data_4ZNF # _entry.id 4ZNF # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.356 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 4ZNF pdb_00004znf 10.2210/pdb4znf/pdb WWPDB D_1000179661 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.db_id 3ZNF _pdbx_database_related.details . _pdbx_database_related.content_type 'representative structure' # _pdbx_database_status.status_code REL _pdbx_database_status.entry_id 4ZNF _pdbx_database_status.recvd_initial_deposition_date 1990-07-09 _pdbx_database_status.deposit_site ? _pdbx_database_status.process_site BNL _pdbx_database_status.SG_entry . _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_mr ? _pdbx_database_status.status_code_sf ? _pdbx_database_status.status_code_cs ? _pdbx_database_status.status_code_nmr_data ? _pdbx_database_status.methods_development_category ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Gronenborn, A.M.' 1 'Clore, G.M.' 2 'Omichinski, J.G.' 3 # _citation.id primary _citation.title 'High-resolution three-dimensional structure of a single zinc finger from a human enhancer binding protein in solution.' _citation.journal_abbrev Biochemistry _citation.journal_volume 29 _citation.page_first 9324 _citation.page_last 9334 _citation.year 1990 _citation.journal_id_ASTM BICHAW _citation.country US _citation.journal_id_ISSN 0006-2960 _citation.journal_id_CSD 0033 _citation.book_publisher ? _citation.pdbx_database_id_PubMed 2248949 _citation.pdbx_database_id_DOI 10.1021/bi00492a004 # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Omichinski, J.G.' 1 ? primary 'Clore, G.M.' 2 ? primary 'Appella, E.' 3 ? primary 'Sakaguchi, K.' 4 ? primary 'Gronenborn, A.M.' 5 ? # _cell.entry_id 4ZNF _cell.length_a 1.000 _cell.length_b 1.000 _cell.length_c 1.000 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 1 _cell.pdbx_unique_axis ? # _symmetry.entry_id 4ZNF _symmetry.space_group_name_H-M 'P 1' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 1 # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'ZINC FINGER' 3569.212 1 ? ? ? ? 2 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code RPYHCSYCNFSFKTKGNLTKHMKSKAHSKK _entity_poly.pdbx_seq_one_letter_code_can RPYHCSYCNFSFKTKGNLTKHMKSKAHSKK _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 ARG n 1 2 PRO n 1 3 TYR n 1 4 HIS n 1 5 CYS n 1 6 SER n 1 7 TYR n 1 8 CYS n 1 9 ASN n 1 10 PHE n 1 11 SER n 1 12 PHE n 1 13 LYS n 1 14 THR n 1 15 LYS n 1 16 GLY n 1 17 ASN n 1 18 LEU n 1 19 THR n 1 20 LYS n 1 21 HIS n 1 22 MET n 1 23 LYS n 1 24 SER n 1 25 LYS n 1 26 ALA n 1 27 HIS n 1 28 SER n 1 29 LYS n 1 30 LYS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type ? _entity_src_gen.pdbx_beg_seq_num ? _entity_src_gen.pdbx_end_seq_num ? _entity_src_gen.gene_src_common_name human _entity_src_gen.gene_src_genus Homo _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Homo sapiens' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 9606 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name ? _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id ? _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code ZEP1_HUMAN _struct_ref.entity_id 1 _struct_ref.pdbx_db_accession P15822 _struct_ref.pdbx_align_begin 1 _struct_ref.pdbx_seq_one_letter_code ;MPRTKQIHPRNLRDKIEEAQKELNGAEVSKKEILQAGVKGTSESLKGVKRKKIVAENHLKKIPKSPLRNPLQAKHKQNTE ESSFAVLHSASESHKKQNYIPVKNGKQFTKQNGETPGIIAEASKSEESVSPKKPLFLQQPSELRRWRSEGADPAKFSDLD EQCDSSSLSSKTRTDNSECISSHCGTTSPSYTNTAFDVLLKAMEPELSTLSQKGSPCAIKTEKLRPNKTARSPPKLKNSS MDAPNQTSQELVAESQSSCTSYTVHMSAAQKNEQGAMQSASHLYHQHEHFVPKSNQHNQQLPGCSGFTGSLTNLQNQENA KLEQVYNIAVTSSVGLTSPSSRSQVTPQNQQMDSASPLSISPANSTQSPPMPIYNSTHVASVVNQSVEQMCNLLLKDQKP KKQGKYICEYCNRACAKPSVLLKHIRSHTGERPYPCVTCGFSFKTKSNLYKHKKSHAHTIKLGLVLQPDAGGLFLSHESP KALSIHSDVEDSGESEEEGATDERQHDLGAMELQNVHIIKRMSNAETLLKSSFTPSSPENVIGDFLLQDRSAESQAVTEL PKVVVHHVTVSPLRTDSPKAMDPKPELSSAQKQKDLQVTNVQPLSANMSQGGVSRLETNENSHQKGDMNPLEGKQDSHVG TVHAQLQRQQATDYSQEQQGKLLSPRSLGSTDSGYFSRSESADQTVSPPTPFARRFPAQNKTLEGVTDPLQLLSPRQHPL LCHREKALLLPGQMRPPLATKTLEERISKLISDNEALVDDKQLDSVKPRRTSLSRRGSIDSPKSYIFKDSFQFDLKPVGR RTSSSSDIPKSPFTPTEKSKQVFLLSVPSLDCLPITRSNSMPTTGYSAVPANIIPPPHPLRGSQSFDDKIGAFYDDVFVS GPNAPVPQSGHPRTLVRQAAIEDSSANESHVLGTGQSLDESHQGCHAAGEAMSVRSKALAQGPHIEKKKSHQGRGTMFEC ETCRNRYRKLENFENHKKFYCSELHGPKTKVAMREPEHSPVPGGLQPQILHYRVAGSSGIWEQTPQIRKRRKMKSVGDDE ELQQNESGTSPKSSEGLQFQNALGCNPSLPKHSVTIRSDQQHKNIQLQNSHIHLVARGPEQTMDPKLSTIMEQQISSAAQ DKIELQRHGTGISVIQHTNSLSRPNSFDKPEPFERASPVSFQELNRTGNSGSLKVIGISQEESHPSRDGSHPHQLALSDA LRGELQESSRKSPSERHVLGQPSRLIRQHNIQVPEILVTEEPDRDLEAQCHDQEKSEKFSWPQRSETLSKLPTEKLPPKK KRLRLAEIEHSSTESSFDSTLSRSLSRESSLSHTSSFSASLDIEDVSKTEASPKIDFLNKAEFLMIPAGLNTLNVPGCHR EMRRTASEQINCTQTSMEVSDLRSKSFDCGSITPPQTTPLTELQPPSSPSRVGVTGHVPLLERRRGPLVRQISLGIAPDS HLSPVHPTSFQNTALPSVNAVPYQGPQLTSTSLAEFSANTLHSQTQVKDLQAETSNSSSTNVFPVQQLCDINLLNQIHAP PSHQSTQLSLQVSTQGSKPDKNSVLSGSSKSEDCFAPKYQLHCQVFTSGPSCSSNPVHSLPNQVISDPVGTDHCVTSATL PTKLIDSMSNSHPLLPPELRPLGSQVQKVPSSFMLPIRLQSSVPAYCFATLTSLPQILVTQDLPNQPICQTNHSVVPISE EQNSVPTLQKGHQNALPNPEKEFLCENVFSEMSQNSSLSESLPITQKISVGRLSPQQESSASSKRMLSPANSLDIAMEKH QKRAKDENGAVCATDVRPLEALSSRVNEASKQKKPILVRQVCTTEPLDGVMLEKDVFSQPEISNEAVNLTNVLPADNSST