data_5AUJ # _entry.id 5AUJ # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5AUJ WWPDB D_1300000003 # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'The entry is the selenomethionine derivative of 1GE8' _pdbx_database_related.db_id 1GE8 _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5AUJ _pdbx_database_status.recvd_initial_deposition_date 2015-04-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Watanabe, Y.' 1 'Oyama, T.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country ? _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'To Be Published' _citation.journal_id_ASTM ? _citation.journal_id_CSD 0353 _citation.journal_id_ISSN ? _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume ? _citation.language ? _citation.page_first ? _citation.page_last ? _citation.title 'Pyrococcus furiosus proliferating cell nuclear antigen (PCNA) SeMet derivative' _citation.year ? _citation.database_id_CSD ? _citation.pdbx_database_id_DOI ? _citation.pdbx_database_id_PubMed ? _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Watanabe, Y.' 1 ? primary 'Oyama, T.' 2 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5AUJ _cell.details ? _cell.formula_units_Z ? _cell.length_a 88.545 _cell.length_a_esd ? _cell.length_b 88.545 _cell.length_b_esd ? _cell.length_c 62.726 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5AUJ _symmetry.cell_setting ? _symmetry.Int_Tables_number 173 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 63' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'DNA polymerase sliding clamp' 28440.270 1 ? M73L ? ? 2 water nat water 18.015 21 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Proliferating cell nuclear antigen homolog, PCNA' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)PFEIVFEGAKEFAQLIDTASKLIDEAAFKVTEDGIS(MSE)RA(MSE)DPSRVVLIDLNLPSSIFSKYEVVEPET IGVNLDHLKKILKRGKAKDTLILKKGEENFLEITIQGTATRTFRVPLIDVEE(MSE)EVDLPELPFTAKVVVLGEVLKDA VKDASLVSDSIKFIARENEFI(MSE)KAEGETQEVEIKLTLEDEGLLDIEVQEETKSAYGVSYLSD(MSE)VKGLGKADE VTIKFGNE(MSE)P(MSE)Q(MSE)EYYIRDEGRLTFLLAPRVEE ; _entity_poly.pdbx_seq_one_letter_code_can ;MPFEIVFEGAKEFAQLIDTASKLIDEAAFKVTEDGISMRAMDPSRVVLIDLNLPSSIFSKYEVVEPETIGVNLDHLKKIL KRGKAKDTLILKKGEENFLEITIQGTATRTFRVPLIDVEEMEVDLPELPFTAKVVVLGEVLKDAVKDASLVSDSIKFIAR ENEFIMKAEGETQEVEIKLTLEDEGLLDIEVQEETKSAYGVSYLSDMVKGLGKADEVTIKFGNEMPMQMEYYIRDEGRLT FLLAPRVEE ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 PRO n 1 3 PHE n 1 4 GLU n 1 5 ILE n 1 6 VAL n 1 7 PHE n 1 8 GLU n 1 9 GLY n 1 10 ALA n 1 11 LYS n 1 12 GLU n 1 13 PHE n 1 14 ALA n 1 15 GLN n 1 16 LEU n 1 17 ILE n 1 18 ASP n 1 19 THR n 1 20 ALA n 1 21 SER n 1 22 LYS n 1 23 LEU n 1 24 ILE n 1 25 ASP n 1 26 GLU n 1 27 ALA n 1 28 ALA n 1 29 PHE n 1 30 LYS n 1 31 VAL n 1 32 THR n 1 33 GLU n 1 34 ASP n 1 35 GLY n 1 36 ILE n 1 37 SER n 1 38 MSE n 1 39 ARG n 1 40 ALA n 1 41 MSE n 1 42 ASP n 1 43 PRO n 1 44 SER n 1 45 ARG n 1 46 VAL n 1 47 VAL n 1 48 LEU n 1 49 ILE n 1 50 ASP n 1 51 LEU n 1 52 ASN n 1 53 LEU n 1 54 PRO n 1 55 SER n 1 56 SER n 1 57 ILE n 1 58 PHE n 1 59 SER n 1 60 LYS n 1 61 TYR n 1 62 GLU n 1 63 VAL n 1 64 VAL n 1 65 GLU n 1 66 PRO n 1 67 GLU n 1 68 THR n 1 69 ILE n 1 70 GLY n 1 71 VAL n 1 72 ASN n 1 73 LEU n 1 74 ASP n 1 75 HIS n 1 76 LEU n 1 77 LYS n 1 78 LYS n 1 79 ILE n 1 80 LEU n 1 81 LYS n 1 82 ARG n 1 83 GLY n 1 84 LYS n 1 85 ALA n 1 86 LYS n 1 87 ASP n 1 88 THR n 1 89 LEU n 1 90 ILE n 1 91 LEU n 1 92 LYS n 1 93 LYS n 1 94 GLY n 1 95 GLU n 1 96 GLU n 1 97 ASN n 1 98 PHE n 1 99 LEU n 1 100 GLU n 1 101 ILE n 1 102 THR n 1 103 ILE n 1 104 GLN n 1 105 GLY n 1 106 THR n 1 107 ALA n 1 108 THR n 1 109 ARG n 1 110 THR n 1 111 PHE n 1 112 ARG n 1 113 VAL n 1 114 PRO n 1 115 LEU n 1 116 ILE n 1 117 ASP n 1 118 VAL n 1 119 GLU n 1 120 GLU n 1 121 MSE n 1 122 GLU n 1 123 VAL n 1 124 ASP n 1 125 LEU n 1 126 PRO n 1 127 GLU n 1 128 LEU n 1 129 PRO n 1 130 PHE n 1 131 THR n 1 132 ALA n 1 133 LYS n 1 134 VAL n 1 135 VAL n 1 136 VAL n 1 137 LEU n 1 138 GLY n 1 139 GLU n 1 140 VAL n 1 141 LEU n 1 142 LYS n 1 143 ASP n 1 144 ALA n 1 145 VAL n 1 146 LYS n 1 147 ASP n 1 148 ALA n 1 149 SER n 1 150 LEU n 1 151 VAL n 1 152 SER n 1 153 ASP n 1 154 SER n 1 155 ILE n 1 156 LYS n 1 157 PHE n 1 158 ILE n 1 159 ALA n 1 160 ARG n 1 161 GLU n 1 162 ASN n 1 163 GLU n 1 164 PHE n 1 165 ILE n 1 166 MSE n 1 167 LYS n 1 168 ALA n 1 169 GLU n 1 170 GLY n 1 171 GLU n 1 172 THR n 1 173 GLN n 1 174 GLU n 1 175 VAL n 1 176 GLU n 1 177 ILE n 1 178 LYS n 1 179 LEU n 1 180 THR n 1 181 LEU n 1 182 GLU n 1 183 ASP n 1 184 GLU n 1 185 GLY n 1 186 LEU n 1 187 LEU n 1 188 ASP n 1 189 ILE n 1 190 GLU n 1 191 VAL n 1 192 GLN n 1 193 GLU n 1 194 GLU n 1 195 THR n 1 196 LYS n 1 197 SER n 1 198 ALA n 1 199 TYR n 1 200 GLY n 1 201 VAL n 1 202 SER n 1 203 TYR n 1 204 LEU n 1 205 SER n 1 206 ASP n 1 207 MSE n 1 208 VAL n 1 209 LYS n 1 210 GLY n 1 211 LEU n 1 212 GLY n 1 213 LYS n 1 214 ALA n 1 215 ASP n 1 216 GLU n 1 217 VAL n 1 218 THR n 1 219 ILE n 1 220 LYS n 1 221 PHE n 1 222 GLY n 1 223 ASN n 1 224 GLU n 1 225 MSE n 1 226 PRO n 1 227 MSE n 1 228 GLN n 1 229 MSE n 1 230 GLU n 1 231 TYR n 1 232 TYR n 1 233 ILE n 1 234 ARG n 1 235 ASP n 1 236 GLU n 1 237 GLY n 1 238 ARG n 1 239 LEU n 1 240 THR n 1 241 PHE n 1 242 LEU n 1 243 LEU n 1 244 ALA n 1 245 PRO n 1 246 ARG n 1 247 VAL n 1 248 GLU n 1 249 GLU n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 249 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'pcn, PF0983' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'DSM 3638' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Pyrococcus furiosus DSM 3638' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 186497 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code PCNA_PYRFU _struct_ref.pdbx_db_accession O73947 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MPFEIVFEGAKEFAQLIDTASKLIDEAAFKVTEDGISMRAMDPSRVVLIDLNLPSSIFSKYEVVEPETIGVNMDHLKKIL KRGKAKDTLILKKGEENFLEITIQGTATRTFRVPLIDVEEMEVDLPELPFTAKVVVLGEVLKDAVKDASLVSDSIKFIAR ENEFIMKAEGETQEVEIKLTLEDEGLLDIEVQEETKSAYGVSYLSDMVKGLGKADEVTIKFGNEMPMQMEYYIRDEGRLT FLLAPRVEE ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5AUJ _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 249 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession O73947 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 249 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 249 # _struct_ref_seq_dif.align_id 1 _struct_ref_seq_dif.pdbx_pdb_id_code 5AUJ _struct_ref_seq_dif.mon_id LEU _struct_ref_seq_dif.pdbx_pdb_strand_id A _struct_ref_seq_dif.seq_num 73 _struct_ref_seq_dif.pdbx_pdb_ins_code ? _struct_ref_seq_dif.pdbx_seq_db_name UNP _struct_ref_seq_dif.pdbx_seq_db_accession_code O73947 _struct_ref_seq_dif.db_mon_id MET _struct_ref_seq_dif.pdbx_seq_db_seq_num 73 _struct_ref_seq_dif.details 'engineered mutation' _struct_ref_seq_dif.pdbx_auth_seq_num 73 _struct_ref_seq_dif.pdbx_ordinal 1 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5AUJ _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.72 _exptl_crystal.description 'THE STRUCTURE FACTOR FILE CONTAINS FRIEDEL PAIRS' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'ammonium sulfate, 1,4-dioxane, sodium citrate, pH 5.5' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-12-13 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9795 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE AR-NW12A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9795 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline AR-NW12A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5AUJ _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.50 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 19578 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 100.0 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 20.0 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 18.1 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'THE STRUCTURE FACTOR FILE CONTAINS FRIEDEL PAIRS IN I_PLUS/MINUS AND F_PLUS/MINUS COLUMNS' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5AUJ _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.50 _refine.ls_d_res_low 36.170 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 19090 _refine.ls_number_reflns_R_free 922 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.97 _refine.ls_percent_reflns_R_free 4.83 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2203 _refine.ls_R_factor_R_free 0.2734 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2177 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.34 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details Random _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 28.65 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.25 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1850 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 21 _refine_hist.number_atoms_total 1871 _refine_hist.d_res_high 2.50 _refine_hist.d_res_low 36.170 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1874 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.476 ? 2526 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 11.684 ? 707 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.020 ? 304 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 319 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.4983 2.6300 . . 120 2620 100.00 . . . 0.2681 . 0.2663 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.6300 2.7947 . . 149 2570 100.00 . . . 0.3756 . 0.2635 . . . . . . . . . . 'X-RAY DIFFRACTION' 2.7947 3.0104 . . 127 2630 100.00 . . . 0.2886 . 0.2661 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.0104 3.3132 . . 138 2555 100.00 . . . 0.2974 . 0.2448 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3132 3.7922 . . 123 2604 100.00 . . . 0.2637 . 0.2027 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7922 4.7760 . . 133 2591 100.00 . . . 0.2145 . 0.1753 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.7760 10 . . 132 2598 100.00 . . . 0.2839 . 0.2090 . . . . . . . . . . # _struct.entry_id 5AUJ _struct.title 'Pyrococcus furiosus proliferating cell nuclear antigen (PCNA) SeMet derivative' _struct.pdbx_descriptor 'DNA polymerase sliding clamp' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5AUJ _struct_keywords.text 'Replication, Processivity, Sliding clamp, DNA BINDING PROTEIN' _struct_keywords.pdbx_keywords 'DNA BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 GLY A 9 ? LYS A 22 ? GLY A 9 LYS A 22 1 ? 14 HELX_P HELX_P2 AA2 SER A 56 ? PHE A 58 ? SER A 56 PHE A 58 5 ? 3 HELX_P HELX_P3 AA3 LEU A 73 ? LYS A 81 ? LEU A 73 LYS A 81 1 ? 9 HELX_P HELX_P4 AA4 GLY A 138 ? SER A 152 ? GLY A 138 SER A 152 1 ? 15 HELX_P HELX_P5 AA5 VAL A 201 ? VAL A 208 ? VAL A 201 VAL A 208 1 ? 8 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A SER 37 C ? ? ? 1_555 A MSE 38 N ? ? A SER 37 A MSE 38 1_555 ? ? ? ? ? ? ? 1.328 ? covale2 covale both ? A MSE 38 C ? ? ? 1_555 A ARG 39 N ? ? A MSE 38 A ARG 39 1_555 ? ? ? ? ? ? ? 1.330 ? covale3 covale both ? A ALA 40 C ? ? ? 1_555 A MSE 41 N ? ? A ALA 40 A MSE 41 1_555 ? ? ? ? ? ? ? 1.328 ? covale4 covale both ? A MSE 41 C ? ? ? 1_555 A ASP 42 N ? ? A MSE 41 A ASP 42 1_555 ? ? ? ? ? ? ? 1.329 ? covale5 covale both ? A ILE 165 C ? ? ? 1_555 A MSE 166 N ? ? A ILE 165 A MSE 166 1_555 ? ? ? ? ? ? ? 1.329 ? covale6 covale both ? A MSE 166 C ? ? ? 1_555 A LYS 167 N ? ? A MSE 166 A LYS 167 1_555 ? ? ? ? ? ? ? 1.328 ? covale7 covale both ? A ASP 206 C ? ? ? 1_555 A MSE 207 N ? ? A ASP 206 A MSE 207 1_555 ? ? ? ? ? ? ? 1.329 ? covale8 covale both ? A MSE 207 C ? ? ? 1_555 A VAL 208 N ? ? A MSE 207 A VAL 208 1_555 ? ? ? ? ? ? ? 1.328 ? covale9 covale both ? A GLU 224 C ? ? ? 1_555 A MSE 225 N ? ? A GLU 224 A MSE 225 1_555 ? ? ? ? ? ? ? 1.328 ? covale10 covale both ? A MSE 225 C ? ? ? 1_555 A PRO 226 N ? ? A MSE 225 A PRO 226 1_555 ? ? ? ? ? ? ? 1.342 ? covale11 covale both ? A PRO 226 C ? ? ? 1_555 A MSE 227 N ? ? A PRO 226 A MSE 227 1_555 ? ? ? ? ? ? ? 1.329 ? covale12 covale both ? A MSE 227 C ? ? ? 1_555 A GLN 228 N ? ? A MSE 227 A GLN 228 1_555 ? ? ? ? ? ? ? 1.328 ? covale13 covale both ? A GLN 228 C ? ? ? 1_555 A MSE 229 N ? ? A GLN 228 A MSE 229 1_555 ? ? ? ? ? ? ? 1.327 ? covale14 covale both ? A MSE 229 C ? ? ? 1_555 A GLU 230 N ? ? A MSE 229 A GLU 230 1_555 ? ? ? ? ? ? ? 1.328 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 5 ? AA2 ? 9 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? anti-parallel AA1 4 5 ? anti-parallel AA2 1 2 ? anti-parallel AA2 2 3 ? anti-parallel AA2 3 4 ? anti-parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel AA2 6 7 ? anti-parallel AA2 7 8 ? anti-parallel AA2 8 9 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LYS A 60 ? VAL A 63 ? LYS A 60 VAL A 63 AA1 2 PHE A 3 ? GLU A 8 ? PHE A 3 GLU A 8 AA1 3 THR A 88 ? LYS A 93 ? THR A 88 LYS A 93 AA1 4 PHE A 98 ? GLN A 104 ? PHE A 98 GLN A 104 AA1 5 THR A 108 ? PRO A 114 ? THR A 108 PRO A 114 AA2 1 GLU A 67 ? ASN A 72 ? GLU A 67 ASN A 72 AA2 2 GLU A 26 ? VAL A 31 ? GLU A 26 VAL A 31 AA2 3 GLY A 35 ? MSE A 41 ? GLY A 35 MSE A 41 AA2 4 VAL A 47 ? PRO A 54 ? VAL A 47 PRO A 54 AA2 5 GLY A 237 ? LEU A 243 ? GLY A 237 LEU A 243 AA2 6 MSE A 227 ? ILE A 233 ? MSE A 227 ILE A 233 AA2 7 GLU A 216 ? PHE A 221 ? GLU A 216 PHE A 221 AA2 8 ALA A 132 ? LEU A 137 ? ALA A 132 LEU A 137 AA2 9 LEU A 186 ? VAL A 191 ? LEU A 186 VAL A 191 AA3 1 GLU A 174 ? LEU A 179 ? GLU A 174 LEU A 179 AA3 2 PHE A 164 ? GLU A 169 ? PHE A 164 GLU A 169 AA3 3 SER A 154 ? ALA A 159 ? SER A 154 ALA A 159 AA3 4 THR A 195 ? GLY A 200 ? THR A 195 GLY A 200 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 O GLU A 62 ? O GLU A 62 N GLU A 4 ? N GLU A 4 AA1 2 3 N ILE A 5 ? N ILE A 5 O LEU A 91 ? O LEU A 91 AA1 3 4 N THR A 88 ? N THR A 88 O GLN A 104 ? O GLN A 104 AA1 4 5 N LEU A 99 ? N LEU A 99 O VAL A 113 ? O VAL A 113 AA2 1 2 O ILE A 69 ? O ILE A 69 N PHE A 29 ? N PHE A 29 AA2 2 3 N LYS A 30 ? N LYS A 30 O SER A 37 ? O SER A 37 AA2 3 4 N ILE A 36 ? N ILE A 36 O LEU A 53 ? O LEU A 53 AA2 4 5 N ASN A 52 ? N ASN A 52 O ARG A 238 ? O ARG A 238 AA2 5 6 O GLY A 237 ? O GLY A 237 N ILE A 233 ? N ILE A 233 AA2 6 7 O GLN A 228 ? O GLN A 228 N LYS A 220 ? N LYS A 220 AA2 7 8 O ILE A 219 ? O ILE A 219 N VAL A 134 ? N VAL A 134 AA2 8 9 N LYS A 133 ? N LYS A 133 O GLU A 190 ? O GLU A 190 AA3 1 2 O LEU A 179 ? O LEU A 179 N PHE A 164 ? N PHE A 164 AA3 2 3 O ILE A 165 ? O ILE A 165 N ILE A 158 ? N ILE A 158 AA3 3 4 N PHE A 157 ? N PHE A 157 O SER A 197 ? O SER A 197 # _atom_sites.entry_id 5AUJ _atom_sites.fract_transf_matrix[1][1] 0.011294 _atom_sites.fract_transf_matrix[1][2] 0.006520 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013041 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.015942 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 ? ? ? A . n A 1 2 PRO 2 2 2 PRO PRO A . n A 1 3 PHE 3 3 3 PHE PHE A . n A 1 4 GLU 4 4 4 GLU GLU A . n A 1 5 ILE 5 5 5 ILE ILE A . n A 1 6 VAL 6 6 6 VAL VAL A . n A 1 7 PHE 7 7 7 PHE PHE A . n A 1 8 GLU 8 8 8 GLU GLU A . n A 1 9 GLY 9 9 9 GLY GLY A . n A 1 10 ALA 10 10 10 ALA ALA A . n A 1 11 LYS 11 11 11 LYS LYS A . n A 1 12 GLU 12 12 12 GLU GLU A . n A 1 13 PHE 13 13 13 PHE PHE A . n A 1 14 ALA 14 14 14 ALA ALA A . n A 1 15 GLN 15 15 15 GLN GLN A . n A 1 16 LEU 16 16 16 LEU LEU A . n A 1 17 ILE 17 17 17 ILE ILE A . n A 1 18 ASP 18 18 18 ASP ASP A . n A 1 19 THR 19 19 19 THR THR A . n A 1 20 ALA 20 20 20 ALA ALA A . n A 1 21 SER 21 21 21 SER SER A . n A 1 22 LYS 22 22 22 LYS LYS A . n A 1 23 LEU 23 23 23 LEU LEU A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ASP 25 25 25 ASP ASP A . n A 1 26 GLU 26 26 26 GLU GLU A . n A 1 27 ALA 27 27 27 ALA ALA A . n A 1 28 ALA 28 28 28 ALA ALA A . n A 1 29 PHE 29 29 29 PHE PHE A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 VAL 31 31 31 VAL VAL A . n A 1 32 THR 32 32 32 THR THR A . n A 1 33 GLU 33 33 33 GLU GLU A . n A 1 34 ASP 34 34 34 ASP ASP A . n A 1 35 GLY 35 35 35 GLY GLY A . n A 1 36 ILE 36 36 36 ILE ILE A . n A 1 37 SER 37 37 37 SER SER A . n A 1 38 MSE 38 38 38 MSE MSE A . n A 1 39 ARG 39 39 39 ARG ARG A . n A 1 40 ALA 40 40 40 ALA ALA A . n A 1 41 MSE 41 41 41 MSE MSE A . n A 1 42 ASP 42 42 42 ASP ASP A . n A 1 43 PRO 43 43 43 PRO PRO A . n A 1 44 SER 44 44 44 SER SER A . n A 1 45 ARG 45 45 45 ARG ARG A . n A 1 46 VAL 46 46 46 VAL VAL A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 LEU 48 48 48 LEU LEU A . n A 1 49 ILE 49 49 49 ILE ILE A . n A 1 50 ASP 50 50 50 ASP ASP A . n A 1 51 LEU 51 51 51 LEU LEU A . n A 1 52 ASN 52 52 52 ASN ASN A . n A 1 53 LEU 53 53 53 LEU LEU A . n A 1 54 PRO 54 54 54 PRO PRO A . n A 1 55 SER 55 55 55 SER SER A . n A 1 56 SER 56 56 56 SER SER A . n A 1 57 ILE 57 57 57 ILE ILE A . n A 1 58 PHE 58 58 58 PHE PHE A . n A 1 59 SER 59 59 59 SER SER A . n A 1 60 LYS 60 60 60 LYS LYS A . n A 1 61 TYR 61 61 61 TYR TYR A . n A 1 62 GLU 62 62 62 GLU GLU A . n A 1 63 VAL 63 63 63 VAL VAL A . n A 1 64 VAL 64 64 64 VAL VAL A . n A 1 65 GLU 65 65 65 GLU GLU A . n A 1 66 PRO 66 66 66 PRO PRO A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 THR 68 68 68 THR THR A . n A 1 69 ILE 69 69 69 ILE ILE A . n A 1 70 GLY 70 70 70 GLY GLY A . n A 1 71 VAL 71 71 71 VAL VAL A . n A 1 72 ASN 72 72 72 ASN ASN A . n A 1 73 LEU 73 73 73 LEU LEU A . n A 1 74 ASP 74 74 74 ASP ASP A . n A 1 75 HIS 75 75 75 HIS HIS A . n A 1 76 LEU 76 76 76 LEU LEU A . n A 1 77 LYS 77 77 77 LYS LYS A . n A 1 78 LYS 78 78 78 LYS LYS A . n A 1 79 ILE 79 79 79 ILE ILE A . n A 1 80 LEU 80 80 80 LEU LEU A . n A 1 81 LYS 81 81 81 LYS LYS A . n A 1 82 ARG 82 82 82 ARG ARG A . n A 1 83 GLY 83 83 83 GLY GLY A . n A 1 84 LYS 84 84 84 LYS LYS A . n A 1 85 ALA 85 85 85 ALA ALA A . n A 1 86 LYS 86 86 86 LYS LYS A . n A 1 87 ASP 87 87 87 ASP ASP A . n A 1 88 THR 88 88 88 THR THR A . n A 1 89 LEU 89 89 89 LEU LEU A . n A 1 90 ILE 90 90 90 ILE ILE A . n A 1 91 LEU 91 91 91 LEU LEU A . n A 1 92 LYS 92 92 92 LYS LYS A . n A 1 93 LYS 93 93 93 LYS LYS A . n A 1 94 GLY 94 94 94 GLY GLY A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 GLU 96 96 96 GLU GLU A . n A 1 97 ASN 97 97 97 ASN ASN A . n A 1 98 PHE 98 98 98 PHE PHE A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 GLU 100 100 100 GLU GLU A . n A 1 101 ILE 101 101 101 ILE ILE A . n A 1 102 THR 102 102 102 THR THR A . n A 1 103 ILE 103 103 103 ILE ILE A . n A 1 104 GLN 104 104 104 GLN GLN A . n A 1 105 GLY 105 105 105 GLY GLY A . n A 1 106 THR 106 106 106 THR THR A . n A 1 107 ALA 107 107 107 ALA ALA A . n A 1 108 THR 108 108 108 THR THR A . n A 1 109 ARG 109 109 109 ARG ARG A . n A 1 110 THR 110 110 110 THR THR A . n A 1 111 PHE 111 111 111 PHE PHE A . n A 1 112 ARG 112 112 112 ARG ARG A . n A 1 113 VAL 113 113 113 VAL VAL A . n A 1 114 PRO 114 114 114 PRO PRO A . n A 1 115 LEU 115 115 115 LEU LEU A . n A 1 116 ILE 116 116 116 ILE ILE A . n A 1 117 ASP 117 117 117 ASP ASP A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 GLU 119 119 119 GLU GLU A . n A 1 120 GLU 120 120 120 GLU GLU A . n A 1 121 MSE 121 121 ? ? ? A . n A 1 122 GLU 122 122 ? ? ? A . n A 1 123 VAL 123 123 ? ? ? A . n A 1 124 ASP 124 124 ? ? ? A . n A 1 125 LEU 125 125 ? ? ? A . n A 1 126 PRO 126 126 ? ? ? A . n A 1 127 GLU 127 127 ? ? ? A . n A 1 128 LEU 128 128 128 LEU LEU A . n A 1 129 PRO 129 129 129 PRO PRO A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 THR 131 131 131 THR THR A . n A 1 132 ALA 132 132 132 ALA ALA A . n A 1 133 LYS 133 133 133 LYS LYS A . n A 1 134 VAL 134 134 134 VAL VAL A . n A 1 135 VAL 135 135 135 VAL VAL A . n A 1 136 VAL 136 136 136 VAL VAL A . n A 1 137 LEU 137 137 137 LEU LEU A . n A 1 138 GLY 138 138 138 GLY GLY A . n A 1 139 GLU 139 139 139 GLU GLU A . n A 1 140 VAL 140 140 140 VAL VAL A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 LYS 142 142 142 LYS LYS A . n A 1 143 ASP 143 143 143 ASP ASP A . n A 1 144 ALA 144 144 144 ALA ALA A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 LYS 146 146 146 LYS LYS A . n A 1 147 ASP 147 147 147 ASP ASP A . n A 1 148 ALA 148 148 148 ALA ALA A . n A 1 149 SER 149 149 149 SER SER A . n A 1 150 LEU 150 150 150 LEU LEU A . n A 1 151 VAL 151 151 151 VAL VAL A . n A 1 152 SER 152 152 152 SER SER A . n A 1 153 ASP 153 153 153 ASP ASP A . n A 1 154 SER 154 154 154 SER SER A . n A 1 155 ILE 155 155 155 ILE ILE A . n A 1 156 LYS 156 156 156 LYS LYS A . n A 1 157 PHE 157 157 157 PHE PHE A . n A 1 158 ILE 158 158 158 ILE ILE A . n A 1 159 ALA 159 159 159 ALA ALA A . n A 1 160 ARG 160 160 160 ARG ARG A . n A 1 161 GLU 161 161 161 GLU GLU A . n A 1 162 ASN 162 162 162 ASN ASN A . n A 1 163 GLU 163 163 163 GLU GLU A . n A 1 164 PHE 164 164 164 PHE PHE A . n A 1 165 ILE 165 165 165 ILE ILE A . n A 1 166 MSE 166 166 166 MSE MSE A . n A 1 167 LYS 167 167 167 LYS LYS A . n A 1 168 ALA 168 168 168 ALA ALA A . n A 1 169 GLU 169 169 169 GLU GLU A . n A 1 170 GLY 170 170 170 GLY GLY A . n A 1 171 GLU 171 171 171 GLU GLU A . n A 1 172 THR 172 172 172 THR THR A . n A 1 173 GLN 173 173 173 GLN GLN A . n A 1 174 GLU 174 174 174 GLU GLU A . n A 1 175 VAL 175 175 175 VAL VAL A . n A 1 176 GLU 176 176 176 GLU GLU A . n A 1 177 ILE 177 177 177 ILE ILE A . n A 1 178 LYS 178 178 178 LYS LYS A . n A 1 179 LEU 179 179 179 LEU LEU A . n A 1 180 THR 180 180 180 THR THR A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 GLU 182 182 182 GLU GLU A . n A 1 183 ASP 183 183 183 ASP ASP A . n A 1 184 GLU 184 184 184 GLU GLU A . n A 1 185 GLY 185 185 185 GLY GLY A . n A 1 186 LEU 186 186 186 LEU LEU A . n A 1 187 LEU 187 187 187 LEU LEU A . n A 1 188 ASP 188 188 188 ASP ASP A . n A 1 189 ILE 189 189 189 ILE ILE A . n A 1 190 GLU 190 190 190 GLU GLU A . n A 1 191 VAL 191 191 191 VAL VAL A . n A 1 192 GLN 192 192 192 GLN GLN A . n A 1 193 GLU 193 193 193 GLU GLU A . n A 1 194 GLU 194 194 194 GLU GLU A . n A 1 195 THR 195 195 195 THR THR A . n A 1 196 LYS 196 196 196 LYS LYS A . n A 1 197 SER 197 197 197 SER SER A . n A 1 198 ALA 198 198 198 ALA ALA A . n A 1 199 TYR 199 199 199 TYR TYR A . n A 1 200 GLY 200 200 200 GLY GLY A . n A 1 201 VAL 201 201 201 VAL VAL A . n A 1 202 SER 202 202 202 SER SER A . n A 1 203 TYR 203 203 203 TYR TYR A . n A 1 204 LEU 204 204 204 LEU LEU A . n A 1 205 SER 205 205 205 SER SER A . n A 1 206 ASP 206 206 206 ASP ASP A . n A 1 207 MSE 207 207 207 MSE MSE A . n A 1 208 VAL 208 208 208 VAL VAL A . n A 1 209 LYS 209 209 209 LYS LYS A . n A 1 210 GLY 210 210 210 GLY GLY A . n A 1 211 LEU 211 211 211 LEU LEU A . n A 1 212 GLY 212 212 212 GLY GLY A . n A 1 213 LYS 213 213 213 LYS LYS A . n A 1 214 ALA 214 214 214 ALA ALA A . n A 1 215 ASP 215 215 215 ASP ASP A . n A 1 216 GLU 216 216 216 GLU GLU A . n A 1 217 VAL 217 217 217 VAL VAL A . n A 1 218 THR 218 218 218 THR THR A . n A 1 219 ILE 219 219 219 ILE ILE A . n A 1 220 LYS 220 220 220 LYS LYS A . n A 1 221 PHE 221 221 221 PHE PHE A . n A 1 222 GLY 222 222 222 GLY GLY A . n A 1 223 ASN 223 223 223 ASN ASN A . n A 1 224 GLU 224 224 224 GLU GLU A . n A 1 225 MSE 225 225 225 MSE MSE A . n A 1 226 PRO 226 226 226 PRO PRO A . n A 1 227 MSE 227 227 227 MSE MSE A . n A 1 228 GLN 228 228 228 GLN GLN A . n A 1 229 MSE 229 229 229 MSE MSE A . n A 1 230 GLU 230 230 230 GLU GLU A . n A 1 231 TYR 231 231 231 TYR TYR A . n A 1 232 TYR 232 232 232 TYR TYR A . n A 1 233 ILE 233 233 233 ILE ILE A . n A 1 234 ARG 234 234 234 ARG ARG A . n A 1 235 ASP 235 235 235 ASP ASP A . n A 1 236 GLU 236 236 236 GLU GLU A . n A 1 237 GLY 237 237 237 GLY GLY A . n A 1 238 ARG 238 238 238 ARG ARG A . n A 1 239 LEU 239 239 239 LEU LEU A . n A 1 240 THR 240 240 240 THR THR A . n A 1 241 PHE 241 241 241 PHE PHE A . n A 1 242 LEU 242 242 242 LEU LEU A . n A 1 243 LEU 243 243 243 LEU LEU A . n A 1 244 ALA 244 244 244 ALA ALA A . n A 1 245 PRO 245 245 245 PRO PRO A . n A 1 246 ARG 246 246 246 ARG ARG A . n A 1 247 VAL 247 247 247 VAL VAL A . n A 1 248 GLU 248 248 ? ? ? A . n A 1 249 GLU 249 249 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 12 HOH HOH A . B 2 HOH 2 302 16 HOH HOH A . B 2 HOH 3 303 6 HOH HOH A . B 2 HOH 4 304 8 HOH HOH A . B 2 HOH 5 305 10 HOH HOH A . B 2 HOH 6 306 11 HOH HOH A . B 2 HOH 7 307 7 HOH HOH A . B 2 HOH 8 308 2 HOH HOH A . B 2 HOH 9 309 1 HOH HOH A . B 2 HOH 10 310 21 HOH HOH A . B 2 HOH 11 311 14 HOH HOH A . B 2 HOH 12 312 4 HOH HOH A . B 2 HOH 13 313 15 HOH HOH A . B 2 HOH 14 314 9 HOH HOH A . B 2 HOH 15 315 17 HOH HOH A . B 2 HOH 16 316 20 HOH HOH A . B 2 HOH 17 317 19 HOH HOH A . B 2 HOH 18 318 3 HOH HOH A . B 2 HOH 19 319 13 HOH HOH A . B 2 HOH 20 320 18 HOH HOH A . B 2 HOH 21 321 5 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 38 A MSE 38 ? MET 'modified residue' 2 A MSE 41 A MSE 41 ? MET 'modified residue' 3 A MSE 166 A MSE 166 ? MET 'modified residue' 4 A MSE 207 A MSE 207 ? MET 'modified residue' 5 A MSE 225 A MSE 225 ? MET 'modified residue' 6 A MSE 227 A MSE 227 ? MET 'modified residue' 7 A MSE 229 A MSE 229 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details trimeric _pdbx_struct_assembly.oligomeric_count 3 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 4180 ? 1 MORE -13 ? 1 'SSA (A^2)' 31170 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 2_655 -y+1,x-y,z -0.5000000000 -0.8660254038 0.0000000000 88.5450000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 3_665 -x+y+1,-x+1,z -0.5000000000 0.8660254038 0.0000000000 44.2725000000 -0.8660254038 -0.5000000000 0.0000000000 76.6822193781 0.0000000000 0.0000000000 1.0000000000 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-04-27 2 'Structure model' 1 1 2020-02-19 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Data collection' 2 2 'Structure model' 'Database references' 3 2 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_source 2 2 'Structure model' pdbx_struct_oper_list 3 2 'Structure model' struct_ref_seq_dif # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 2 'Structure model' '_struct_ref_seq_dif.details' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 95 ? ? -82.08 36.98 2 1 GLU A 96 ? ? 60.23 -57.48 3 1 ARG A 160 ? ? -107.17 -168.41 4 1 LEU A 181 ? ? 63.46 -38.24 5 1 ASP A 235 ? ? 65.91 -10.58 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A LYS 86 ? CG ? A LYS 86 CG 2 1 Y 1 A LYS 86 ? CD ? A LYS 86 CD 3 1 Y 1 A LYS 86 ? CE ? A LYS 86 CE 4 1 Y 1 A LYS 86 ? NZ ? A LYS 86 NZ 5 1 Y 1 A GLU 95 ? CG ? A GLU 95 CG 6 1 Y 1 A GLU 95 ? CD ? A GLU 95 CD 7 1 Y 1 A GLU 95 ? OE1 ? A GLU 95 OE1 8 1 Y 1 A GLU 95 ? OE2 ? A GLU 95 OE2 9 1 Y 1 A GLU 119 ? CG ? A GLU 119 CG 10 1 Y 1 A GLU 119 ? CD ? A GLU 119 CD 11 1 Y 1 A GLU 119 ? OE1 ? A GLU 119 OE1 12 1 Y 1 A GLU 119 ? OE2 ? A GLU 119 OE2 13 1 Y 1 A GLU 120 ? CG ? A GLU 120 CG 14 1 Y 1 A GLU 120 ? CD ? A GLU 120 CD 15 1 Y 1 A GLU 120 ? OE1 ? A GLU 120 OE1 16 1 Y 1 A GLU 120 ? OE2 ? A GLU 120 OE2 17 1 Y 1 A GLU 161 ? CG ? A GLU 161 CG 18 1 Y 1 A GLU 161 ? CD ? A GLU 161 CD 19 1 Y 1 A GLU 161 ? OE1 ? A GLU 161 OE1 20 1 Y 1 A GLU 161 ? OE2 ? A GLU 161 OE2 21 1 Y 1 A ASN 162 ? CG ? A ASN 162 CG 22 1 Y 1 A ASN 162 ? OD1 ? A ASN 162 OD1 23 1 Y 1 A ASN 162 ? ND2 ? A ASN 162 ND2 24 1 Y 1 A GLU 182 ? CG ? A GLU 182 CG 25 1 Y 1 A GLU 182 ? CD ? A GLU 182 CD 26 1 Y 1 A GLU 182 ? OE1 ? A GLU 182 OE1 27 1 Y 1 A GLU 182 ? OE2 ? A GLU 182 OE2 28 1 Y 1 A GLU 224 ? CG ? A GLU 224 CG 29 1 Y 1 A GLU 224 ? CD ? A GLU 224 CD 30 1 Y 1 A GLU 224 ? OE1 ? A GLU 224 OE1 31 1 Y 1 A GLU 224 ? OE2 ? A GLU 224 OE2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MSE 1 ? A MSE 1 2 1 Y 1 A MSE 121 ? A MSE 121 3 1 Y 1 A GLU 122 ? A GLU 122 4 1 Y 1 A VAL 123 ? A VAL 123 5 1 Y 1 A ASP 124 ? A ASP 124 6 1 Y 1 A LEU 125 ? A LEU 125 7 1 Y 1 A PRO 126 ? A PRO 126 8 1 Y 1 A GLU 127 ? A GLU 127 9 1 Y 1 A GLU 248 ? A GLU 248 10 1 Y 1 A GLU 249 ? A GLU 249 # _pdbx_audit_support.funding_organization 'Ministry of Education, Culture, Sports, Science and Technology' _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 26440023 _pdbx_audit_support.ordinal 1 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #