_num 
_pdbx_validate_symm_contact.auth_atom_id_1 
_pdbx_validate_symm_contact.auth_asym_id_1 
_pdbx_validate_symm_contact.auth_comp_id_1 
_pdbx_validate_symm_contact.auth_seq_id_1 
_pdbx_validate_symm_contact.PDB_ins_code_1 
_pdbx_validate_symm_contact.label_alt_id_1 
_pdbx_validate_symm_contact.site_symmetry_1 
_pdbx_validate_symm_contact.auth_atom_id_2 
_pdbx_validate_symm_contact.auth_asym_id_2 
_pdbx_validate_symm_contact.auth_comp_id_2 
_pdbx_validate_symm_contact.auth_seq_id_2 
_pdbx_validate_symm_contact.PDB_ins_code_2 
_pdbx_validate_symm_contact.label_alt_id_2 
_pdbx_validate_symm_contact.site_symmetry_2 
_pdbx_validate_symm_contact.dist 
1 1 O A HOH 553 ? ? 1_555 O A HOH 565 ? ? 6_544 1.97 
2 1 O A HOH 489 ? ? 1_555 O A HOH 565 ? ? 6_544 2.11 
3 1 O A HOH 497 ? ? 1_555 O A HOH 580 ? ? 6_544 2.19 
# 
loop_
_pdbx_validate_torsion.id 
_pdbx_validate_torsion.PDB_model_num 
_pdbx_validate_torsion.auth_comp_id 
_pdbx_validate_torsion.auth_asym_id 
_pdbx_validate_torsion.auth_seq_id 
_pdbx_validate_torsion.PDB_ins_code 
_pdbx_validate_torsion.label_alt_id 
_pdbx_validate_torsion.phi 
_pdbx_validate_torsion.psi 
1 1 HIS A 74  ? ? 72.56 -0.37  
2 1 LYS A 139 ? ? 69.43 -15.82 
3 1 THR A 162 ? ? 69.03 -61.04 
# 
loop_
_pdbx_unobs_or_zero_occ_residues.id 
_pdbx_unobs_or_zero_occ_residues.PDB_model_num 
_pdbx_unobs_or_zero_occ_residues.polymer_flag 
_pdbx_unobs_or_zero_occ_residues.occupancy_flag 
_pdbx_unobs_or_zero_occ_residues.auth_asym_id 
_pdbx_unobs_or_zero_occ_residues.auth_comp_id 
_pdbx_unobs_or_zero_occ_residues.auth_seq_id 
_pdbx_unobs_or_zero_occ_residues.PDB_ins_code 
_pdbx_unobs_or_zero_occ_residues.label_asym_id 
_pdbx_unobs_or_zero_occ_residues.label_comp_id 
_pdbx_unobs_or_zero_occ_residues.label_seq_id 
1  1 Y 1 A GLY 197 ? A GLY 182 
2  1 Y 1 A ALA 198 ? A ALA 183 
3  1 Y 1 A ALA 199 ? A ALA 184 
4  1 Y 1 A GLU 200 ? A GLU 185 
5  1 Y 1 A LEU 201 ? A LEU 186 
6  1 Y 1 A ALA 202 ? A ALA 187 
7  1 Y 1 A LEU 203 ? A LEU 188 
8  1 Y 1 A VAL 204 ? A VAL 189 
9  1 Y 1 A PRO 205 ? A PRO 190 
10 1 Y 1 A ARG 206 ? A ARG 191 
# 
loop_
_chem_comp_atom.comp_id 
_chem_comp_atom.atom_id 
_chem_comp_atom.type_symbol 
_chem_comp_atom.pdbx_aromatic_flag 
_chem_comp_atom.pdbx_stereo_config 
_chem_comp_atom.pdbx_ordinal 
4P9 CAN  C  Y N 1   
4P9 CAP  C  Y N 2   
4P9 CAR  C  Y N 3   
4P9 CLS  CL N N 4   
4P9 CAQ  C  Y N 5   
4P9 CAO  C  Y N 6   
4P9 CAM  C  Y N 7   
4P9 NAL  N  N N 8   
4P9 NAK  N  N N 9   
4P9 CAJ  C  N N 10  
4P9 CAB  C  Y N 11  
4P9 CAC  C  Y N 12  
4P9 CAD  C  Y N 13  
4P9 CAE  C  Y N 14  
4P9 OAG  O  N N 15  
4P9 CAF  C  Y N 16  
4P9 OAH  O  N N 17  
4P9 CAA  C  Y N 18  
4P9 OAI  O  N N 19  
4P9 H1   H  N N 20  
4P9 H2   H  N N 21  
4P9 H3   H  N N 22  
4P9 H4   H  N N 23  
4P9 H5   H  N N 24  
4P9 H7   H  N N 25  
4P9 H9   H  N N 26  
4P9 H10  H  N N 27  
4P9 H11  H  N N 28  
4P9 H12  H  N N 29  
4P9 H13  H  N N 30  
ALA N    N  N N 31  
ALA CA   C  N S 32  
ALA C    C  N N 33  
ALA O    O  N N 34  
ALA CB   C  N N 35  
ALA OXT  O  N N 36  
ALA H    H  N N 37  
ALA H2   H  N N 38  
ALA HA   H  N N 39  
ALA HB1  H  N N 40  
ALA HB2  H  N N 41  
ALA HB3  H  N N 42  
ALA HXT  H  N N 43  
ARG N    N  N N 44  
ARG CA   C  N S 45  
ARG C    C  N N 46  
ARG O    O  N N 47  
ARG CB   C  N N 48  
ARG CG   C  N N 49  
ARG CD   C  N N 50  
ARG NE   N  N N 51  
ARG CZ   C  N N 52  
ARG NH1  N  N N 53  
ARG NH2  N  N N 54  
ARG OXT  O  N N 55  
ARG H    H  N N 56  
ARG H2   H  N N 57  
ARG HA   H  N N 58  
ARG HB2  H  N N 59  
ARG HB3  H  N N 60  
ARG HG2  H  N N 61  
ARG HG3  H  N N 62  
ARG HD2  H  N N 63  
ARG HD3  H  N N 64  
ARG HE   H  N N 65  
ARG HH11 H  N N 66  
ARG HH12 H  N N 67  
ARG HH21 H  N N 68  
ARG HH22 H  N N 69  
ARG HXT  H  N N 70  
ASN N    N  N N 71  
ASN CA   C  N S 72  
ASN C    C  N N 73  
ASN O    O  N N 74  
ASN CB   C  N N 75  
ASN CG   C  N N 76  
ASN OD1  O  N N 77  
ASN ND2  N  N N 78  
ASN OXT  O  N N 79  
ASN H    H  N N 80  
ASN H2   H  N N 81  
ASN HA   H  N N 82  
ASN HB2  H  N N 83  
ASN HB3  H  N N 84  
ASN HD21 H  N N 85  
ASN HD22 H  N N 86  
ASN HXT  H  N N 87  
ASP N    N  N N 88  
ASP CA   C  N S 89  
ASP C    C  N N 90  
ASP O    O  N N 91  
ASP CB   C  N N 92  
ASP CG   C  N N 93  
ASP OD1  O  N N 94  
ASP OD2  O  N N 95  
ASP OXT  O  N N 96  
ASP H    H  N N 97  
ASP H2   H  N N 98  
ASP HA   H  N N 99  
ASP HB2  H  N N 100 
ASP HB3  H  N N 101 
ASP HD2  H  N N 102 
ASP HXT  H  N N 103 
CYS N    N  N N 104 
CYS CA   C  N R 105 
CYS C    C  N N 106 
CYS O    O  N N 107 
CYS CB   C  N N 108 
CYS SG   S  N N 109 
CYS OXT  O  N N 110 
CYS H    H  N N 111 
CYS H2   H  N N 112 
CYS HA   H  N N 113 
CYS HB2  H  N N 114 
CYS HB3  H  N N 115 
CYS HG   H  N N 116 
CYS HXT  H  N N 117 
GLN N    N  N N 118 
GLN CA   C  N S 119 
GLN C    C  N N 120 
GLN O    O  N N 121 
GLN CB   C  N N 122 
GLN CG   C  N N 123 
GLN CD   C  N N 124 
GLN OE1  O  N N 125 
GLN NE2  N  N N 126 
GLN OXT  O  N N 127 
GLN H    H  N N 128 
GLN H2   H  N N 129 
GLN HA   H  N N 130 
GLN HB2  H  N N 131 
GLN HB3  H  N N 132 
GLN HG2  H  N N 133 
GLN HG3  H  N N 134 
GLN HE21 H  N N 135 
GLN HE22 H  N N 136 
GLN HXT  H  N N 137 
GLU N    N  N N 138 
GLU CA   C  N S 139 
GLU C    C  N N 140 
GLU O    O  N N 141 
GLU CB   C  N N 142 
GLU CG   C  N N 143 
GLU CD   C  N N 144 
GLU OE1  O  N N 145 
GLU OE2  O  N N 146 
GLU OXT  O  N N 147 
GLU H    H  N N 148 
GLU H2   H  N N 149 
GLU HA   H  N N 150 
GLU HB2  H  N N 151 
GLU HB3  H  N N 152 
GLU HG2  H  N N 153 
GLU HG3  H  N N 154 
GLU HE2  H  N N 155 
GLU HXT  H  N N 156 
GLY N    N  N N 157 
GLY CA   C  N N 158 
GLY C    C  N N 159 
GLY O    O  N N 160 
GLY OXT  O  N N 161 
GLY H    H  N N 162 
GLY H2   H  N N 163 
GLY HA2  H  N N 164 
GLY HA3  H  N N 165 
GLY HXT  H  N N 166 
HIS N    N  N N 167 
HIS CA   C  N S 168 
HIS C    C  N N 169 
HIS O    O  N N 170 
HIS CB   C  N N 171 
HIS CG   C  Y N 172 
HIS ND1  N  Y N 173 
HIS CD2  C  Y N 174 
HIS CE1  C  Y N 175 
HIS NE2  N  Y N 176 
HIS OXT  O  N N 177 
HIS H    H  N N 178 
HIS H2   H  N N 179 
HIS HA   H  N N 180 
HIS HB2  H  N N 181 
HIS HB3  H  N N 182 
HIS HD1  H  N N 183 
HIS HD2  H  N N 184 
HIS HE1  H  N N 185 
HIS HE2  H  N N 186 
HIS HXT  H  N N 187 
HOH O    O  N N 188 
HOH H1   H  N N 189 
HOH H2   H  N N 190 
ILE N    N  N N 191 
ILE CA   C  N S 192 
ILE C    C  N N 193 
ILE O    O  N N 194 
ILE CB   C  N S 195 
ILE CG1  C  N N 196 
ILE CG2  C  N N 197 
ILE CD1  C  N N 198 
ILE OXT  O  N N 199 
ILE H    H  N N 200 
ILE H2   H  N N 201 
ILE HA   H  N N 202 
ILE HB   H  N N 203 
ILE HG12 H  N N 204 
ILE HG13 H  N N 205 
ILE HG21 H  N N 206 
ILE HG22 H  N N 207 
ILE HG23 H  N N 208 
ILE HD11 H  N N 209 
ILE HD12 H  N N 210 
ILE HD13 H  N N 211 
ILE HXT  H  N N 212 
LEU N    N  N N 213 
LEU CA   C  N S 214 
LEU C    C  N N 215 
LEU O    O  N N 216 
LEU CB   C  N N 217 
LEU CG   C  N N 218 
LEU CD1  C  N N 219 
LEU CD2  C  N N 220 
LEU OXT  O  N N 221 
LEU H    H  N N 222 
LEU H2   H  N N 223 
LEU HA   H  N N 224 
LEU HB2  H  N N 225 
LEU HB3  H  N N 226 
LEU HG   H  N N 227 
LEU HD11 H  N N 228 
LEU HD12 H  N N 229 
LEU HD13 H  N N 230 
LEU HD21 H  N N 231 
LEU HD22 H  N N 232 
LEU HD23 H  N N 233 
LEU HXT  H  N N 234 
LYS N    N  N N 235 
LYS CA   C  N S 236 
LYS C    C  N N 237 
LYS O    O  N N 238 
LYS CB   C  N N 239 
LYS CG   C  N N 240 
LYS CD   C  N N 241 
LYS CE   C  N N 242 
LYS NZ   N  N N 243 
LYS OXT  O  N N 244 
LYS H    H  N N 245 
LYS H2   H  N N 246 
LYS HA   H  N N 247 
LYS HB2  H  N N 248 
LYS HB3  H  N N 249 
LYS HG2  H  N N 250 
LYS HG3  H  N N 251 
LYS HD2  H  N N 252 
LYS HD3  H  N N 253 
LYS HE2  H  N N 254 
LYS HE3  H  N N 255 
LYS HZ1  H  N N 256 
LYS HZ2  H  N N 257 
LYS HZ3  H  N N 258 
LYS HXT  H  N N 259 
MET N    N  N N 260 
MET CA   C  N S 261 
MET C    C  N N 262 
MET O    O  N N 263 
MET CB   C  N N 264 
MET CG   C  N N 265 
MET SD   S  N N 266 
MET CE   C  N N 267 
MET OXT  O  N N 268 
MET H    H  N N 269 
MET H2   H  N N 270 
MET HA   H  N N 271 
MET HB2  H  N N 272 
MET HB3  H  N N 273 
MET HG2  H  N N 274 
MET HG3  H  N N 275 
MET HE1  H  N N 276 
MET HE2  H  N N 277 
MET HE3  H  N N 278 
MET HXT  H  N N 279 
MN  MN   MN N N 280 
PHE N    N  N N 281 
PHE CA   C  N S 282 
PHE C    C  N N 283 
PHE O    O  N N 284 
PHE CB   C  N N 285 
PHE CG   C  Y N 286 
PHE CD1  C  Y N 287 
PHE CD2  C  Y N 288 
PHE CE1  C  Y N 289 
PHE CE2  C  Y N 290 
PHE CZ   C  Y N 291 
PHE OXT  O  N N 292 
PHE H    H  N N 293 
PHE H2   H  N N 294 
PHE HA   H  N N 295 
PHE HB2  H  N N 296 
PHE HB3  H  N N 297 
PHE HD1  H  N N 298 
PHE HD2  H  N N 299 
PHE HE1  H  N N 300 
PHE HE2  H  N N 301 
PHE HZ   H  N N 302 
PHE HXT  H  N N 303 
PRO N    N  N N 304 
PRO CA   C  N S 305 
PRO C    C  N N 306 
PRO O    O  N N 307 
PRO CB   C  N N 308 
PRO CG   C  N N 309 
PRO CD   C  N N 310 
PRO OXT  O  N N 311 
PRO H    H  N N 312 
PRO HA   H  N N 313 
PRO HB2  H  N N 314 
PRO HB3  H  N N 315 
PRO HG2  H  N N 316 
PRO HG3  H  N N 317 
PRO HD2  H  N N 318 
PRO HD3  H  N N 319 
PRO HXT  H  N N 320 
SER N    N  N N 321 
SER CA   C  N S 322 
SER C    C  N N 323 
SER O    O  N N 324 
SER CB   C  N N 325 
SER OG   O  N N 326 
SER OXT  O  N N 327 
SER H    H  N N 328 
SER H2   H  N N 329 
SER HA   H  N N 330 
SER HB2  H  N N 331 
SER HB3  H  N N 332 
SER HG   H  N N 333 
SER HXT  H  N N 334 
SO4 S    S  N N 335 
SO4 O1   O  N N 336 
SO4 O2   O  N N 337 
SO4 O3   O  N N 338 
SO4 O4   O  N N 339 
THR N    N  N N 340 
THR CA   C  N S 341 
THR C    C  N N 342 
THR O    O  N N 343 
THR CB   C  N R 344 
THR OG1  O  N N 345 
THR CG2  C  N N 346 
THR OXT  O  N N 347 
THR H    H  N N 348 
THR H2   H  N N 349 
THR HA   H  N N 350 
THR HB   H  N N 351 
THR HG1  H  N N 352 
THR HG21 H  N N 353 
THR HG22 H  N N 354 
THR HG23 H  N N 355 
THR HXT  H  N N 356 
TRP N    N  N N 357 
TRP CA   C  N S 358 
TRP C    C  N N 359 
TRP O    O  N N 360 
TRP CB   C  N N 361 
TRP CG   C  Y N 362 
TRP CD1  C  Y N 363 
TRP CD2  C  Y N 364 
TRP NE1  N  Y N 365 
TRP CE2  C  Y N 366 
TRP CE3  C  Y N 367 
TRP CZ2  C  Y N 368 
TRP CZ3  C  Y N 369 
TRP CH2  C  Y N 370 
TRP OXT  O  N N 371 
TRP H    H  N N 372 
TRP H2   H  N N 373 
TRP HA   H  N N 374 
TRP HB2  H  N N 375 
TRP HB3  H  N N 376 
TRP HD1  H  N N 377 
TRP HE1  H  N N 378 
TRP HE3  H  N N 379 
TRP HZ2  H  N N 380 
TRP HZ3  H  N N 381 
TRP HH2  H  N N 382 
TRP HXT  H  N N 383 
TYR N    N  N N 384 
TYR CA   C  N S 385 
TYR C    C  N N 386 
TYR O    O  N N 387 
TYR CB   C  N N 388 
TYR CG   C  Y N 389 
TYR CD1  C  Y N 390 
TYR CD2  C  Y N 391 
TYR CE1  C  Y N 392 
TYR CE2  C  Y N 393 
TYR CZ   C  Y N 394 
TYR OH   O  N N 395 
TYR OXT  O  N N 396 
TYR H    H  N N 397 
TYR H2   H  N N 398 
TYR HA   H  N N 399 
TYR HB2  H  N N 400 
TYR HB3  H  N N 401 
TYR HD1  H  N N 402 
TYR HD2  H  N N 403 
TYR HE1  H  N N 404 
TYR HE2  H  N N 405 
TYR HH   H  N N 406 
TYR HXT  H  N N 407 
VAL N    N  N N 408 
VAL CA   C  N S 409 
VAL C    C  N N 410 
VAL O    O  N N 411 
VAL CB   C  N N 412 
VAL CG1  C  N N 413 
VAL CG2  C  N N 414 
VAL OXT  O  N N 415 
VAL H    H  N N 416 
VAL H2   H  N N 417 
VAL HA   H  N N 418 
VAL HB   H  N N 419 
VAL HG11 H  N N 420 
VAL HG12 H  N N 421 
VAL HG13 H  N N 422 
VAL HG21 H  N N 423 
VAL HG22 H  N N 424 
VAL HG23 H  N N 425 
VAL HXT  H  N N 426 
# 
loop_
_chem_comp_bond.comp_id 
_chem_comp_bond.atom_id_1 
_chem_comp_bond.atom_id_2 
_chem_comp_bond.value_order 
_chem_comp_bond.pdbx_aromatic_flag 
_chem_comp_bond.pdbx_stereo_config 
_chem_comp_bond.pdbx_ordinal 
4P9 OAG CAE  sing N N 1   
4P9 CAD CAE  doub Y N 2   
4P9 CAD CAC  sing Y N 3   
4P9 CAE CAF  sing Y N 4   
4P9 CAC CAB  doub Y N 5   
4P9 CAF OAH  sing N N 6   
4P9 CAF CAA  doub Y N 7   
4P9 CAB CAA  sing Y N 8   
4P9 CAB CAJ  sing N N 9   
4P9 CAA OAI  sing N N 10  
4P9 CAJ NAK  doub N E 11  
4P9 NAK NAL  sing N N 12  
4P9 CAO CAQ  doub Y N 13  
4P9 CAO CAM  sing Y N 14  
4P9 CAQ CAR  sing Y N 15  
4P9 NAL CAM  sing N N 16  
4P9 CAR CLS  sing N N 17  
4P9 CAR CAP  doub Y N 18  
4P9 CAM CAN  doub Y N 19  
4P9 CAN CAP  sing Y N 20  
4P9 CAN H1   sing N N 21  
4P9 CAP H2   sing N N 22  
4P9 CAQ H3   sing N N 23  
4P9 CAO H4   sing N N 24  
4P9 NAL H5   sing N N 25  
4P9 CAJ H7   sing N N 26  
4P9 CAC H9   sing N N 27  
4P9 CAD H10  sing N N 28  
4P9 OAG H11  sing N N 29  
4P9 OAH H12  sing N N 30  
4P9 OAI H13  sing N N 31  
ALA N   CA   sing N N 32  
ALA N   H    sing N N 33  
ALA N   H2   sing N N 34  
ALA CA  C    sing N N 35  
ALA CA  CB   sing N N 36  
ALA CA  HA   sing N N 37  
ALA C   O    doub N N 38  
ALA C   OXT  sing N N 39  
ALA CB  HB1  sing N N 40  
ALA CB  HB2  sing N N 41  
ALA CB  HB3  sing N N 42  
ALA OXT HXT  sing N N 43  
ARG N   CA   sing N N 44  
ARG N   H    sing N N 45  
ARG N   H2   sing N N 46  
ARG CA  C    sing N N 47  
ARG CA  CB   sing N N 48  
ARG CA  HA   sing N N 49  
ARG C   O    doub N N 50  
ARG C   OXT  sing N N 51  
ARG CB  CG   sing N N 52  
ARG CB  HB2  sing N N 53  
ARG CB  HB3  sing N N 54  
ARG CG  CD   sing N N 55  
ARG CG  HG2  sing N N 56  
ARG CG  HG3  sing N N 57  
ARG CD  NE   sing N N 58  
ARG CD  HD2  sing N N 59  
ARG CD  HD3  sing N N 60  
ARG NE  CZ   sing N N 61  
ARG NE  HE   sing N N 62  
ARG CZ  NH1  sing N N 63  
ARG CZ  NH2  doub N N 64  
ARG NH1 HH11 sing N N 65  
ARG NH1 HH12 sing N N 66  
ARG NH2 HH21 sing N N 67  
ARG NH2 HH22 sing N N 68  
ARG OXT HXT  sing N N 69  
ASN N   CA   sing N N 70  
ASN N   H    sing N N 71  
ASN N   H2   sing N N 72  
ASN CA  C    sing N N 73  
ASN CA  CB   sing N N 74  
ASN CA  HA   sing N N 75  
ASN C   O    doub N N 76  
ASN C   OXT  sing N N 77  
ASN CB  CG   sing N N 78  
ASN CB  HB2  sing N N 79  
ASN CB  HB3  sing N N 80  
ASN CG  OD1  doub N N 81  
ASN CG  ND2  sing N N 82  
ASN ND2 HD21 sing N N 83  
ASN ND2 HD22 sing N N 84  
ASN OXT HXT  sing N N 85  
ASP N   CA   sing N N 86  
ASP N   H    sing N N 87  
ASP N   H2   sing N N 88  
ASP CA  C    sing N N 89  
ASP CA  CB   sing N N 90  
ASP CA  HA   sing N N 91  
ASP C   O    doub N N 92  
ASP C   OXT  sing N N 93  
ASP CB  CG   sing N N 94  
ASP CB  HB2  sing N N 95  
ASP CB  HB3  sing N N 96  
ASP CG  OD1  doub N N 97  
ASP CG  OD2  sing N N 98  
ASP OD2 HD2  sing N N 99  
ASP OXT HXT  sing N N 100 
CYS N   CA   sing N N 101 
CYS N   H    sing N N 102 
CYS N   H2   sing N N 103 
CYS CA  C    sing N N 104 
CYS CA  CB   sing N N 105 
CYS CA  HA   sing N N 106 
CYS C   O    doub N N 107 
CYS C   OXT  sing N N 108 
CYS CB  SG   sing N N 109 
CYS CB  HB2  sing N N 110 
CYS CB  HB3  sing N N 111 
CYS SG  HG   sing N N 112 
CYS OXT HXT  sing N N 113 
GLN N   CA   sing N N 114 
GLN N   H    sing N N 115 
GLN N   H2   sing N N 116 
GLN CA  C    sing N N 117 
GLN CA  CB   sing N N 118 
GLN CA  HA   sing N N 119 
GLN C   O    doub N N 120 
GLN C   OXT  sing N N 121 
GLN CB  CG   sing N N 122 
GLN CB  HB2  sing N N 123 
GLN CB  HB3  sing N N 124 
GLN CG  CD   sing N N 125 
GLN CG  HG2  sing N N 126 
GLN CG  HG3  sing N N 127 
GLN CD  OE1  doub N N 128 
GLN CD  NE2  sing N N 129 
GLN NE2 HE21 sing N N 130 
GLN NE2 HE22 sing N N 131 
GLN OXT HXT  sing N N 132 
GLU N   CA   sing N N 133 
GLU N   H    sing N N 134 
GLU N   H2   sing N N 135 
GLU CA  C    sing N N 136 
GLU CA  CB   sing N N 137 
GLU CA  HA   sing N N 138 
GLU C   O    doub N N 139 
GLU C   OXT  sing N N 140 
GLU CB  CG   sing N N 141 
GLU CB  HB2  sing N N 142 
GLU CB  HB3  sing N N 143 
GLU CG  CD   sing N N 144 
GLU CG  HG2  sing N N 145 
GLU CG  HG3  sing N N 146 
GLU CD  OE1  doub N N 147 
GLU CD  OE2  sing N N 148 
GLU OE2 HE2  sing N N 149 
GLU OXT HXT  sing N N 150 
GLY N   CA   sing N N 151 
GLY N   H    sing N N 152 
GLY N   H2   sing N N 153 
GLY CA  C    sing N N 154 
GLY CA  HA2  sing N N 155 
GLY CA  HA3  sing N N 156 
GLY C   O    doub N N 157 
GLY C   OXT  sing N N 158 
GLY OXT HXT  sing N N 159 
HIS N   CA   sing N N 160 
HIS N   H    sing N N 161 
HIS N   H2   sing N N 162 
HIS CA  C    sing N N 163 
HIS CA  CB   sing N N 164 
HIS CA  HA   sing N N 165 
HIS C   O    doub N N 166 
HIS C   OXT  sing N N 167 
HIS CB  CG   sing N N 168 
HIS CB  HB2  sing N N 169 
HIS CB  HB3  sing N N 170 
HIS CG  ND1  sing Y N 171 
HIS CG  CD2  doub Y N 172 
HIS ND1 CE1  doub Y N 173 
HIS ND1 HD1  sing N N 174 
HIS CD2 NE2  sing Y N 175 
HIS CD2 HD2  sing N N 176 
HIS CE1 NE2  sing Y N 177 
HIS CE1 HE1  sing N N 178 
HIS NE2 HE2  sing N N 179 
HIS OXT HXT  sing N N 180 
HOH O   H1   sing N N 181 
HOH O   H2   sing N N 182 
ILE N   CA   sing N N 183 
ILE N   H    sing N N 184 
ILE N   H2   sing N N 185 
ILE CA  C    sing N N 186 
ILE CA  CB   sing N N 187 
ILE CA  HA   sing N N 188 
ILE C   O    doub N N 189 
ILE C   OXT  sing N N 190 
ILE CB  CG1  sing N N 191 
ILE CB  CG2  sing N N 192 
ILE CB  HB   sing N N 193 
ILE CG1 CD1  sing N N 194 
ILE CG1 HG12 sing N N 195 
ILE CG1 HG13 sing N N 196 
ILE CG2 HG21 sing N N 197 
ILE CG2 HG22 sing N N 198 
ILE CG2 HG23 sing N N 199 
ILE CD1 HD11 sing N N 200 
ILE CD1 HD12 sing N N 201 
ILE CD1 HD13 sing N N 202 
ILE OXT HXT  sing N N 203 
LEU N   CA   sing N N 204 
LEU N   H    sing N N 205 
LEU N   H2   sing N N 206 
LEU CA  C    sing N N 207 
LEU CA  CB   sing N N 208 
LEU CA  HA   sing N N 209 
LEU C   O    doub N N 210 
LEU C   OXT  sing N N 211 
LEU CB  CG   sing N N 212 
LEU CB  HB2  sing N N 213 
LEU CB  HB3  sing N N 214 
LEU CG  CD1  sing N N 215 
LEU CG  CD2  sing N N 216 
LEU CG  HG   sing N N 217 
LEU CD1 HD11 sing N N 218 
LEU CD1 HD12 sing N N 219 
LEU CD1 HD13 sing N N 220 
LEU CD2 HD21 sing N N 221 
LEU CD2 HD22 sing N N 222 
LEU CD2 HD23 sing N N 223 
LEU OXT HXT  sing N N 224 
LYS N   CA   sing N N 225 
LYS N   H    sing N N 226 
LYS N   H2   sing N N 227 
LYS CA  C    sing N N 228 
LYS CA  CB   sing N N 229 
LYS CA  HA   sing N N 230 
LYS C   O    doub N N 231 
LYS C   OXT  sing N N 232 
LYS CB  CG   sing N N 233 
LYS CB  HB2  sing N N 234 
LYS CB  HB3  sing N N 235 
LYS CG  CD   sing N N 236 
LYS CG  HG2  sing N N 237 
LYS CG  HG3  sing N N 238 
LYS CD  CE   sing N N 239 
LYS CD  HD2  sing N N 240 
LYS CD  HD3  sing N N 241 
LYS CE  NZ   sing N N 242 
LYS CE  HE2  sing N N 243 
LYS CE  HE3  sing N N 244 
LYS NZ  HZ1  sing N N 245 
LYS NZ  HZ2  sing N N 246 
LYS NZ  HZ3  sing N N 247 
LYS OXT HXT  sing N N 248 
MET N   CA   sing N N 249 
MET N   H    sing N N 250 
MET N   H2   sing N N 251 
MET CA  C    sing N N 252 
MET CA  CB   sing N N 253 
MET CA  HA   sing N N 254 
MET C   O    doub N N 255 
MET C   OXT  sing N N 256 
MET CB  CG   sing N N 257 
MET CB  HB2  sing N N 258 
MET CB  HB3  sing N N 259 
MET CG  SD   sing N N 260 
MET CG  HG2  sing N N 261 
MET CG  HG3  sing N N 262 
MET SD  CE   sing N N 263 
MET CE  HE1  sing N N 264 
MET CE  HE2  sing N N 265 
MET CE  HE3  sing N N 266 
MET OXT HXT  sing N N 267 
PHE N   CA   sing N N 268 
PHE N   H    sing N N 269 
PHE N   H2   sing N N 270 
PHE CA  C    sing N N 271 
PHE CA  CB   sing N N 272 
PHE CA  HA   sing N N 273 
PHE C   O    doub N N 274 
PHE C   OXT  sing N N 275 
PHE CB  CG   sing N N 276 
PHE CB  HB2  sing N N 277 
PHE CB  HB3  sing N N 278 
PHE CG  CD1  doub Y N 279 
PHE CG  CD2  sing Y N 280 
PHE CD1 CE1  sing Y N 281 
PHE CD1 HD1  sing N N 282 
PHE CD2 CE2  doub Y N 283 
PHE CD2 HD2  sing N N 284 
PHE CE1 CZ   doub Y N 285 
PHE CE1 HE1  sing N N 286 
PHE CE2 CZ   sing Y N 287 
PHE CE2 HE2  sing N N 288 
PHE CZ  HZ   sing N N 289 
PHE OXT HXT  sing N N 290 
PRO N   CA   sing N N 291 
PRO N   CD   sing N N 292 
PRO N   H    sing N N 293 
PRO CA  C    sing N N 294 
PRO CA  CB   sing N N 295 
PRO CA  HA   sing N N 296 
PRO C   O    doub N N 297 
PRO C   OXT  sing N N 298 
PRO CB  CG   sing N N 299 
PRO CB  HB2  sing N N 300 
PRO CB  HB3  sing N N 301 
PRO CG  CD   sing N N 302 
PRO CG  HG2  sing N N 303 
PRO CG  HG3  sing N N 304 
PRO CD  HD2  sing N N 305 
PRO CD  HD3  sing N N 306 
PRO OXT HXT  sing N N 307 
SER N   CA   sing N N 308 
SER N   H    sing N N 309 
SER N   H2   sing N N 310 
SER CA  C    sing N N 311 
SER CA  CB   sing N N 312 
SER CA  HA   sing N N 313 
SER C   O    doub N N 314 
SER C   OXT  sing N N 315 
SER CB  OG   sing N N 316 
SER CB  HB2  sing N N 317 
SER CB  HB3  sing N N 318 
SER OG  HG   sing N N 319 
SER OXT HXT  sing N N 320 
SO4 S   O1   doub N N 321 
SO4 S   O2   doub N N 322 
SO4 S   O3   sing N N 323 
SO4 S   O4   sing N N 324 
THR N   CA   sing N N 325 
THR N   H    sing N N 326 
THR N   H2   sing N N 327 
THR CA  C    sing N N 328 
THR CA  CB   sing N N 329 
THR CA  HA   sing N N 330 
THR C   O    doub N N 331 
THR C   OXT  sing N N 332 
THR CB  OG1  sing N N 333 
THR CB  CG2  sing N N 334 
THR CB  HB   sing N N 335 
THR OG1 HG1  sing N N 336 
THR CG2 HG21 sing N N 337 
THR CG2 HG22 sing N N 338 
THR CG2 HG23 sing N N 339 
THR OXT HXT  sing N N 340 
TRP N   CA   sing N N 341 
TRP N   H    sing N N 342 
TRP N   H2   sing N N 343 
TRP CA  C    sing N N 344 
TRP CA  CB   sing N N 345 
TRP CA  HA   sing N N 346 
TRP C   O    doub N N 347 
TRP C   OXT  sing N N 348 
TRP CB  CG   sing N N 349 
TRP CB  HB2  sing N N 350 
TRP CB  HB3  sing N N 351 
TRP CG  CD1  doub Y N 352 
TRP CG  CD2  sing Y N 353 
TRP CD1 NE1  sing Y N 354 
TRP CD1 HD1  sing N N 355 
TRP CD2 CE2  doub Y N 356 
TRP CD2 CE3  sing Y N 357 
TRP NE1 CE2  sing Y N 358 
TRP NE1 HE1  sing N N 359 
TRP CE2 CZ2  sing Y N 360 
TRP CE3 CZ3  doub Y N 361 
TRP CE3 HE3  sing N N 362 
TRP CZ2 CH2  doub Y N 363 
TRP CZ2 HZ2  sing N N 364 
TRP CZ3 CH2  sing Y N 365 
TRP CZ3 HZ3  sing N N 366 
TRP CH2 HH2  sing N N 367 
TRP OXT HXT  sing N N 368 
TYR N   CA   sing N N 369 
TYR N   H    sing N N 370 
TYR N   H2   sing N N 371 
TYR CA  C    sing N N 372 
TYR CA  CB   sing N N 373 
TYR CA  HA   sing N N 374 
TYR C   O    doub N N 375 
TYR C   OXT  sing N N 376 
TYR CB  CG   sing N N 377 
TYR CB  HB2  sing N N 378 
TYR CB  HB3  sing N N 379 
TYR CG  CD1  doub Y N 380 
TYR CG  CD2  sing Y N 381 
TYR CD1 CE1  sing Y N 382 
TYR CD1 HD1  sing N N 383 
TYR CD2 CE2  doub Y N 384 
TYR CD2 HD2  sing N N 385 
TYR CE1 CZ   doub Y N 386 
TYR CE1 HE1  sing N N 387 
TYR CE2 CZ   sing Y N 388 
TYR CE2 HE2  sing N N 389 
TYR CZ  OH   sing N N 390 
TYR OH  HH   sing N N 391 
TYR OXT HXT  sing N N 392 
VAL N   CA   sing N N 393 
VAL N   H    sing N N 394 
VAL N   H2   sing N N 395 
VAL CA  C    sing N N 396 
VAL CA  CB   sing N N 397 
VAL CA  HA   sing N N 398 
VAL C   O    doub N N 399 
VAL C   OXT  sing N N 400 
VAL CB  CG1  sing N N 401 
VAL CB  CG2  sing N N 402 
VAL CB  HB   sing N N 403 
VAL CG1 HG11 sing N N 404 
VAL CG1 HG12 sing N N 405 
VAL CG1 HG13 sing N N 406 
VAL CG2 HG21 sing N N 407 
VAL CG2 HG22 sing N N 408 
VAL CG2 HG23 sing N N 409 
VAL OXT HXT  sing N N 410 
# 
_pdbx_audit_support.funding_organization   'Japan Society for the Promotion of Science' 
_pdbx_audit_support.country                Japan 
_pdbx_audit_support.grant_number           24590548 
_pdbx_audit_support.ordinal                1 
# 
loop_
_pdbx_entity_nonpoly.entity_id 
_pdbx_entity_nonpoly.name 
_pdbx_entity_nonpoly.comp_id 
2 'SULFATE ION'                                                          SO4 
3 'MANGANESE (II) ION'                                                   MN  
4 '4-{(E)-[2-(4-chlorophenyl)hydrazinylidene]methyl}benzene-1,2,3-triol' 4P9 
5 water                                                                  HOH 
# 
_pdbx_initial_refinement_model.id               1 
_pdbx_initial_refinement_model.entity_id_list   ? 
_pdbx_initial_refinement_model.type             'experimental model' 
_pdbx_initial_refinement_model.source_name      PDB 
_pdbx_initial_refinement_model.accession_code   4M5Q 
_pdbx_initial_refinement_model.details          ? 
#