data_5AWE # _entry.id 5AWE # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5AWE WWPDB D_1300000059 # _pdbx_database_related.db_name PDB _pdbx_database_related.details ;Crystal structure of CBS domain-containing protein in complex with AMP (NP_344512.1) from SULFOLOBUS SOLFATARICUS at 1.80 A resolution ; _pdbx_database_related.db_id 3DDJ _pdbx_database_related.content_type unspecified # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5AWE _pdbx_database_status.recvd_initial_deposition_date 2015-07-03 _pdbx_database_status.SG_entry Y _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Nakabayashi, M.' 1 'Shibata, N.' 2 'Kanagawa, M.' 3 'Nakagawa, N.' 4 'Kuramitsu, S.' 5 'Higuchi, Y.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country DE _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev Extremophiles _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1433-4909 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 20 _citation.language ? _citation.page_first 275 _citation.page_last 282 _citation.title ;Crystal structure of a hypothetical protein, TTHA0829 from Thermus thermophilus HB8, composed of cystathionine-beta-synthase (CBS) and aspartate-kinase chorismate-mutase tyrA (ACT) domains. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1007/s00792-016-0817-y _citation.pdbx_database_id_PubMed 26936147 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nakabayashi, M.' 1 ? primary 'Shibata, N.' 2 ? primary 'Ishido-Nakai, E.' 3 ? primary 'Kanagawa, M.' 4 ? primary 'Iio, Y.' 5 ? primary 'Komori, H.' 6 ? primary 'Ueda, Y.' 7 ? primary 'Nakagawa, N.' 8 ? primary 'Kuramitsu, S.' 9 ? primary 'Higuchi, Y.' 10 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5AWE _cell.details ? _cell.formula_units_Z ? _cell.length_a 90.800 _cell.length_a_esd ? _cell.length_b 90.800 _cell.length_b_esd ? _cell.length_c 89.750 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 12 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5AWE _symmetry.cell_setting ? _symmetry.Int_Tables_number 180 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 62 2 2' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Putative acetoin utilization protein, acetoin dehydrogenase' 23251.953 1 ? ? ? ? 2 water nat water 18.015 53 ? ? ? ? # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer yes _entity_poly.pdbx_seq_one_letter_code ;(MSE)LVRDW(MSE)TKDPVVVAPDTPVLEAIRLLKEKGFRRLPV(MSE)EGGRLVGLVTDKDLKDA(MSE)PSKATTLS VWE(MSE)NYLLAKLTVREV(MSE)ARPVVTVEADAPLEKAALL(MSE)EERKIGGLPV(MSE)EGERLVGIITVTDVLR AFIEVLGLKLGGLRITVDIPDVPGALAQ(MSE)AQAVPPANIVSIATAAHLPGYQRLV(MSE)RVVGEDVEGVPKRLEAA GERVVDVRPG ; _entity_poly.pdbx_seq_one_letter_code_can ;MLVRDWMTKDPVVVAPDTPVLEAIRLLKEKGFRRLPVMEGGRLVGLVTDKDLKDAMPSKATTLSVWEMNYLLAKLTVREV MARPVVTVEADAPLEKAALLMEERKIGGLPVMEGERLVGIITVTDVLRAFIEVLGLKLGGLRITVDIPDVPGALAQMAQA VPPANIVSIATAAHLPGYQRLVMRVVGEDVEGVPKRLEAAGERVVDVRPG ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MSE n 1 2 LEU n 1 3 VAL n 1 4 ARG n 1 5 ASP n 1 6 TRP n 1 7 MSE n 1 8 THR n 1 9 LYS n 1 10 ASP n 1 11 PRO n 1 12 VAL n 1 13 VAL n 1 14 VAL n 1 15 ALA n 1 16 PRO n 1 17 ASP n 1 18 THR n 1 19 PRO n 1 20 VAL n 1 21 LEU n 1 22 GLU n 1 23 ALA n 1 24 ILE n 1 25 ARG n 1 26 LEU n 1 27 LEU n 1 28 LYS n 1 29 GLU n 1 30 LYS n 1 31 GLY n 1 32 PHE n 1 33 ARG n 1 34 ARG n 1 35 LEU n 1 36 PRO n 1 37 VAL n 1 38 MSE n 1 39 GLU n 1 40 GLY n 1 41 GLY n 1 42 ARG n 1 43 LEU n 1 44 VAL n 1 45 GLY n 1 46 LEU n 1 47 VAL n 1 48 THR n 1 49 ASP n 1 50 LYS n 1 51 ASP n 1 52 LEU n 1 53 LYS n 1 54 ASP n 1 55 ALA n 1 56 MSE n 1 57 PRO n 1 58 SER n 1 59 LYS n 1 60 ALA n 1 61 THR n 1 62 THR n 1 63 LEU n 1 64 SER n 1 65 VAL n 1 66 TRP n 1 67 GLU n 1 68 MSE n 1 69 ASN n 1 70 TYR n 1 71 LEU n 1 72 LEU n 1 73 ALA n 1 74 LYS n 1 75 LEU n 1 76 THR n 1 77 VAL n 1 78 ARG n 1 79 GLU n 1 80 VAL n 1 81 MSE n 1 82 ALA n 1 83 ARG n 1 84 PRO n 1 85 VAL n 1 86 VAL n 1 87 THR n 1 88 VAL n 1 89 GLU n 1 90 ALA n 1 91 ASP n 1 92 ALA n 1 93 PRO n 1 94 LEU n 1 95 GLU n 1 96 LYS n 1 97 ALA n 1 98 ALA n 1 99 LEU n 1 100 LEU n 1 101 MSE n 1 102 GLU n 1 103 GLU n 1 104 ARG n 1 105 LYS n 1 106 ILE n 1 107 GLY n 1 108 GLY n 1 109 LEU n 1 110 PRO n 1 111 VAL n 1 112 MSE n 1 113 GLU n 1 114 GLY n 1 115 GLU n 1 116 ARG n 1 117 LEU n 1 118 VAL n 1 119 GLY n 1 120 ILE n 1 121 ILE n 1 122 THR n 1 123 VAL n 1 124 THR n 1 125 ASP n 1 126 VAL n 1 127 LEU n 1 128 ARG n 1 129 ALA n 1 130 PHE n 1 131 ILE n 1 132 GLU n 1 133 VAL n 1 134 LEU n 1 135 GLY n 1 136 LEU n 1 137 LYS n 1 138 LEU n 1 139 GLY n 1 140 GLY n 1 141 LEU n 1 142 ARG n 1 143 ILE n 1 144 THR n 1 145 VAL n 1 146 ASP n 1 147 ILE n 1 148 PRO n 1 149 ASP n 1 150 VAL n 1 151 PRO n 1 152 GLY n 1 153 ALA n 1 154 LEU n 1 155 ALA n 1 156 GLN n 1 157 MSE n 1 158 ALA n 1 159 GLN n 1 160 ALA n 1 161 VAL n 1 162 PRO n 1 163 PRO n 1 164 ALA n 1 165 ASN n 1 166 ILE n 1 167 VAL n 1 168 SER n 1 169 ILE n 1 170 ALA n 1 171 THR n 1 172 ALA n 1 173 ALA n 1 174 HIS n 1 175 LEU n 1 176 PRO n 1 177 GLY n 1 178 TYR n 1 179 GLN n 1 180 ARG n 1 181 LEU n 1 182 VAL n 1 183 MSE n 1 184 ARG n 1 185 VAL n 1 186 VAL n 1 187 GLY n 1 188 GLU n 1 189 ASP n 1 190 VAL n 1 191 GLU n 1 192 GLY n 1 193 VAL n 1 194 PRO n 1 195 LYS n 1 196 ARG n 1 197 LEU n 1 198 GLU n 1 199 ALA n 1 200 ALA n 1 201 GLY n 1 202 GLU n 1 203 ARG n 1 204 VAL n 1 205 VAL n 1 206 ASP n 1 207 VAL n 1 208 ARG n 1 209 PRO n 1 210 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 210 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene TTHA0829 _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain 'HB8 / ATCC 27634 / DSM 579' _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Thermus thermophilus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 300852 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli ' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain 'B834 (DE3)' _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type PLASMID _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET11a _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q5SK23_THET8 _struct_ref.pdbx_db_accession Q5SK23 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;MLVRDWMTKDPVVVAPDTPVLEAIRLLKEKGFRRLPVMEGGRLVGLVTDKDLKDAMPSKATTLSVWEMNYLLAKLTVREV MARPVVTVEADAPLEKAALLMEERKIGGLPVMEGERLVGIITVTDVLRAFIEVLGLKLGGLRITVDIPDVPGALAQMAQA VPPANIVSIATAAHLPGYQRLVMRVVGEDVEGVPKRLEAAGERVVDVRPG ; _struct_ref.pdbx_align_begin 1 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5AWE _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 1 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 210 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q5SK23 _struct_ref_seq.db_align_beg 1 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 210 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 1 _struct_ref_seq.pdbx_auth_seq_align_end 210 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MSE 'L-peptide linking' n SELENOMETHIONINE ? 'C5 H11 N O2 Se' 196.106 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5AWE _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.3 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 46.44 _exptl_crystal.description 'THE FILE CONTAINS FRIEDEL PAIRS.' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 7.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'HEPES, magnesium chloride, PEG 400' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RIGAKU JUPITER 210' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2004-06-25 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.97911 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL26B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.97911 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL26B1 _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate 29.5 _reflns.entry_id 5AWE _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.45 _reflns.d_resolution_low 40.51 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8426 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.6 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 16.4 _reflns.pdbx_Rmerge_I_obs 0.104 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 31.7 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.45 _reflns_shell.d_res_low 2.54 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 4.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 98.2 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.305 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 14.1 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] -6.91 _refine.aniso_B[1][2] -0.00 _refine.aniso_B[1][3] -0.00 _refine.aniso_B[2][2] -6.91 _refine.aniso_B[2][3] -0.00 _refine.aniso_B[3][3] 13.82 _refine.B_iso_max ? _refine.B_iso_mean 35.8 _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'THE FILE CONTAINS FRIEDEL PAIRS. BULK SOLVENT MODEL USED.' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5AWE _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.45 _refine.ls_d_res_low 40.51 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 8426 _refine.ls_number_reflns_R_free 1443 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 96.9 _refine.ls_percent_reflns_R_free 9.8 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.214 _refine.ls_R_factor_R_free 0.261 _refine.ls_R_factor_R_free_error 0.007 _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.214 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT MODEL' _refine.solvent_model_param_bsol 48.9401 _refine.solvent_model_param_ksol 0.38 _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.0 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF 246220.86 _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF 0.000000 _refine.pdbx_isotropic_thermal_model RESTRAINED _refine.pdbx_ls_cross_valid_method THROUGHOUT _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details RANDOM _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii ? _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii ? _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_analyze.entry_id 5AWE _refine_analyze.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_analyze.Luzzati_coordinate_error_free 0.40 _refine_analyze.Luzzati_coordinate_error_obs 0.29 _refine_analyze.Luzzati_d_res_low_free ? _refine_analyze.Luzzati_d_res_low_obs 5.00 _refine_analyze.Luzzati_sigma_a_free 0.38 _refine_analyze.Luzzati_sigma_a_free_details ? _refine_analyze.Luzzati_sigma_a_obs 0.26 _refine_analyze.Luzzati_sigma_a_obs_details ? _refine_analyze.number_disordered_residues ? _refine_analyze.occupancy_sum_hydrogen ? _refine_analyze.occupancy_sum_non_hydrogen ? _refine_analyze.RG_d_res_high ? _refine_analyze.RG_d_res_low ? _refine_analyze.RG_free ? _refine_analyze.RG_work ? _refine_analyze.RG_free_work_ratio ? _refine_analyze.pdbx_Luzzati_d_res_high_obs ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id 1 _refine_hist.pdbx_number_atoms_protein 0 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 0 _refine_hist.d_res_high 2.45 _refine_hist.d_res_low 40.51 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.017 ? ? ? c_bond_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_bond_d_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_bond_d_prot ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_d_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_d_prot ? ? 'X-RAY DIFFRACTION' ? 1.1 ? ? ? c_angle_deg ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_deg_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_angle_deg_prot ? ? 'X-RAY DIFFRACTION' ? 24.9 ? ? ? c_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_dihedral_angle_d_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_dihedral_angle_d_prot ? ? 'X-RAY DIFFRACTION' ? 0.81 ? ? ? c_improper_angle_d ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_improper_angle_d_na ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_improper_angle_d_prot ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_mcbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_mcangle_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_scbond_it ? ? 'X-RAY DIFFRACTION' ? ? ? ? ? c_scangle_it ? ? # _refine_ls_shell.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_ls_shell.d_res_high 2.45 _refine_ls_shell.d_res_low 2.54 _refine_ls_shell.number_reflns_all ? _refine_ls_shell.number_reflns_obs ? _refine_ls_shell.number_reflns_R_free 106 _refine_ls_shell.number_reflns_R_work 1175 _refine_ls_shell.percent_reflns_obs 83.7 _refine_ls_shell.percent_reflns_R_free 8.3 _refine_ls_shell.R_factor_all ? _refine_ls_shell.R_factor_obs ? _refine_ls_shell.R_factor_R_free 0.447 _refine_ls_shell.R_factor_R_free_error 0.043 _refine_ls_shell.R_factor_R_work 0.286 _refine_ls_shell.redundancy_reflns_all ? _refine_ls_shell.redundancy_reflns_obs ? _refine_ls_shell.wR_factor_all ? _refine_ls_shell.wR_factor_obs ? _refine_ls_shell.wR_factor_R_free ? _refine_ls_shell.wR_factor_R_work ? _refine_ls_shell.pdbx_total_number_of_bins_used 10 _refine_ls_shell.pdbx_phase_error ? _refine_ls_shell.pdbx_fsc_work ? _refine_ls_shell.pdbx_fsc_free ? # loop_ _pdbx_xplor_file.pdbx_refine_id _pdbx_xplor_file.serial_no _pdbx_xplor_file.param_file _pdbx_xplor_file.topol_file 'X-RAY DIFFRACTION' 1 CNS_TOPPAR/protein_rep.param CNS_TOPPAR/protein.top 'X-RAY DIFFRACTION' 2 CNS_TOPPAR/dna-rna_rep.param CNS_TOPPAR/dna-rna.top 'X-RAY DIFFRACTION' 3 CNS_TOPPAR/water_rep.param CNS_TOPPAR/water.top 'X-RAY DIFFRACTION' 4 CNS_TOPPAR/ion.param CNS_TOPPAR/ion.top 'X-RAY DIFFRACTION' 5 CNS_TOPPAR/carbohydrate.param CNS_TOPPAR/carbohydrate.top # _struct.entry_id 5AWE _struct.title ;Crystal structure of a hypothetical protein, TTHA0829 from Thermus thermophilus HB8, composed of cystathionine-beta-synthase (CBS) and aspartate-kinase chorismate-mutase tyrA (ACT) domains ; _struct.pdbx_descriptor 'Putative acetoin utilization protein, acetoin dehydrogenase' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5AWE _struct_keywords.text ;hypothetical protein, Thermus thermophilus HB8, CBS domain, ACT domain, Structural Genomics, RIKEN Structural Genomics/Proteomics Initiative, RSGI, UNKNOWN FUNCTION ; _struct_keywords.pdbx_keywords 'STRUCTURAL GENOMICS, UNKNOWN FUNCTION' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 2 ? TRP A 6 ? LEU A 2 TRP A 6 5 ? 5 HELX_P HELX_P2 AA2 PRO A 19 ? GLY A 31 ? PRO A 19 GLY A 31 1 ? 13 HELX_P HELX_P3 AA3 ASP A 49 ? ASP A 54 ? ASP A 49 ASP A 54 1 ? 6 HELX_P HELX_P4 AA4 SER A 64 ? LEU A 75 ? SER A 64 LEU A 75 1 ? 12 HELX_P HELX_P5 AA5 THR A 76 ? VAL A 80 ? THR A 76 VAL A 80 5 ? 5 HELX_P HELX_P6 AA6 PRO A 93 ? ARG A 104 ? PRO A 93 ARG A 104 1 ? 12 HELX_P HELX_P7 AA7 VAL A 123 ? LEU A 134 ? VAL A 123 LEU A 134 1 ? 12 HELX_P HELX_P8 AA8 GLY A 152 ? GLN A 159 ? GLY A 152 GLN A 159 1 ? 8 HELX_P HELX_P9 AA9 ASP A 189 ? GLU A 191 ? ASP A 189 GLU A 191 5 ? 3 HELX_P HELX_P10 AB1 GLY A 192 ? ALA A 200 ? GLY A 192 ALA A 200 1 ? 9 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order covale1 covale both ? A MSE 1 C ? ? ? 1_555 A LEU 2 N ? ? A MSE 1 A LEU 2 1_555 ? ? ? ? ? ? ? 1.323 ? covale2 covale both ? A TRP 6 C ? ? ? 1_555 A MSE 7 N ? ? A TRP 6 A MSE 7 1_555 ? ? ? ? ? ? ? 1.331 ? covale3 covale both ? A MSE 7 C ? ? ? 1_555 A THR 8 N ? ? A MSE 7 A THR 8 1_555 ? ? ? ? ? ? ? 1.328 ? covale4 covale both ? A VAL 37 C ? ? ? 1_555 A MSE 38 N ? ? A VAL 37 A MSE 38 1_555 ? ? ? ? ? ? ? 1.332 ? covale5 covale both ? A MSE 38 C ? ? ? 1_555 A GLU 39 N ? ? A MSE 38 A GLU 39 1_555 ? ? ? ? ? ? ? 1.326 ? covale6 covale both ? A ALA 55 C ? ? ? 1_555 A MSE 56 N ? ? A ALA 55 A MSE 56 1_555 ? ? ? ? ? ? ? 1.329 ? covale7 covale both ? A MSE 56 C ? ? ? 1_555 A PRO 57 N ? ? A MSE 56 A PRO 57 1_555 ? ? ? ? ? ? ? 1.346 ? covale8 covale both ? A GLU 67 C ? ? ? 1_555 A MSE 68 N ? ? A GLU 67 A MSE 68 1_555 ? ? ? ? ? ? ? 1.328 ? covale9 covale both ? A MSE 68 C ? ? ? 1_555 A ASN 69 N ? ? A MSE 68 A ASN 69 1_555 ? ? ? ? ? ? ? 1.328 ? covale10 covale both ? A VAL 80 C ? ? ? 1_555 A MSE 81 N ? ? A VAL 80 A MSE 81 1_555 ? ? ? ? ? ? ? 1.329 ? covale11 covale both ? A MSE 81 C ? ? ? 1_555 A ALA 82 N ? ? A MSE 81 A ALA 82 1_555 ? ? ? ? ? ? ? 1.329 ? covale12 covale both ? A LEU 100 C ? ? ? 1_555 A MSE 101 N ? ? A LEU 100 A MSE 101 1_555 ? ? ? ? ? ? ? 1.331 ? covale13 covale both ? A MSE 101 C ? ? ? 1_555 A GLU 102 N ? ? A MSE 101 A GLU 102 1_555 ? ? ? ? ? ? ? 1.331 ? covale14 covale both ? A VAL 111 C ? ? ? 1_555 A MSE 112 N ? ? A VAL 111 A MSE 112 1_555 ? ? ? ? ? ? ? 1.325 ? covale15 covale both ? A MSE 112 C ? ? ? 1_555 A GLU 113 N ? ? A MSE 112 A GLU 113 1_555 ? ? ? ? ? ? ? 1.326 ? covale16 covale both ? A GLN 156 C ? ? ? 1_555 A MSE 157 N ? ? A GLN 156 A MSE 157 1_555 ? ? ? ? ? ? ? 1.331 ? covale17 covale both ? A MSE 157 C ? ? ? 1_555 A ALA 158 N ? ? A MSE 157 A ALA 158 1_555 ? ? ? ? ? ? ? 1.336 ? covale18 covale both ? A VAL 182 C ? ? ? 1_555 A MSE 183 N ? ? A VAL 182 A MSE 183 1_555 ? ? ? ? ? ? ? 1.326 ? covale19 covale both ? A MSE 183 C ? ? ? 1_555 A ARG 184 N ? ? A MSE 183 A ARG 184 1_555 ? ? ? ? ? ? ? 1.326 ? # _struct_conn_type.id covale _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _struct_mon_prot_cis.pdbx_id _struct_mon_prot_cis.label_comp_id _struct_mon_prot_cis.label_seq_id _struct_mon_prot_cis.label_asym_id _struct_mon_prot_cis.label_alt_id _struct_mon_prot_cis.pdbx_PDB_ins_code _struct_mon_prot_cis.auth_comp_id _struct_mon_prot_cis.auth_seq_id _struct_mon_prot_cis.auth_asym_id _struct_mon_prot_cis.pdbx_label_comp_id_2 _struct_mon_prot_cis.pdbx_label_seq_id_2 _struct_mon_prot_cis.pdbx_label_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_ins_code_2 _struct_mon_prot_cis.pdbx_auth_comp_id_2 _struct_mon_prot_cis.pdbx_auth_seq_id_2 _struct_mon_prot_cis.pdbx_auth_asym_id_2 _struct_mon_prot_cis.pdbx_PDB_model_num _struct_mon_prot_cis.pdbx_omega_angle 1 ARG 83 A . ? ARG 83 A PRO 84 A ? PRO 84 A 1 -0.06 2 PRO 162 A . ? PRO 162 A PRO 163 A ? PRO 163 A 1 0.43 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 2 ? AA3 ? 4 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA2 1 2 ? anti-parallel AA3 1 2 ? anti-parallel AA3 2 3 ? anti-parallel AA3 3 4 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 THR A 8 ? LYS A 9 ? THR A 8 LYS A 9 AA1 2 ARG A 116 ? THR A 122 ? ARG A 116 THR A 122 AA1 3 GLY A 108 ? GLU A 113 ? GLY A 108 GLU A 113 AA1 4 VAL A 88 ? GLU A 89 ? VAL A 88 GLU A 89 AA2 1 ARG A 34 ? GLU A 39 ? ARG A 34 GLU A 39 AA2 2 ARG A 42 ? THR A 48 ? ARG A 42 THR A 48 AA3 1 ASN A 165 ? LEU A 175 ? ASN A 165 LEU A 175 AA3 2 TYR A 178 ? VAL A 186 ? TYR A 178 VAL A 186 AA3 3 LEU A 141 ? PRO A 148 ? LEU A 141 PRO A 148 AA3 4 ARG A 203 ? PRO A 209 ? ARG A 203 PRO A 209 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N THR A 8 ? N THR A 8 O ILE A 120 ? O ILE A 120 AA1 2 3 O GLY A 119 ? O GLY A 119 N VAL A 111 ? N VAL A 111 AA1 3 4 O MSE A 112 ? O MSE A 112 N VAL A 88 ? N VAL A 88 AA2 1 2 N LEU A 35 ? N LEU A 35 O VAL A 47 ? O VAL A 47 AA3 1 2 N ALA A 170 ? N ALA A 170 O VAL A 182 ? O VAL A 182 AA3 2 3 O MSE A 183 ? O MSE A 183 N ILE A 143 ? N ILE A 143 AA3 3 4 N ARG A 142 ? N ARG A 142 O ARG A 208 ? O ARG A 208 # _database_PDB_matrix.entry_id 5AWE _database_PDB_matrix.origx[1][1] 1.000000 _database_PDB_matrix.origx[1][2] 0.000000 _database_PDB_matrix.origx[1][3] 0.000000 _database_PDB_matrix.origx[2][1] 0.000000 _database_PDB_matrix.origx[2][2] 1.000000 _database_PDB_matrix.origx[2][3] 0.000000 _database_PDB_matrix.origx[3][1] 0.000000 _database_PDB_matrix.origx[3][2] 0.000000 _database_PDB_matrix.origx[3][3] 1.000000 _database_PDB_matrix.origx_vector[1] 0.00000 _database_PDB_matrix.origx_vector[2] 0.00000 _database_PDB_matrix.origx_vector[3] 0.00000 # _atom_sites.entry_id 5AWE _atom_sites.fract_transf_matrix[1][1] 0.011013 _atom_sites.fract_transf_matrix[1][2] 0.006358 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.012717 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.011142 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O SE # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MSE 1 1 1 MSE MSE A . n A 1 2 LEU 2 2 2 LEU LEU A . n A 1 3 VAL 3 3 3 VAL VAL A . n A 1 4 ARG 4 4 4 ARG ARG A . n A 1 5 ASP 5 5 5 ASP ASP A . n A 1 6 TRP 6 6 6 TRP TRP A . n A 1 7 MSE 7 7 7 MSE MSE A . n A 1 8 THR 8 8 8 THR THR A . n A 1 9 LYS 9 9 9 LYS LYS A . n A 1 10 ASP 10 10 10 ASP ASP A . n A 1 11 PRO 11 11 11 PRO PRO A . n A 1 12 VAL 12 12 12 VAL VAL A . n A 1 13 VAL 13 13 13 VAL VAL A . n A 1 14 VAL 14 14 14 VAL VAL A . n A 1 15 ALA 15 15 15 ALA ALA A . n A 1 16 PRO 16 16 16 PRO PRO A . n A 1 17 ASP 17 17 17 ASP ASP A . n A 1 18 THR 18 18 18 THR THR A . n A 1 19 PRO 19 19 19 PRO PRO A . n A 1 20 VAL 20 20 20 VAL VAL A . n A 1 21 LEU 21 21 21 LEU LEU A . n A 1 22 GLU 22 22 22 GLU GLU A . n A 1 23 ALA 23 23 23 ALA ALA A . n A 1 24 ILE 24 24 24 ILE ILE A . n A 1 25 ARG 25 25 25 ARG ARG A . n A 1 26 LEU 26 26 26 LEU LEU A . n A 1 27 LEU 27 27 27 LEU LEU A . n A 1 28 LYS 28 28 28 LYS LYS A . n A 1 29 GLU 29 29 29 GLU GLU A . n A 1 30 LYS 30 30 30 LYS LYS A . n A 1 31 GLY 31 31 31 GLY GLY A . n A 1 32 PHE 32 32 32 PHE PHE A . n A 1 33 ARG 33 33 33 ARG ARG A . n A 1 34 ARG 34 34 34 ARG ARG A . n A 1 35 LEU 35 35 35 LEU LEU A . n A 1 36 PRO 36 36 36 PRO PRO A . n A 1 37 VAL 37 37 37 VAL VAL A . n A 1 38 MSE 38 38 38 MSE MSE A . n A 1 39 GLU 39 39 39 GLU GLU A . n A 1 40 GLY 40 40 40 GLY GLY A . n A 1 41 GLY 41 41 41 GLY GLY A . n A 1 42 ARG 42 42 42 ARG ARG A . n A 1 43 LEU 43 43 43 LEU LEU A . n A 1 44 VAL 44 44 44 VAL VAL A . n A 1 45 GLY 45 45 45 GLY GLY A . n A 1 46 LEU 46 46 46 LEU LEU A . n A 1 47 VAL 47 47 47 VAL VAL A . n A 1 48 THR 48 48 48 THR THR A . n A 1 49 ASP 49 49 49 ASP ASP A . n A 1 50 LYS 50 50 50 LYS LYS A . n A 1 51 ASP 51 51 51 ASP ASP A . n A 1 52 LEU 52 52 52 LEU LEU A . n A 1 53 LYS 53 53 53 LYS LYS A . n A 1 54 ASP 54 54 54 ASP ASP A . n A 1 55 ALA 55 55 55 ALA ALA A . n A 1 56 MSE 56 56 56 MSE MSE A . n A 1 57 PRO 57 57 57 PRO PRO A . n A 1 58 SER 58 58 ? ? ? A . n A 1 59 LYS 59 59 ? ? ? A . n A 1 60 ALA 60 60 ? ? ? A . n A 1 61 THR 61 61 ? ? ? A . n A 1 62 THR 62 62 ? ? ? A . n A 1 63 LEU 63 63 63 LEU LEU A . n A 1 64 SER 64 64 64 SER SER A . n A 1 65 VAL 65 65 65 VAL VAL A . n A 1 66 TRP 66 66 66 TRP TRP A . n A 1 67 GLU 67 67 67 GLU GLU A . n A 1 68 MSE 68 68 68 MSE MSE A . n A 1 69 ASN 69 69 69 ASN ASN A . n A 1 70 TYR 70 70 70 TYR TYR A . n A 1 71 LEU 71 71 71 LEU LEU A . n A 1 72 LEU 72 72 72 LEU LEU A . n A 1 73 ALA 73 73 73 ALA ALA A . n A 1 74 LYS 74 74 74 LYS LYS A . n A 1 75 LEU 75 75 75 LEU LEU A . n A 1 76 THR 76 76 76 THR THR A . n A 1 77 VAL 77 77 77 VAL VAL A . n A 1 78 ARG 78 78 78 ARG ARG A . n A 1 79 GLU 79 79 79 GLU GLU A . n A 1 80 VAL 80 80 80 VAL VAL A . n A 1 81 MSE 81 81 81 MSE MSE A . n A 1 82 ALA 82 82 82 ALA ALA A . n A 1 83 ARG 83 83 83 ARG ARG A . n A 1 84 PRO 84 84 84 PRO PRO A . n A 1 85 VAL 85 85 85 VAL VAL A . n A 1 86 VAL 86 86 86 VAL VAL A . n A 1 87 THR 87 87 87 THR THR A . n A 1 88 VAL 88 88 88 VAL VAL A . n A 1 89 GLU 89 89 89 GLU GLU A . n A 1 90 ALA 90 90 90 ALA ALA A . n A 1 91 ASP 91 91 91 ASP ASP A . n A 1 92 ALA 92 92 92 ALA ALA A . n A 1 93 PRO 93 93 93 PRO PRO A . n A 1 94 LEU 94 94 94 LEU LEU A . n A 1 95 GLU 95 95 95 GLU GLU A . n A 1 96 LYS 96 96 96 LYS LYS A . n A 1 97 ALA 97 97 97 ALA ALA A . n A 1 98 ALA 98 98 98 ALA ALA A . n A 1 99 LEU 99 99 99 LEU LEU A . n A 1 100 LEU 100 100 100 LEU LEU A . n A 1 101 MSE 101 101 101 MSE MSE A . n A 1 102 GLU 102 102 102 GLU GLU A . n A 1 103 GLU 103 103 103 GLU GLU A . n A 1 104 ARG 104 104 104 ARG ARG A . n A 1 105 LYS 105 105 105 LYS LYS A . n A 1 106 ILE 106 106 106 ILE ILE A . n A 1 107 GLY 107 107 107 GLY GLY A . n A 1 108 GLY 108 108 108 GLY GLY A . n A 1 109 LEU 109 109 109 LEU LEU A . n A 1 110 PRO 110 110 110 PRO PRO A . n A 1 111 VAL 111 111 111 VAL VAL A . n A 1 112 MSE 112 112 112 MSE MSE A . n A 1 113 GLU 113 113 113 GLU GLU A . n A 1 114 GLY 114 114 114 GLY GLY A . n A 1 115 GLU 115 115 115 GLU GLU A . n A 1 116 ARG 116 116 116 ARG ARG A . n A 1 117 LEU 117 117 117 LEU LEU A . n A 1 118 VAL 118 118 118 VAL VAL A . n A 1 119 GLY 119 119 119 GLY GLY A . n A 1 120 ILE 120 120 120 ILE ILE A . n A 1 121 ILE 121 121 121 ILE ILE A . n A 1 122 THR 122 122 122 THR THR A . n A 1 123 VAL 123 123 123 VAL VAL A . n A 1 124 THR 124 124 124 THR THR A . n A 1 125 ASP 125 125 125 ASP ASP A . n A 1 126 VAL 126 126 126 VAL VAL A . n A 1 127 LEU 127 127 127 LEU LEU A . n A 1 128 ARG 128 128 128 ARG ARG A . n A 1 129 ALA 129 129 129 ALA ALA A . n A 1 130 PHE 130 130 130 PHE PHE A . n A 1 131 ILE 131 131 131 ILE ILE A . n A 1 132 GLU 132 132 132 GLU GLU A . n A 1 133 VAL 133 133 133 VAL VAL A . n A 1 134 LEU 134 134 134 LEU LEU A . n A 1 135 GLY 135 135 135 GLY GLY A . n A 1 136 LEU 136 136 136 LEU LEU A . n A 1 137 LYS 137 137 137 LYS LYS A . n A 1 138 LEU 138 138 138 LEU LEU A . n A 1 139 GLY 139 139 139 GLY GLY A . n A 1 140 GLY 140 140 140 GLY GLY A . n A 1 141 LEU 141 141 141 LEU LEU A . n A 1 142 ARG 142 142 142 ARG ARG A . n A 1 143 ILE 143 143 143 ILE ILE A . n A 1 144 THR 144 144 144 THR THR A . n A 1 145 VAL 145 145 145 VAL VAL A . n A 1 146 ASP 146 146 146 ASP ASP A . n A 1 147 ILE 147 147 147 ILE ILE A . n A 1 148 PRO 148 148 148 PRO PRO A . n A 1 149 ASP 149 149 149 ASP ASP A . n A 1 150 VAL 150 150 150 VAL VAL A . n A 1 151 PRO 151 151 151 PRO PRO A . n A 1 152 GLY 152 152 152 GLY GLY A . n A 1 153 ALA 153 153 153 ALA ALA A . n A 1 154 LEU 154 154 154 LEU LEU A . n A 1 155 ALA 155 155 155 ALA ALA A . n A 1 156 GLN 156 156 156 GLN GLN A . n A 1 157 MSE 157 157 157 MSE MSE A . n A 1 158 ALA 158 158 158 ALA ALA A . n A 1 159 GLN 159 159 159 GLN GLN A . n A 1 160 ALA 160 160 160 ALA ALA A . n A 1 161 VAL 161 161 161 VAL VAL A . n A 1 162 PRO 162 162 162 PRO PRO A . n A 1 163 PRO 163 163 163 PRO PRO A . n A 1 164 ALA 164 164 164 ALA ALA A . n A 1 165 ASN 165 165 165 ASN ASN A . n A 1 166 ILE 166 166 166 ILE ILE A . n A 1 167 VAL 167 167 167 VAL VAL A . n A 1 168 SER 168 168 168 SER SER A . n A 1 169 ILE 169 169 169 ILE ILE A . n A 1 170 ALA 170 170 170 ALA ALA A . n A 1 171 THR 171 171 171 THR THR A . n A 1 172 ALA 172 172 172 ALA ALA A . n A 1 173 ALA 173 173 173 ALA ALA A . n A 1 174 HIS 174 174 174 HIS HIS A . n A 1 175 LEU 175 175 175 LEU LEU A . n A 1 176 PRO 176 176 176 PRO PRO A . n A 1 177 GLY 177 177 177 GLY GLY A . n A 1 178 TYR 178 178 178 TYR TYR A . n A 1 179 GLN 179 179 179 GLN GLN A . n A 1 180 ARG 180 180 180 ARG ARG A . n A 1 181 LEU 181 181 181 LEU LEU A . n A 1 182 VAL 182 182 182 VAL VAL A . n A 1 183 MSE 183 183 183 MSE MSE A . n A 1 184 ARG 184 184 184 ARG ARG A . n A 1 185 VAL 185 185 185 VAL VAL A . n A 1 186 VAL 186 186 186 VAL VAL A . n A 1 187 GLY 187 187 187 GLY GLY A . n A 1 188 GLU 188 188 188 GLU GLU A . n A 1 189 ASP 189 189 189 ASP ASP A . n A 1 190 VAL 190 190 190 VAL VAL A . n A 1 191 GLU 191 191 191 GLU GLU A . n A 1 192 GLY 192 192 192 GLY GLY A . n A 1 193 VAL 193 193 193 VAL VAL A . n A 1 194 PRO 194 194 194 PRO PRO A . n A 1 195 LYS 195 195 195 LYS LYS A . n A 1 196 ARG 196 196 196 ARG ARG A . n A 1 197 LEU 197 197 197 LEU LEU A . n A 1 198 GLU 198 198 198 GLU GLU A . n A 1 199 ALA 199 199 199 ALA ALA A . n A 1 200 ALA 200 200 200 ALA ALA A . n A 1 201 GLY 201 201 201 GLY GLY A . n A 1 202 GLU 202 202 202 GLU GLU A . n A 1 203 ARG 203 203 203 ARG ARG A . n A 1 204 VAL 204 204 204 VAL VAL A . n A 1 205 VAL 205 205 205 VAL VAL A . n A 1 206 ASP 206 206 206 ASP ASP A . n A 1 207 VAL 207 207 207 VAL VAL A . n A 1 208 ARG 208 208 208 ARG ARG A . n A 1 209 PRO 209 209 209 PRO PRO A . n A 1 210 GLY 210 210 210 GLY GLY A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 HOH 1 301 19 HOH HOH A . B 2 HOH 2 302 33 HOH HOH A . B 2 HOH 3 303 1 HOH HOH A . B 2 HOH 4 304 52 HOH HOH A . B 2 HOH 5 305 53 HOH HOH A . B 2 HOH 6 306 26 HOH HOH A . B 2 HOH 7 307 3 HOH HOH A . B 2 HOH 8 308 13 HOH HOH A . B 2 HOH 9 309 10 HOH HOH A . B 2 HOH 10 310 48 HOH HOH A . B 2 HOH 11 311 51 HOH HOH A . B 2 HOH 12 312 6 HOH HOH A . B 2 HOH 13 313 2 HOH HOH A . B 2 HOH 14 314 14 HOH HOH A . B 2 HOH 15 315 41 HOH HOH A . B 2 HOH 16 316 15 HOH HOH A . B 2 HOH 17 317 8 HOH HOH A . B 2 HOH 18 318 9 HOH HOH A . B 2 HOH 19 319 12 HOH HOH A . B 2 HOH 20 320 11 HOH HOH A . B 2 HOH 21 321 37 HOH HOH A . B 2 HOH 22 322 49 HOH HOH A . B 2 HOH 23 323 7 HOH HOH A . B 2 HOH 24 324 50 HOH HOH A . B 2 HOH 25 325 47 HOH HOH A . B 2 HOH 26 326 4 HOH HOH A . B 2 HOH 27 327 43 HOH HOH A . B 2 HOH 28 328 17 HOH HOH A . B 2 HOH 29 329 27 HOH HOH A . B 2 HOH 30 330 23 HOH HOH A . B 2 HOH 31 331 42 HOH HOH A . B 2 HOH 32 332 30 HOH HOH A . B 2 HOH 33 333 25 HOH HOH A . B 2 HOH 34 334 22 HOH HOH A . B 2 HOH 35 335 5 HOH HOH A . B 2 HOH 36 336 35 HOH HOH A . B 2 HOH 37 337 21 HOH HOH A . B 2 HOH 38 338 45 HOH HOH A . B 2 HOH 39 339 31 HOH HOH A . B 2 HOH 40 340 46 HOH HOH A . B 2 HOH 41 341 38 HOH HOH A . B 2 HOH 42 342 34 HOH HOH A . B 2 HOH 43 343 39 HOH HOH A . B 2 HOH 44 344 28 HOH HOH A . B 2 HOH 45 345 32 HOH HOH A . B 2 HOH 46 346 44 HOH HOH A . B 2 HOH 47 347 40 HOH HOH A . B 2 HOH 48 348 16 HOH HOH A . B 2 HOH 49 349 18 HOH HOH A . B 2 HOH 50 350 36 HOH HOH A . B 2 HOH 51 351 20 HOH HOH A . B 2 HOH 52 352 29 HOH HOH A . B 2 HOH 53 353 24 HOH HOH A . # loop_ _pdbx_struct_mod_residue.id _pdbx_struct_mod_residue.label_asym_id _pdbx_struct_mod_residue.label_comp_id _pdbx_struct_mod_residue.label_seq_id _pdbx_struct_mod_residue.auth_asym_id _pdbx_struct_mod_residue.auth_comp_id _pdbx_struct_mod_residue.auth_seq_id _pdbx_struct_mod_residue.PDB_ins_code _pdbx_struct_mod_residue.parent_comp_id _pdbx_struct_mod_residue.details 1 A MSE 1 A MSE 1 ? MET 'modified residue' 2 A MSE 7 A MSE 7 ? MET 'modified residue' 3 A MSE 38 A MSE 38 ? MET 'modified residue' 4 A MSE 56 A MSE 56 ? MET 'modified residue' 5 A MSE 68 A MSE 68 ? MET 'modified residue' 6 A MSE 81 A MSE 81 ? MET 'modified residue' 7 A MSE 101 A MSE 101 ? MET 'modified residue' 8 A MSE 112 A MSE 112 ? MET 'modified residue' 9 A MSE 157 A MSE 157 ? MET 'modified residue' 10 A MSE 183 A MSE 183 ? MET 'modified residue' # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details tetrameric _pdbx_struct_assembly.oligomeric_count 4 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2,3,4 _pdbx_struct_assembly_gen.asym_id_list A,B # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 13200 ? 1 MORE -86 ? 1 'SSA (A^2)' 34570 ? # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 4_765 -x+2,-y+1,z -1.0000000000 0.0000000000 0.0000000000 136.2000000000 0.0000000000 -1.0000000000 0.0000000000 78.6351066636 0.0000000000 0.0000000000 1.0000000000 0.0000000000 3 'crystal symmetry operation' 9_765 -x+2,-x+y+1,-z+1/3 -0.5000000000 -0.8660254038 0.0000000000 136.2000000000 -0.8660254038 0.5000000000 0.0000000000 78.6351066636 0.0000000000 0.0000000000 -1.0000000000 29.9166666667 4 'crystal symmetry operation' 12_555 x,x-y,-z+1/3 0.5000000000 0.8660254038 0.0000000000 0.0000000000 0.8660254038 -0.5000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 29.9166666667 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-05-18 2 'Structure model' 1 1 2016-09-28 3 'Structure model' 1 2 2020-02-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Structure summary' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Derived calculations' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' diffrn_source 2 3 'Structure model' pdbx_struct_oper_list # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? CNS ? ? ? 1.3 1 ? 'data processing' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? SnB ? ? ? . 4 # _pdbx_validate_symm_contact.id 1 _pdbx_validate_symm_contact.PDB_model_num 1 _pdbx_validate_symm_contact.auth_atom_id_1 CH2 _pdbx_validate_symm_contact.auth_asym_id_1 A _pdbx_validate_symm_contact.auth_comp_id_1 TRP _pdbx_validate_symm_contact.auth_seq_id_1 66 _pdbx_validate_symm_contact.PDB_ins_code_1 ? _pdbx_validate_symm_contact.label_alt_id_1 ? _pdbx_validate_symm_contact.site_symmetry_1 1_555 _pdbx_validate_symm_contact.auth_atom_id_2 CH2 _pdbx_validate_symm_contact.auth_asym_id_2 A _pdbx_validate_symm_contact.auth_comp_id_2 TRP _pdbx_validate_symm_contact.auth_seq_id_2 66 _pdbx_validate_symm_contact.PDB_ins_code_2 ? _pdbx_validate_symm_contact.label_alt_id_2 ? _pdbx_validate_symm_contact.site_symmetry_2 12_555 _pdbx_validate_symm_contact.dist 2.12 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ARG A 33 ? ? -142.12 -16.46 2 1 ASP A 149 ? ? -92.16 51.27 3 1 ALA A 173 ? ? -171.58 141.31 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A SER 58 ? A SER 58 2 1 Y 1 A LYS 59 ? A LYS 59 3 1 Y 1 A ALA 60 ? A ALA 60 4 1 Y 1 A THR 61 ? A THR 61 5 1 Y 1 A THR 62 ? A THR 62 # _pdbx_entity_nonpoly.entity_id 2 _pdbx_entity_nonpoly.name water _pdbx_entity_nonpoly.comp_id HOH #