GCSKFVVIEPISELQEFENIKSSTSLTLTVRSSPAPSENTHLSPLKCTDNNQERKSPGVKNQGDKVNIQEQSQRPVTSLS LFNIKDTQQLAFPSLKTTTNFTWCYLLRQKSLHLPQKDQKTSAYTDWTVSASNPNPLGLPTKVALALLNSKQNTGKSLYC QAITTHSKSDLLVYSSKWKSSLSKRALGNQKSTVVEFSNKDASEINSEQDKENSLIKSEPRRIKIFDGGYKSNEEYVYIR GRGRGKYICEECGIRCKKPSMLKKHIRTHTDVRPYHCTYCNFSFKTKGNLTKHMKSKAHSKKCVDLGISVGLIDEQDTEE SDEKQRFSYERSGYDLEESDGPDEDDNENEDDDEDSQAESVLSATPSVTASPQHLPSRSSLQDPVSTDEDVRITDCFSGV HTDPMDVLPRALLTRMTVLSTAQSDYNRKTLSPGKARQRAARDENDTIPSVDTSRSPCHQMSVDYPESEEILRSSMAGKA VAITQSPSSVRLPPAAAEHSPQTAAGMPSVASPHPDPQEQKQQITLQPTPGLPSPHTHLFSHLPLHSQQQSRTPYNMVPV GGIHVVPAGLTYSTFVPLQAGPVQLTIPAVSVVHRTLGTHRNTVTEVSGTTNPAGVAELSSVVPCIPIGQIRVPGLQNLS TPGLQSLPSLSMETVNIVGLANTNMAPQVHPPGLALNAVGLQVLTANPSSQSSPAPQAHIPGLQILNIALPTLIPSVSQV AVDAQGAPEMPASQSKACETQPKQTSVASANQVSRTESPQGLPTVQRENAKKVLNPPAPAGDHARLDGLSKMDTEKAASA NHVKPKPELTSIQGQPASTSQPLLKAHSEVFTKPSGQQTLSPDRQVPRPTGLPRRQPTVHFSDVSSDDDEDRLVIAT ; _struct_ref.pdbx_db_isoform ? # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 4ZNF _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 30 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession P15822 _struct_ref_seq.db_align_beg 2113 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 2142 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 30 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 4ZNF _struct_ref_seq_dif.mon_id SER _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 6 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code P15822 _struct_ref_seq_dif.db_mon_id THR _struct_ref_seq_dif.pdbx_seq_db_seq_num 2118 _struct_ref_seq_dif.details conflict _struct_ref_seq_dif.pdbx_auth_seq_num 6 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _pdbx_nmr_refine.entry_id 4ZNF _pdbx_nmr_refine.method ? _pdbx_nmr_refine.details ;THE 3D STRUCTURE OF THE ZINC FINGER IN SOLUTION BY NMR IS BASED ON 487 APPROXIMATE INTERPROTON DISTANCE RESTRAINTS AND 63 TORSION ANGLE RESTRAINTS DERIVED FROM NOE AND COUPLING CONSTANT MEASUREMENTS. THE STRUCTURES ARE CALCULATED USING THE HYBRID METRIC MATRIX DISTANCE GEOMETRY-DYNAMICAL SIMULATED ANNEALING METHOD DESCRIBED BY M. NILGES, G. M. CLORE, AND A. M. GRONENBORN (1988) FEBS LETT 229, 317. THIS ENTRY REPRESENTS 41 MODELS OF THE ZINC FINGER OF HUMAN ENHANCER BINDING PROTEIN. THE RESTRAINED MINIMIZED AVERAGE STRUCTURE (SA)$R DERIVED BY RESTRAINED LEAST SQUARE REFINEMENT OF THE MEAN STRUCTURE OBTAINED BY AVERAGING THE COORDINATES OF THE FINAL 41 SA STRUCTURES BEST FITTED TO EACH OTHER CAN BE FOUND IN PDB ENTRY 3ZNF. ; _pdbx_nmr_refine.software_ordinal 1 # _pdbx_nmr_ensemble.entry_id 4ZNF _pdbx_nmr_ensemble.conformers_calculated_total_number ? _pdbx_nmr_ensemble.conformers_submitted_total_number 41 _pdbx_nmr_ensemble.conformer_selection_criteria ? # _exptl.entry_id 4ZNF _exptl.method 'SOLUTION NMR' _exptl.crystals_number ? # _struct.entry_id 4ZNF _struct.title 'HIGH-RESOLUTION THREE-DIMENSIONAL STRUCTURE OF A SINGLE ZINC FINGER FROM A HUMAN ENHANCER BINDING PROTEIN IN SOLUTION' _struct.pdbx_model_details ? _struct.pdbx_CASP_flag ? _struct.pdbx_model_type_details ? # _struct_keywords.entry_id 4ZNF _struct_keywords.pdbx_keywords 'ZINC FINGER DNA BINDING DOMAIN' _struct_keywords.text 'ZINC FINGER DNA BINDING DOMAIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A Y N 1 ? B N N 2 ? # _struct_biol.id 1 # _struct_conf.conf_type_id HELX_P _struct_conf.id HELX_P1 _struct_conf.pdbx_PDB_helix_id 1 _struct_conf.beg_label_comp_id THR _struct_conf.beg_label_asym_id A _struct_conf.beg_label_seq_id 14 _struct_conf.pdbx_beg_PDB_ins_code ? _struct_conf.end_label_comp_id SER _struct_conf.end_label_asym_id A _struct_conf.end_label_seq_id 24 _struct_conf.pdbx_end_PDB_ins_code ? _struct_conf.beg_auth_comp_id THR _struct_conf.beg_auth_asym_id A _struct_conf.beg_auth_seq_id 14 _struct_conf.end_auth_comp_id SER _struct_conf.end_auth_asym_id A _struct_conf.end_auth_seq_id 24 _struct_conf.pdbx_PDB_helix_class 1 _struct_conf.details ? _struct_conf.pdbx_PDB_helix_length 11 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 5 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 5 A ZN 31 1_555 ? ? ? ? ? ? ? 2.297 ? ? metalc2 metalc ? ? A CYS 8 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 8 A ZN 31 1_555 ? ? ? ? ? ? ? 2.305 ? ? metalc3 metalc ? ? A HIS 21 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 21 A ZN 31 1_555 ? ? ? ? ? ? ? 2.007 ? ? metalc4 metalc ? ? A HIS 27 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 27 A ZN 31 1_555 ? ? ? ? ? ? ? 2.021 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 31 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'BINDING SITE FOR RESIDUE ZN A 31' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 5 ? CYS A 5 . ? 1_555 ? 2 AC1 4 CYS A 8 ? CYS A 8 . ? 1_555 ? 3 AC1 4 HIS A 21 ? HIS A 21 . ? 1_555 ? 4 AC1 4 HIS A 27 ? HIS A 27 . ? 1_555 ? # _database_PDB_matrix.entry_id 4ZNF _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 4ZNF _atom_sites.fract_transf_matrix[1][1] 1.000000 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 1.000000 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 1.000000 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # _atom_sites_footnote.id 1 _atom_sites_footnote.text 'THE C-TERMINAL TWO RESIDUES, LYS 29 AND LYS 30, ARE ILL-DEFINED.' # loop_ _atom_type.symbol C H N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 ARG 1 1 1 ARG ARG A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 TYR 3 3 3 TYR TYR A . n A 1 4 HIS 4 4 4 HIS HIS A . n A 1 5 CYS 5 5 5 CYS CYS A . n A 1 6 SER 6 6 6 SER SER A . n A 1 7 TYR 7 7 7 TYR TYR A . n A 1 8 CYS 8 8 8 CYS CYS A . n A 1 9 ASN 9 9 9 ASN ASN A . n A 1 10 PHE 10 10 10 PHE PHE A . n A 1 11 SER 11 11 11 SER SER A . n A 1 12 PHE 12 12 12 PHE PHE A . n A 1 13 LYS 13 13 13 LYS LYS A . n A 1 14 THR 14 14 14 THR THR A . n A 1 15 LYS 15 15 15 LYS LYS A . n A 1 16 GLY 16 16 16 GLY GLY A . n A 1 17 ASN 17 17 17 ASN ASN A . n A 1 18 LEU 18 18 18 LEU LEU A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 LYS 20 20 20 LYS LYS A . n A 1 21 HIS 21 21 21 HIS HIS A . n A 1 22 MET 22 22 22 MET MET A . n A 1 23 LYS 23 23 23 LYS LYS A . n A 1 24 SER 24 24 24 SER SER A . n A 1 25 LYS 25 25 25 LYS LYS A . n A 1 26 ALA 26 26 26 ALA ALA A . n A 1 27 HIS 27 27 27 HIS HIS A . n A 1 28 SER 28 28 28 SER SER A . n A 1 29 LYS 29 29 29 LYS LYS A . n A 1 30 LYS 30 30 30 LYS LYS A . n # _pdbx_nonpoly_scheme.asym_id B _pdbx_nonpoly_scheme.entity_id 2 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 31 _pdbx_nonpoly_scheme.auth_seq_num 31 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 5 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 31 ? 1_555 SG ? A CYS 8 ? A CYS 8 ? 1_555 111.9 ? 2 SG ? A CYS 5 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 31 ? 1_555 NE2 ? A HIS 21 ? A HIS 21 ? 1_555 111.2 ? 3 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 31 ? 1_555 NE2 ? A HIS 21 ? A HIS 21 ? 1_555 110.5 ? 4 SG ? A CYS 5 ? A CYS 5 ? 1_555 ZN ? B ZN . ? A ZN 31 ? 1_555 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 111.9 ? 5 SG ? A CYS 8 ? A CYS 8 ? 1_555 ZN ? B ZN . ? A ZN 31 ? 1_555 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 97.5 ? 6 NE2 ? A HIS 21 ? A HIS 21 ? 1_555 ZN ? B ZN . ? A ZN 31 ? 1_555 NE2 ? A HIS 27 ? A HIS 27 ? 1_555 113.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 1992-01-15 2 'Structure model' 1 1 2008-03-25 3 'Structure model' 1 2 2011-07-13 4 'Structure model' 1 3 2022-03-16 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Version format compliance' 2 3 'Structure model' 'Version format compliance' 3 4 'Structure model' 'Database references' 4 4 'Structure model' 'Derived calculations' 5 4 'Structure model' Other # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 4 'Structure model' database_2 2 4 'Structure model' pdbx_database_status 3 4 'Structure model' pdbx_struct_assembly 4 4 'Structure model' pdbx_struct_conn_angle 5 4 'Structure model' pdbx_struct_oper_list 6 4 'Structure model' struct_conn 7 4 'Structure model' struct_ref_seq_dif 8 4 'Structure model' struct_site # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 4 'Structure model' '_database_2.pdbx_DOI' 2 4 'Structure model' '_database_2.pdbx_database_accession' 3 4 'Structure model' '_pdbx_database_status.process_site' 4 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_comp_id' 5 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_auth_seq_id' 6 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_atom_id' 7 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_comp_id' 8 4 'Structure model' '_pdbx_struct_conn_angle.ptnr1_label_seq_id' 9 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_comp_id' 10 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_auth_seq_id' 11 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_atom_id' 12 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_comp_id' 13 4 'Structure model' '_pdbx_struct_conn_angle.ptnr3_label_seq_id' 14 4 'Structure model' '_pdbx_struct_conn_angle.value' 15 4 'Structure model' '_struct_conn.pdbx_dist_value' 16 4 'Structure model' '_struct_conn.ptnr1_auth_comp_id' 17 4 'Structure model' '_struct_conn.ptnr1_auth_seq_id' 18 4 'Structure model' '_struct_conn.ptnr1_label_asym_id' 19 4 'Structure model' '_struct_conn.ptnr1_label_atom_id' 20 4 'Structure model' '_struct_conn.ptnr1_label_comp_id' 21 4 'Structure model' '_struct_conn.ptnr1_label_seq_id' 22 4 'Structure model' '_struct_conn.ptnr2_auth_comp_id' 23 4 'Structure model' '_struct_conn.ptnr2_auth_seq_id' 24 4 'Structure model' '_struct_conn.ptnr2_label_asym_id' 25 4 'Structure model' '_struct_conn.ptnr2_label_atom_id' 26 4 'Structure model' '_struct_conn.ptnr2_label_comp_id' 27 4 'Structure model' '_struct_conn.ptnr2_label_seq_id' 28 4 'Structure model' '_struct_ref_seq_dif.details' 29 4 'Structure model' '_struct_site.pdbx_auth_asym_id' 30 4 'Structure model' '_struct_site.pdbx_auth_comp_id' 31 4 'Structure model' '_struct_site.pdbx_auth_seq_id' # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 19 O A THR 19 ? ? H A LYS 23 ? ? 1.58 2 31 O A THR 19 ? ? H A LYS 23 ? ? 1.59 3 36 O A THR 19 ? ? H A LYS 23 ? ? 1.58 # loop_ _pdbx_validate_rmsd_bond.id _pdbx_validate_rmsd_bond.PDB_model_num _pdbx_validate_rmsd_bond.auth_atom_id_1 _pdbx_validate_rmsd_bond.auth_asym_id_1 _pdbx_validate_rmsd_bond.auth_comp_id_1 _pdbx_validate_rmsd_bond.auth_seq_id_1 _pdbx_validate_rmsd_bond.PDB_ins_code_1 _pdbx_validate_rmsd_bond.label_alt_id_1 _pdbx_validate_rmsd_bond.auth_atom_id_2 _pdbx_validate_rmsd_bond.auth_asym_id_2 _pdbx_validate_rmsd_bond.auth_comp_id_2 _pdbx_validate_rmsd_bond.auth_seq_id_2 _pdbx_validate_rmsd_bond.PDB_ins_code_2 _pdbx_validate_rmsd_bond.label_alt_id_2 _pdbx_validate_rmsd_bond.bond_value _pdbx_validate_rmsd_bond.bond_target_value _pdbx_validate_rmsd_bond.bond_deviation _pdbx_validate_rmsd_bond.bond_standard_deviation _pdbx_validate_rmsd_bond.linker_flag 1 1 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.253 1.369 -0.116 0.015 N 2 1 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.411 1.354 0.057 0.009 N 3 1 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.274 1.369 -0.095 0.015 N 4 2 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.252 1.369 -0.117 0.015 N 5 2 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.278 1.369 -0.091 0.015 N 6 2 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.272 1.369 -0.097 0.015 N 7 3 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.253 1.369 -0.116 0.015 N 8 3 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.271 1.369 -0.098 0.015 N 9 4 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.256 1.369 -0.113 0.015 N 10 4 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.276 1.369 -0.093 0.015 N 11 4 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.412 1.354 0.058 0.009 N 12 4 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.273 1.369 -0.096 0.015 N 13 5 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.250 1.369 -0.119 0.015 N 14 5 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.408 1.354 0.054 0.009 N 15 5 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.272 1.369 -0.097 0.015 N 16 6 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.254 1.369 -0.115 0.015 N 17 6 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.279 1.369 -0.090 0.015 N 18 6 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.411 1.354 0.057 0.009 N 19 6 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.268 1.369 -0.101 0.015 N 20 7 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.254 1.369 -0.115 0.015 N 21 7 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.413 1.354 0.059 0.009 N 22 7 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.268 1.369 -0.101 0.015 N 23 8 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.251 1.369 -0.118 0.015 N 24 8 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.279 1.369 -0.090 0.015 N 25 8 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.409 1.354 0.055 0.009 N 26 8 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.269 1.369 -0.100 0.015 N 27 9 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.253 1.369 -0.116 0.015 N 28 9 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.414 1.354 0.060 0.009 N 29 9 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.270 1.369 -0.099 0.015 N 30 10 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.254 1.369 -0.115 0.015 N 31 10 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.279 1.369 -0.090 0.015 N 32 10 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.414 1.354 0.060 0.009 N 33 10 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.270 1.369 -0.099 0.015 N 34 11 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.256 1.369 -0.113 0.015 N 35 11 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.277 1.369 -0.092 0.015 N 36 11 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.410 1.354 0.056 0.009 N 37 11 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.271 1.369 -0.098 0.015 N 38 12 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.254 1.369 -0.115 0.015 N 39 12 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.417 1.354 0.063 0.009 N 40 12 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.269 1.369 -0.100 0.015 N 41 13 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.253 1.369 -0.116 0.015 N 42 13 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.278 1.369 -0.091 0.015 N 43 13 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.409 1.354 0.055 0.009 N 44 13 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.271 1.369 -0.098 0.015 N 45 14 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.254 1.369 -0.115 0.015 N 46 14 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.270 1.369 -0.099 0.015 N 47 15 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.252 1.369 -0.117 0.015 N 48 15 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.278 1.369 -0.091 0.015 N 49 15 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.415 1.354 0.061 0.009 N 50 15 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.268 1.369 -0.101 0.015 N 51 16 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.254 1.369 -0.115 0.015 N 52 16 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.270 1.369 -0.099 0.015 N 53 17 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.255 1.369 -0.114 0.015 N 54 17 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.279 1.369 -0.090 0.015 N 55 17 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.412 1.354 0.058 0.009 N 56 17 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.268 1.369 -0.101 0.015 N 57 18 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.252 1.369 -0.117 0.015 N 58 18 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.408 1.354 0.054 0.009 N 59 18 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.269 1.369 -0.100 0.015 N 60 19 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.253 1.369 -0.116 0.015 N 61 19 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.279 1.369 -0.090 0.015 N 62 19 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.408 1.354 0.054 0.009 N 63 19 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.270 1.369 -0.099 0.015 N 64 20 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.252 1.369 -0.117 0.015 N 65 20 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.278 1.369 -0.091 0.015 N 66 20 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.409 1.354 0.055 0.009 N 67 20 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.271 1.369 -0.098 0.015 N 68 21 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.253 1.369 -0.116 0.015 N 69 21 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.412 1.354 0.058 0.009 N 70 21 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.271 1.369 -0.098 0.015 N 71 22 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.253 1.369 -0.116 0.015 N 72 22 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.277 1.369 -0.092 0.015 N 73 22 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.415 1.354 0.061 0.009 N 74 22 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.270 1.369 -0.099 0.015 N 75 23 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.254 1.369 -0.115 0.015 N 76 23 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.414 1.354 0.060 0.009 N 77 23 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.267 1.369 -0.102 0.015 N 78 24 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.252 1.369 -0.117 0.015 N 79 24 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.279 1.369 -0.090 0.015 N 80 24 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.410 1.354 0.056 0.009 N 81 24 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.271 1.369 -0.098 0.015 N 82 25 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.254 1.369 -0.115 0.015 N 83 25 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.413 1.354 0.059 0.009 N 84 25 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.270 1.369 -0.099 0.015 N 85 26 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.252 1.369 -0.117 0.015 N 86 26 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.408 1.354 0.054 0.009 N 87 26 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.270 1.369 -0.099 0.015 N 88 27 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.253 1.369 -0.116 0.015 N 89 27 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.418 1.354 0.064 0.009 N 90 27 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.271 1.369 -0.098 0.015 N 91 28 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.251 1.369 -0.118 0.015 N 92 28 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.409 1.354 0.055 0.009 N 93 28 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.273 1.369 -0.096 0.015 N 94 29 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.255 1.369 -0.114 0.015 N 95 29 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.270 1.369 -0.099 0.015 N 96 30 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.252 1.369 -0.117 0.015 N 97 30 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.408 1.354 0.054 0.009 N 98 30 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.271 1.369 -0.098 0.015 N 99 31 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.253 1.369 -0.116 0.015 N 100 31 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.411 1.354 0.057 0.009 N 101 31 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.270 1.369 -0.099 0.015 N 102 32 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.253 1.369 -0.116 0.015 N 103 32 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.410 1.354 0.056 0.009 N 104 32 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.271 1.369 -0.098 0.015 N 105 33 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.253 1.369 -0.116 0.015 N 106 33 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.412 1.354 0.058 0.009 N 107 33 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.271 1.369 -0.098 0.015 N 108 34 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.252 1.369 -0.117 0.015 N 109 34 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.272 1.369 -0.097 0.015 N 110 35 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.252 1.369 -0.117 0.015 N 111 35 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.411 1.354 0.057 0.009 N 112 35 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.268 1.369 -0.101 0.015 N 113 36 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.253 1.369 -0.116 0.015 N 114 36 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.269 1.369 -0.100 0.015 N 115 37 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.255 1.369 -0.114 0.015 N 116 37 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.277 1.369 -0.092 0.015 N 117 37 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.409 1.354 0.055 0.009 N 118 37 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.274 1.369 -0.095 0.015 N 119 38 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.252 1.369 -0.117 0.015 N 120 38 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.413 1.354 0.059 0.009 N 121 38 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.271 1.369 -0.098 0.015 N 122 39 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.251 1.369 -0.118 0.015 N 123 39 CG A HIS 21 ? ? ND1 A HIS 21 ? ? 1.276 1.369 -0.093 0.015 N 124 39 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.270 1.369 -0.099 0.015 N 125 40 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.252 1.369 -0.117 0.015 N 126 40 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.411 1.354 0.057 0.009 N 127 40 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.270 1.369 -0.099 0.015 N 128 41 CG A HIS 4 ? ? ND1 A HIS 4 ? ? 1.255 1.369 -0.114 0.015 N 129 41 CG A HIS 27 ? ? CD2 A HIS 27 ? ? 1.410 1.354 0.056 0.009 N 130 41 CG A HIS 27 ? ? ND1 A HIS 27 ? ? 1.271 1.369 -0.098 0.015 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 PRO A 2 ? ? -69.01 37.04 2 1 TYR A 7 ? ? -157.59 -75.55 3 1 CYS A 8 ? ? -58.80 -157.45 4 1 PHE A 12 ? ? -124.86 -163.39 5 1 ALA A 26 ? ? -63.53 -90.26 6 1 HIS A 27 ? ? -175.51 71.33 7 1 SER A 28 ? ? -152.15 73.70 8 2 PRO A 2 ? ? -66.10 7.32 9 2 CYS A 5 ? ? -47.88 164.59 10 2 TYR A 7 ? ? -160.94 -74.36 11 2 CYS A 8 ? ? -61.10 -164.44 12 2 PHE A 10 ? ? -68.98 69.06 13 2 ALA A 26 ? ? -50.26 -89.25 14 2 HIS A 27 ? ? -175.43 66.41 15 2 SER A 28 ? ? -169.28 83.34 16 3 PRO A 2 ? ? -67.36 30.52 17 3 CYS A 5 ? ? -48.07 156.69 18 3 TYR A 7 ? ? -161.07 -77.17 19 3 CYS A 8 ? ? -57.79 -159.76 20 3 PHE A 10 ? ? -67.93 92.76 21 3 PHE A 12 ? ? -102.81 -154.59 22 3 LYS A 25 ? ? -76.93 39.57 23 3 ALA A 26 ? ? -64.05 -87.07 24 3 HIS A 27 ? ? -172.80 81.55 25 3 SER A 28 ? ? -171.03 95.66 26 4 PRO A 2 ? ? -65.00 24.53 27 4 TYR A 7 ? ? -156.25 -74.55 28 4 CYS A 8 ? ? -61.36 -157.51 29 4 PHE A 10 ? ? -67.96 92.11 30 4 LYS A 20 ? ? -46.35 -19.13 31 4 LYS A 25 ? ? -73.21 25.08 32 4 ALA A 26 ? ? -52.20 -87.79 33 4 HIS A 27 ? ? -170.70 76.16 34 4 SER A 28 ? ? -170.33 87.85 35 5 TYR A 7 ? ? -159.71 -74.38 36 5 CYS A 8 ? ? -58.36 -170.25 37 5 PHE A 12 ? ? -128.97 -164.45 38 5 SER A 24 ? ? -64.24 -161.53 39 5 LYS A 25 ? ? -104.53 57.38 40 5 ALA A 26 ? ? -80.36 -84.34 41 5 HIS A 27 ? ? -175.16 69.97 42 6 TYR A 7 ? ? -160.60 -75.47 43 6 CYS A 8 ? ? -57.09 -168.52 44 6 PHE A 10 ? ? -66.74 88.50 45 6 ALA A 26 ? ? -46.67 -87.54 46 6 HIS A 27 ? ? -173.54 66.93 47 6 SER A 28 ? ? -171.36 90.21 48 7 PRO A 2 ? ? -66.30 27.39 49 7 CYS A 5 ? ? -49.92 167.12 50 7 TYR A 7 ? ? -159.06 -72.53 51 7 CYS A 8 ? ? -63.60 -167.39 52 7 PHE A 12 ? ? -101.52 -158.42 53 7 ALA A 26 ? ? -73.79 -85.49 54 7 HIS A 27 ? ? -165.29 48.62 55 7 SER A 28 ? ? -145.86 24.74 56 7 LYS A 29 ? ? -116.62 51.62 57 8 PRO A 2 ? ? -60.87 13.64 58 8 TYR A 7 ? ? -158.99 -76.44 59 8 CYS A 8 ? ? -56.93 -161.79 60 8 PHE A 12 ? ? -103.37 -161.57 61 8 SER A 24 ? ? -51.84 170.55 62 8 LYS A 25 ? ? -81.20 45.08 63 8 ALA A 26 ? ? -64.48 -88.30 64 8 HIS A 27 ? ? -173.18 77.80 65 8 SER A 28 ? ? -166.98 85.32 66 8 LYS A 29 ? ? -110.28 58.20 67 9 PRO A 2 ? ? -56.56 -2.36 68 9 TYR A 7 ? ? -163.39 -73.93 69 9 CYS A 8 ? ? -54.42 -164.83 70 9 PHE A 10 ? ? -69.63 91.68 71 9 ALA A 26 ? ? -45.12 -86.32 72 9 HIS A 27 ? ? -153.27 55.84 73 9 SER A 28 ? ? -170.82 86.96 74 10 PRO A 2 ? ? -68.04 30.90 75 10 CYS A 5 ? ? -44.93 165.64 76 10 TYR A 7 ? ? -156.49 -73.40 77 10 CYS A 8 ? ? -59.99 -162.90 78 10 PHE A 10 ? ? -65.83 92.23 79 10 PHE A 12 ? ? -94.22 -159.41 80 10 LYS A 25 ? ? -76.29 35.49 81 10 ALA A 26 ? ? -46.10 -93.05 82 10 HIS A 27 ? ? -175.98 74.09 83 10 SER A 28 ? ? -138.23 -103.81 84 11 PRO A 2 ? ? -62.15 9.01 85 11 CYS A 5 ? ? -44.22 160.19 86 11 TYR A 7 ? ? -157.15 -75.16 87 11 CYS A 8 ? ? -60.77 -162.64 88 11 PHE A 12 ? ? -102.30 -158.78 89 11 LYS A 25 ? ? -73.97 38.28 90 11 ALA A 26 ? ? -59.72 -84.59 91 11 HIS A 27 ? ? -176.20 71.72 92 11 SER A 28 ? ? -169.70 84.47 93 12 PRO A 2 ? ? -67.57 30.24 94 12 CYS A 5 ? ? -47.98 166.28 95 12 TYR A 7 ? ? -159.24 -74.18 96 12 CYS A 8 ? ? -58.08 -168.24 97 12 PHE A 10 ? ? -64.88 74.38 98 12 PHE A 12 ? ? -106.15 -160.01 99 12 LYS A 25 ? ? -32.44 87.61 100 12 ALA A 26 ? ? -115.14 -74.97 101 12 HIS A 27 ? ? -167.26 78.15 102 12 SER A 28 ? ? -170.49 79.55 103 13 CYS A 5 ? ? -47.21 162.83 104 13 TYR A 7 ? ? -160.52 -77.42 105 13 CYS A 8 ? ? -55.68 -167.41 106 13 PHE A 10 ? ? -68.39 87.22 107 13 PHE A 12 ? ? -105.28 -156.08 108 13 LYS A 20 ? ? -48.65 -19.83 109 13 ALA A 26 ? ? -64.45 -85.00 110 13 HIS A 27 ? ? -171.81 86.31 111 13 SER A 28 ? ? -170.29 91.88 112 14 PRO A 2 ? ? -69.34 46.37 113 14 CYS A 5 ? ? -45.78 156.97 114 14 TYR A 7 ? ? -157.75 -77.86 115 14 CYS A 8 ? ? -57.43 -162.05 116 14 PHE A 12 ? ? -103.66 -164.14 117 14 ALA A 26 ? ? -69.30 -88.14 118 14 HIS A 27 ? ? -170.58 74.57 119 14 SER A 28 ? ? -162.10 86.84 120 15 TYR A 7 ? ? -159.22 -75.48 121 15 CYS A 8 ? ? -55.90 -162.95 122 15 SER A 24 ? ? -50.96 174.31 123 15 LYS A 25 ? ? -83.74 46.00 124 15 ALA A 26 ? ? -70.12 -86.27 125 15 HIS A 27 ? ? -173.37 52.55 126 15 SER A 28 ? ? -156.21 56.80 127 15 LYS A 29 ? ? -84.47 45.80 128 16 PRO A 2 ? ? -65.20 10.93 129 16 CYS A 5 ? ? -47.33 165.19 130 16 TYR A 7 ? ? -159.71 -74.96 131 16 CYS A 8 ? ? -60.68 -168.73 132 16 PHE A 10 ? ? -69.61 94.75 133 16 PHE A 12 ? ? -130.91 -157.36 134 16 SER A 24 ? ? -72.65 -150.91 135 16 ALA A 26 ? ? -43.52 -89.45 136 16 HIS A 27 ? ? -172.98 37.74 137 16 SER A 28 ? ? -158.40 55.94 138 17 PRO A 2 ? ? -69.19 25.51 139 17 TYR A 7 ? ? -161.77 -75.52 140 17 CYS A 8 ? ? -58.25 -159.46 141 17 PHE A 10 ? ? -68.71 92.82 142 17 LYS A 25 ? ? -75.76 34.10 143 17 ALA A 26 ? ? -61.19 -89.48 144 17 HIS A 27 ? ? -176.24 79.20 145 17 SER A 28 ? ? -166.84 87.55 146 18 CYS A 5 ? ? -38.93 164.19 147 18 TYR A 7 ? ? -159.10 -74.35 148 18 CYS A 8 ? ? -62.95 -162.44 149 18 PHE A 10 ? ? -66.72 92.08 150 18 PHE A 12 ? ? -126.78 -158.13 151 18 SER A 24 ? ? -47.39 172.55 152 18 LYS A 25 ? ? -74.98 32.89 153 18 ALA A 26 ? ? -52.28 -90.41 154 18 HIS A 27 ? ? -175.78 73.59 155 18 SER A 28 ? ? -170.91 88.67 156 19 PRO A 2 ? ? -66.71 19.46 157 19 TYR A 7 ? ? -160.14 -75.02 158 19 CYS A 8 ? ? -58.02 -156.96 159 19 PHE A 12 ? ? -137.87 -157.50 160 19 LYS A 25 ? ? -75.61 27.30 161 19 ALA A 26 ? ? -46.18 -92.19 162 19 HIS A 27 ? ? -174.38 74.56 163 19 SER A 28 ? ? -171.46 40.42 164 20 PRO A 2 ? ? -59.96 18.44 165 20 TYR A 7 ? ? -157.29 -74.81 166 20 CYS A 8 ? ? -57.44 -162.95 167 20 PHE A 12 ? ? -127.04 -162.44 168 20 LYS A 25 ? ? -75.38 40.60 169 20 ALA A 26 ? ? -55.97 -88.29 170 20 HIS A 27 ? ? -175.86 76.37 171 20 SER A 28 ? ? -167.79 75.95 172 21 PRO A 2 ? ? -57.41 7.56 173 21 CYS A 5 ? ? -43.33 162.96 174 21 TYR A 7 ? ? -159.42 -74.93 175 21 CYS A 8 ? ? -58.50 -162.91 176 21 SER A 24 ? ? -45.56 167.26 177 21 LYS A 25 ? ? -72.49 26.53 178 21 ALA A 26 ? ? -43.03 -92.04 179 21 HIS A 27 ? ? -173.27 79.11 180 21 SER A 28 ? ? -152.97 53.15 181 22 PRO A 2 ? ? -67.47 16.85 182 22 CYS A 5 ? ? -49.64 164.82 183 22 TYR A 7 ? ? -158.33 -75.33 184 22 CYS A 8 ? ? -59.19 -158.85 185 22 PHE A 12 ? ? -102.23 -160.05 186 22 LYS A 25 ? ? -57.37 78.49 187 22 ALA A 26 ? ? -99.10 -81.79 188 22 HIS A 27 ? ? -172.58 80.55 189 22 SER A 28 ? ? -167.93 96.29 190 22 LYS A 29 ? ? -99.40 49.10 191 23 PRO A 2 ? ? -64.00 7.71 192 23 CYS A 5 ? ? -43.66 155.64 193 23 TYR A 7 ? ? -157.64 -78.54 194 23 CYS A 8 ? ? -54.91 -166.38 195 23 LYS A 25 ? ? -57.38 78.77 196 23 ALA A 26 ? ? -89.36 -79.34 197 23 HIS A 27 ? ? -176.35 82.50 198 23 SER A 28 ? ? -156.79 88.61 199 24 PRO A 2 ? ? -66.12 21.93 200 24 CYS A 5 ? ? -47.14 161.64 201 24 TYR A 7 ? ? -161.16 -76.29 202 24 CYS A 8 ? ? -56.50 -165.75 203 24 PHE A 10 ? ? -65.33 93.67 204 24 PHE A 12 ? ? -97.74 -158.94 205 24 LYS A 25 ? ? -83.81 40.55 206 24 ALA A 26 ? ? -46.98 -92.54 207 24 HIS A 27 ? ? -175.19 79.75 208 24 SER A 28 ? ? -150.05 16.72 209 25 PRO A 2 ? ? -59.38 10.79 210 25 CYS A 5 ? ? -42.62 154.95 211 25 TYR A 7 ? ? -157.99 -77.23 212 25 CYS A 8 ? ? -55.89 -162.42 213 25 LYS A 20 ? ? -47.70 -17.90 214 25 LYS A 25 ? ? -92.58 42.60 215 25 ALA A 26 ? ? -48.65 -92.87 216 25 HIS A 27 ? ? -173.48 66.49 217 26 PRO A 2 ? ? -70.71 35.83 218 26 TYR A 7 ? ? -159.76 -73.38 219 26 CYS A 8 ? ? -63.66 -172.48 220 26 PHE A 12 ? ? -117.02 -162.37 221 26 LYS A 25 ? ? -74.68 36.11 222 26 ALA A 26 ? ? -41.36 -92.80 223 26 HIS A 27 ? ? -175.09 72.44 224 26 SER A 28 ? ? -152.28 43.14 225 27 PRO A 2 ? ? -64.34 14.20 226 27 CYS A 5 ? ? -48.52 160.92 227 27 TYR A 7 ? ? -157.52 -75.28 228 27 CYS A 8 ? ? -58.48 -164.82 229 27 PHE A 10 ? ? -68.93 96.14 230 27 PHE A 12 ? ? -100.13 -163.46 231 27 LYS A 25 ? ? -37.16 89.99 232 27 ALA A 26 ? ? -112.98 -76.37 233 27 HIS A 27 ? ? -173.01 73.93 234 27 SER A 28 ? ? -166.45 -16.27 235 28 PRO A 2 ? ? -69.02 33.81 236 28 TYR A 7 ? ? -161.42 -75.89 237 28 CYS A 8 ? ? -58.06 -162.04 238 28 LYS A 25 ? ? -75.42 23.68 239 28 ALA A 26 ? ? -44.32 -90.92 240 28 HIS A 27 ? ? -175.64 75.97 241 28 SER A 28 ? ? -170.60 89.45 242 29 PRO A 2 ? ? -68.50 33.00 243 29 CYS A 5 ? ? -49.59 161.57 244 29 TYR A 7 ? ? -159.96 -74.95 245 29 CYS A 8 ? ? -57.38 -161.08 246 29 PHE A 10 ? ? -67.80 94.69 247 29 PHE A 12 ? ? -92.38 -156.15 248 29 LYS A 25 ? ? -77.17 24.42 249 29 ALA A 26 ? ? -46.90 -90.00 250 29 HIS A 27 ? ? -176.05 88.32 251 29 SER A 28 ? ? -157.80 88.17 252 30 TYR A 7 ? ? -161.93 -75.81 253 30 CYS A 8 ? ? -57.42 -160.81 254 30 PHE A 10 ? ? -69.16 91.60 255 30 SER A 24 ? ? -52.81 173.42 256 30 LYS A 25 ? ? -74.37 25.93 257 30 ALA A 26 ? ? -44.31 -91.07 258 30 HIS A 27 ? ? -175.28 82.22 259 30 SER A 28 ? ? -170.59 69.74 260 30 LYS A 29 ? ? -84.75 -89.70 261 31 PRO A 2 ? ? -57.48 5.27 262 31 TYR A 7 ? ? -160.35 -78.61 263 31 CYS A 8 ? ? -55.08 -166.20 264 31 PHE A 10 ? ? -65.59 82.28 265 31 PHE A 12 ? ? -87.06 -159.56 266 31 LYS A 23 ? ? -53.17 -70.17 267 31 SER A 24 ? ? -49.64 160.71 268 31 LYS A 25 ? ? -77.29 44.69 269 31 ALA A 26 ? ? -52.00 -89.28 270 31 HIS A 27 ? ? -169.52 86.91 271 31 SER A 28 ? ? -158.57 71.71 272 31 LYS A 29 ? ? -100.46 -76.87 273 32 PRO A 2 ? ? -67.35 28.91 274 32 CYS A 5 ? ? -44.87 159.30 275 32 TYR A 7 ? ? -158.24 -77.22 276 32 CYS A 8 ? ? -55.50 -165.41 277 32 PHE A 10 ? ? -69.09 73.12 278 32 PHE A 12 ? ? -84.45 -157.52 279 32 SER A 24 ? ? -53.90 -173.03 280 32 LYS A 25 ? ? -88.69 37.71 281 32 ALA A 26 ? ? -47.66 -92.43 282 32 HIS A 27 ? ? -175.07 76.44 283 32 SER A 28 ? ? -147.18 10.87 284 33 PRO A 2 ? ? -59.87 9.77 285 33 CYS A 5 ? ? -43.38 161.34 286 33 TYR A 7 ? ? -161.88 -73.77 287 33 CYS A 8 ? ? -57.60 -160.01 288 33 PHE A 12 ? ? -110.70 -169.49 289 33 SER A 24 ? ? -54.70 174.86 290 33 LYS A 25 ? ? -71.02 25.54 291 33 ALA A 26 ? ? -44.70 -89.88 292 33 HIS A 27 ? ? -175.78 41.94 293 33 SER A 28 ? ? -158.77 73.78 294 33 LYS A 29 ? ? -110.74 -79.78 295 34 PRO A 2 ? ? -68.15 29.02 296 34 TYR A 7 ? ? -160.53 -77.09 297 34 CYS A 8 ? ? -56.41 -164.31 298 34 SER A 24 ? ? -55.63 -165.73 299 34 LYS A 25 ? ? -95.12 46.46 300 34 ALA A 26 ? ? -57.51 -91.44 301 34 HIS A 27 ? ? -177.14 44.80 302 34 SER A 28 ? ? -171.43 96.41 303 34 LYS A 29 ? ? -124.24 -92.40 304 35 TYR A 7 ? ? -154.23 -75.33 305 35 CYS A 8 ? ? -55.56 -167.19 306 35 PHE A 12 ? ? -129.64 -167.97 307 35 ALA A 26 ? ? -67.54 -89.37 308 35 HIS A 27 ? ? -173.62 73.75 309 35 LYS A 29 ? ? -144.89 -32.59 310 36 CYS A 5 ? ? -44.56 167.21 311 36 TYR A 7 ? ? -159.49 -74.51 312 36 CYS A 8 ? ? -56.08 -166.19 313 36 ALA A 26 ? ? -86.78 -86.97 314 36 HIS A 27 ? ? -175.19 67.86 315 37 PRO A 2 ? ? -67.61 37.47 316 37 CYS A 5 ? ? -43.13 165.95 317 37 TYR A 7 ? ? -157.65 -73.53 318 37 CYS A 8 ? ? -63.09 -175.28 319 37 PHE A 12 ? ? -104.87 -167.20 320 37 SER A 24 ? ? -47.92 174.47 321 37 LYS A 25 ? ? -74.30 28.94 322 37 ALA A 26 ? ? -52.36 -91.77 323 37 HIS A 27 ? ? -175.47 51.71 324 37 SER A 28 ? ? -171.88 95.06 325 38 PRO A 2 ? ? -67.84 21.08 326 38 TYR A 7 ? ? -162.30 -74.51 327 38 CYS A 8 ? ? -58.76 -163.36 328 38 PHE A 12 ? ? -103.19 -161.64 329 38 LYS A 25 ? ? -81.30 49.07 330 38 ALA A 26 ? ? -67.74 -83.12 331 38 HIS A 27 ? ? -175.43 78.33 332 38 SER A 28 ? ? -166.23 72.16 333 39 CYS A 5 ? ? -49.06 166.44 334 39 TYR A 7 ? ? -160.81 -75.58 335 39 CYS A 8 ? ? -56.87 -163.84 336 39 SER A 24 ? ? -66.93 -157.62 337 39 ALA A 26 ? ? -57.31 -82.26 338 39 HIS A 27 ? ? -174.47 88.32 339 39 SER A 28 ? ? -171.19 92.78 340 40 PRO A 2 ? ? -62.12 10.44 341 40 TYR A 7 ? ? -156.06 -73.50 342 40 CYS A 8 ? ? -58.77 -166.78 343 40 PHE A 12 ? ? -115.41 -166.91 344 40 LYS A 25 ? ? -72.88 25.23 345 40 ALA A 26 ? ? -41.99 -90.78 346 40 HIS A 27 ? ? -171.27 88.23 347 40 SER A 28 ? ? -145.72 27.65 348 41 PRO A 2 ? ? -62.18 6.02 349 41 TYR A 7 ? ? -161.35 -76.11 350 41 CYS A 8 ? ? -55.22 -168.43 351 41 ALA A 26 ? ? -44.76 -87.66 352 41 HIS A 27 ? ? -175.02 86.00 353 41 SER A 28 ? ? -162.29 60.71 # loop_ _pdbx_validate_planes.id _pdbx_validate_planes.PDB_model_num _pdbx_validate_planes.auth_comp_id _pdbx_validate_planes.auth_asym_id _pdbx_validate_planes.auth_seq_id _pdbx_validate_planes.PDB_ins_code _pdbx_validate_planes.label_alt_id _pdbx_validate_planes.rmsd _pdbx_validate_planes.type 1 1 ARG A 1 ? ? 0.261 'SIDE CHAIN' 2 2 ARG A 1 ? ? 0.304 'SIDE CHAIN' 3 3 ARG A 1 ? ? 0.200 'SIDE CHAIN' 4 4 ARG A 1 ? ? 0.298 'SIDE CHAIN' 5 5 ARG A 1 ? ? 0.284 'SIDE CHAIN' 6 6 ARG A 1 ? ? 0.207 'SIDE CHAIN' 7 7 ARG A 1 ? ? 0.190 'SIDE CHAIN' 8 8 ARG A 1 ? ? 0.313 'SIDE CHAIN' 9 9 ARG A 1 ? ? 0.200 'SIDE CHAIN' 10 11 ARG A 1 ? ? 0.105 'SIDE CHAIN' 11 12 ARG A 1 ? ? 0.306 'SIDE CHAIN' 12 13 ARG A 1 ? ? 0.319 'SIDE CHAIN' 13 14 ARG A 1 ? ? 0.222 'SIDE CHAIN' 14 15 ARG A 1 ? ? 0.245 'SIDE CHAIN' 15 16 ARG A 1 ? ? 0.084 'SIDE CHAIN' 16 17 ARG A 1 ? ? 0.316 'SIDE CHAIN' 17 18 ARG A 1 ? ? 0.212 'SIDE CHAIN' 18 19 ARG A 1 ? ? 0.308 'SIDE CHAIN' 19 20 ARG A 1 ? ? 0.243 'SIDE CHAIN' 20 21 ARG A 1 ? ? 0.291 'SIDE CHAIN' 21 22 ARG A 1 ? ? 0.307 'SIDE CHAIN' 22 23 ARG A 1 ? ? 0.088 'SIDE CHAIN' 23 24 ARG A 1 ? ? 0.195 'SIDE CHAIN' 24 25 ARG A 1 ? ? 0.155 'SIDE CHAIN' 25 26 ARG A 1 ? ? 0.266 'SIDE CHAIN' 26 27 ARG A 1 ? ? 0.191 'SIDE CHAIN' 27 28 ARG A 1 ? ? 0.260 'SIDE CHAIN' 28 29 ARG A 1 ? ? 0.270 'SIDE CHAIN' 29 30 ARG A 1 ? ? 0.117 'SIDE CHAIN' 30 31 ARG A 1 ? ? 0.127 'SIDE CHAIN' 31 32 ARG A 1 ? ? 0.295 'SIDE CHAIN' 32 33 ARG A 1 ? ? 0.268 'SIDE CHAIN' 33 34 ARG A 1 ? ? 0.247 'SIDE CHAIN' 34 35 ARG A 1 ? ? 0.108 'SIDE CHAIN' 35 36 ARG A 1 ? ? 0.115 'SIDE CHAIN' 36 37 ARG A 1 ? ? 0.148 'SIDE CHAIN' 37 38 ARG A 1 ? ? 0.092 'SIDE CHAIN' 38 39 ARG A 1 ? ? 0.182 'SIDE CHAIN' 39 40 ARG A 1 ? ? 0.165 'SIDE CHAIN' 40 41 ARG A 1 ? ? 0.232 'SIDE CHAIN' # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN #