data_5AYH # _entry.id 5AYH # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5AYH pdb_00005ayh 10.2210/pdb5ayh/pdb WWPDB D_1300000197 ? ? # _pdbx_database_related.db_name PDB _pdbx_database_related.details 'This entry is the C-terminal truncation of 3WUQ' _pdbx_database_related.db_id 3WUQ _pdbx_database_related.content_type re-refinement # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5AYH _pdbx_database_status.recvd_initial_deposition_date 2015-08-21 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Kurisu, G.' 1 'Nishikawa, Y.' 2 'Inatomi, M.' 3 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev J.Mol.Biol. _citation.journal_id_ASTM JMOBAK _citation.journal_id_CSD 0070 _citation.journal_id_ISSN 1089-8638 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 428 _citation.language ? _citation.page_first 1886 _citation.page_last 1896 _citation.title 'Structural Change in the Dynein Stalk Region Associated with Two Different Affinities for the Microtubule' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1016/j.jmb.2015.11.008 _citation.pdbx_database_id_PubMed 26585405 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Nishikawa, Y.' 1 ? primary 'Inatomi, M.' 2 ? primary 'Iwasaki, H.' 3 ? primary 'Kurisu, G.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 120.00 _cell.angle_gamma_esd ? _cell.entry_id 5AYH _cell.details ? _cell.formula_units_Z ? _cell.length_a 103.325 _cell.length_a_esd ? _cell.length_b 103.325 _cell.length_b_esd ? _cell.length_c 69.709 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 6 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5AYH _symmetry.cell_setting ? _symmetry.Int_Tables_number 152 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 31 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # _entity.id 1 _entity.type polymer _entity.src_method man _entity.pdbx_description 'Cytoplasmic dynein 1 heavy chain 1' _entity.formula_weight 31716.348 _entity.pdbx_number_of_molecules 1 _entity.pdbx_ec ? _entity.pdbx_mutation ? _entity.pdbx_fragment ? _entity.details ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Cytoplasmic dynein heavy chain 1,Dynein heavy chain,cytosolic' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;MKETVDQVEELRRDLRIKSQELEVKNAAANDKLKKMVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEP AVIEAQNAVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEEISDAIREKM KKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLEDDAKDNQQKANEVEQMIRDLEASIARY KEEYAVLISEAQAIKADLAAVEAKVNRSTAHHHHHH ; _entity_poly.pdbx_seq_one_letter_code_can ;MKETVDQVEELRRDLRIKSQELEVKNAAANDKLKKMVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEP AVIEAQNAVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEEISDAIREKM KKNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLEDDAKDNQQKANEVEQMIRDLEASIARY KEEYAVLISEAQAIKADLAAVEAKVNRSTAHHHHHH ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 MET n 1 2 LYS n 1 3 GLU n 1 4 THR n 1 5 VAL n 1 6 ASP n 1 7 GLN n 1 8 VAL n 1 9 GLU n 1 10 GLU n 1 11 LEU n 1 12 ARG n 1 13 ARG n 1 14 ASP n 1 15 LEU n 1 16 ARG n 1 17 ILE n 1 18 LYS n 1 19 SER n 1 20 GLN n 1 21 GLU n 1 22 LEU n 1 23 GLU n 1 24 VAL n 1 25 LYS n 1 26 ASN n 1 27 ALA n 1 28 ALA n 1 29 ALA n 1 30 ASN n 1 31 ASP n 1 32 LYS n 1 33 LEU n 1 34 LYS n 1 35 LYS n 1 36 MET n 1 37 VAL n 1 38 LYS n 1 39 ASP n 1 40 GLN n 1 41 GLN n 1 42 GLU n 1 43 ALA n 1 44 GLU n 1 45 LYS n 1 46 LYS n 1 47 LYS n 1 48 VAL n 1 49 MET n 1 50 SER n 1 51 GLN n 1 52 GLU n 1 53 ILE n 1 54 GLN n 1 55 GLU n 1 56 GLN n 1 57 LEU n 1 58 HIS n 1 59 LYS n 1 60 GLN n 1 61 GLN n 1 62 GLU n 1 63 VAL n 1 64 ILE n 1 65 ALA n 1 66 ASP n 1 67 LYS n 1 68 GLN n 1 69 MET n 1 70 SER n 1 71 VAL n 1 72 LYS n 1 73 GLU n 1 74 ASP n 1 75 LEU n 1 76 ASP n 1 77 LYS n 1 78 VAL n 1 79 GLU n 1 80 PRO n 1 81 ALA n 1 82 VAL n 1 83 ILE n 1 84 GLU n 1 85 ALA n 1 86 GLN n 1 87 ASN n 1 88 ALA n 1 89 VAL n 1 90 LYS n 1 91 SER n 1 92 ILE n 1 93 LYS n 1 94 LYS n 1 95 GLN n 1 96 HIS n 1 97 LEU n 1 98 VAL n 1 99 GLU n 1 100 VAL n 1 101 ARG n 1 102 SER n 1 103 MET n 1 104 ALA n 1 105 ASN n 1 106 PRO n 1 107 PRO n 1 108 ALA n 1 109 ALA n 1 110 VAL n 1 111 LYS n 1 112 LEU n 1 113 ALA n 1 114 LEU n 1 115 GLU n 1 116 SER n 1 117 ILE n 1 118 CYS n 1 119 LEU n 1 120 LEU n 1 121 LEU n 1 122 GLY n 1 123 GLU n 1 124 SER n 1 125 THR n 1 126 THR n 1 127 ASP n 1 128 TRP n 1 129 LYS n 1 130 GLN n 1 131 ILE n 1 132 ARG n 1 133 SER n 1 134 ILE n 1 135 ILE n 1 136 MET n 1 137 ARG n 1 138 GLU n 1 139 ASN n 1 140 PHE n 1 141 ILE n 1 142 PRO n 1 143 THR n 1 144 ILE n 1 145 VAL n 1 146 ASN n 1 147 PHE n 1 148 SER n 1 149 ALA n 1 150 GLU n 1 151 GLU n 1 152 ILE n 1 153 SER n 1 154 ASP n 1 155 ALA n 1 156 ILE n 1 157 ARG n 1 158 GLU n 1 159 LYS n 1 160 MET n 1 161 LYS n 1 162 LYS n 1 163 ASN n 1 164 TYR n 1 165 MET n 1 166 SER n 1 167 ASN n 1 168 PRO n 1 169 SER n 1 170 TYR n 1 171 ASN n 1 172 TYR n 1 173 GLU n 1 174 ILE n 1 175 VAL n 1 176 ASN n 1 177 ARG n 1 178 ALA n 1 179 SER n 1 180 LEU n 1 181 ALA n 1 182 CYS n 1 183 GLY n 1 184 PRO n 1 185 MET n 1 186 VAL n 1 187 LYS n 1 188 TRP n 1 189 ALA n 1 190 ILE n 1 191 ALA n 1 192 GLN n 1 193 LEU n 1 194 ASN n 1 195 TYR n 1 196 ALA n 1 197 ASP n 1 198 MET n 1 199 LEU n 1 200 LYS n 1 201 ARG n 1 202 VAL n 1 203 GLU n 1 204 PRO n 1 205 LEU n 1 206 ARG n 1 207 ASN n 1 208 GLU n 1 209 LEU n 1 210 GLN n 1 211 LYS n 1 212 LEU n 1 213 GLU n 1 214 ASP n 1 215 ASP n 1 216 ALA n 1 217 LYS n 1 218 ASP n 1 219 ASN n 1 220 GLN n 1 221 GLN n 1 222 LYS n 1 223 ALA n 1 224 ASN n 1 225 GLU n 1 226 VAL n 1 227 GLU n 1 228 GLN n 1 229 MET n 1 230 ILE n 1 231 ARG n 1 232 ASP n 1 233 LEU n 1 234 GLU n 1 235 ALA n 1 236 SER n 1 237 ILE n 1 238 ALA n 1 239 ARG n 1 240 TYR n 1 241 LYS n 1 242 GLU n 1 243 GLU n 1 244 TYR n 1 245 ALA n 1 246 VAL n 1 247 LEU n 1 248 ILE n 1 249 SER n 1 250 GLU n 1 251 ALA n 1 252 GLN n 1 253 ALA n 1 254 ILE n 1 255 LYS n 1 256 ALA n 1 257 ASP n 1 258 LEU n 1 259 ALA n 1 260 ALA n 1 261 VAL n 1 262 GLU n 1 263 ALA n 1 264 LYS n 1 265 VAL n 1 266 ASN n 1 267 ARG n 1 268 SER n 1 269 THR n 1 270 ALA n 1 271 HIS n 1 272 HIS n 1 273 HIS n 1 274 HIS n 1 275 HIS n 1 276 HIS n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 276 _entity_src_gen.gene_src_common_name Mouse _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene 'Dync1h1, Dhc1, Dnch1, Dnchc1, Dyhc' _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Mus musculus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 10090 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name pET17b _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code DYHC1_MOUSE _struct_ref.pdbx_db_accession Q9JHU4 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;KETVDQVEELRRDLRIKSQELEVKNAAANDKLKKMVKDQQEAEKKKVMSQEIQEQLHKQQEVIADKQMSVKEDLDKVEPA VIEAQNAVKSIKKQHLVEVRSMANPPAAVKLALESICLLLGESTTDWKQIRSIIMRENFIPTIVNFSAEEISDAIREKMK KNYMSNPSYNYEIVNRASLACGPMVKWAIAQLNYADMLKRVEPLRNELQKLEDDAKDNQQKANEVEQMIRDLEASIARYK EEYAVLISEAQAIKADLAAVEAKVNRSTA ; _struct_ref.pdbx_align_begin 3207 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5AYH _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 2 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 270 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q9JHU4 _struct_ref_seq.db_align_beg 3207 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 3475 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 3207 _struct_ref_seq.pdbx_auth_seq_align_end 3475 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5AYH MET A 1 ? UNP Q9JHU4 ? ? 'initiating methionine' 3206 1 1 5AYH HIS A 271 ? UNP Q9JHU4 ? ? 'expression tag' 3476 2 1 5AYH HIS A 272 ? UNP Q9JHU4 ? ? 'expression tag' 3477 3 1 5AYH HIS A 273 ? UNP Q9JHU4 ? ? 'expression tag' 3478 4 1 5AYH HIS A 274 ? UNP Q9JHU4 ? ? 'expression tag' 3479 5 1 5AYH HIS A 275 ? UNP Q9JHU4 ? ? 'expression tag' 3480 6 1 5AYH HIS A 276 ? UNP Q9JHU4 ? ? 'expression tag' 3481 7 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5AYH _exptl.crystals_number ? _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 3.40 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 63.82 _exptl_crystal.description 'THE ENTRY CONTAINS FRIEDEL PAIRS IN F_PLUS/MINUS COLUMNS.' _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 3350, ammonium phosphate monobasic' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX300HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-11-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.90000 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL44XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.90000 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL44XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5AYH _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 3.00 _reflns.d_resolution_low 25 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all 14221 _reflns.number_obs 14221 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 96.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_Rmerge_I_obs 0.076 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 36.3 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 3.00 _reflns_shell.d_res_low 3.05 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs 3.6 _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all 96.7 _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs 0.704 _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy 3.3 _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details 'SF FILE CONTAINS FRIEDEL PAIRS UNDER I/F_MINUS AND I/F_PLUS COLUMNS.' _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5AYH _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 3.011 _refine.ls_d_res_low 23.380 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 14221 _refine.ls_number_reflns_R_free 1412 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 86.28 _refine.ls_percent_reflns_R_free 9.93 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2590 _refine.ls_R_factor_R_free 0.2951 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2549 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 2.50 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 3WUQ _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 32.52 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.45 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1924 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 0 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1924 _refine_hist.d_res_high 3.011 _refine_hist.d_res_low 23.380 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.002 ? 1944 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.592 ? 2625 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 12.186 ? 735 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.023 ? 306 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.002 ? 345 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 3.0113 3.1187 . . 97 939 62.00 . . . 0.3678 . 0.3466 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.1187 3.2433 . . 133 1110 76.00 . . . 0.3780 . 0.3496 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.2433 3.3904 . . 126 1229 84.00 . . . 0.3819 . 0.3204 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.3904 3.5686 . . 133 1348 88.00 . . . 0.3386 . 0.3351 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.5686 3.7913 . . 144 1340 91.00 . . . 0.2697 . 0.2834 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7913 4.0826 . . 165 1322 91.00 . . . 0.2900 . 0.2663 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.0826 4.4909 . . 156 1420 96.00 . . . 0.3070 . 0.2315 . . . . . . . . . . 'X-RAY DIFFRACTION' 4.4909 5.1347 . . 168 1407 95.00 . . . 0.2977 . 0.2351 . . . . . . . . . . 'X-RAY DIFFRACTION' 5.1347 6.4466 . . 154 1414 95.00 . . . 0.3810 . 0.2810 . . . . . . . . . . 'X-RAY DIFFRACTION' 6.4466 23.3810 . . 136 1280 86.00 . . . 0.2093 . 0.1878 . . . . . . . . . . # _struct.entry_id 5AYH _struct.title 'Structure of the entire dynein stalk region' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag ? # _struct_keywords.entry_id 5AYH _struct_keywords.text 'Microtubule, MOTOR PROTEIN' _struct_keywords.pdbx_keywords 'MOTOR PROTEIN' # _struct_asym.id A _struct_asym.pdbx_blank_PDB_chainid_flag N _struct_asym.pdbx_modified N _struct_asym.entity_id 1 _struct_asym.details ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 LEU A 15 ? ASP A 76 ? LEU A 3220 ASP A 3281 1 ? 62 HELX_P HELX_P2 AA2 VAL A 78 ? SER A 91 ? VAL A 3283 SER A 3296 1 ? 14 HELX_P HELX_P3 AA3 LYS A 93 ? SER A 102 ? LYS A 3298 SER A 3307 1 ? 10 HELX_P HELX_P4 AA4 PRO A 107 ? LEU A 121 ? PRO A 3312 LEU A 3326 1 ? 15 HELX_P HELX_P5 AA5 ASP A 127 ? MET A 136 ? ASP A 3332 MET A 3341 1 ? 10 HELX_P HELX_P6 AA6 ASN A 139 ? ASN A 146 ? ASN A 3344 ASN A 3351 1 ? 8 HELX_P HELX_P7 AA7 SER A 153 ? TYR A 164 ? SER A 3358 TYR A 3369 1 ? 12 HELX_P HELX_P8 AA8 ASN A 171 ? SER A 179 ? ASN A 3376 SER A 3384 1 ? 9 HELX_P HELX_P9 AA9 ALA A 181 ? GLU A 250 ? ALA A 3386 GLU A 3455 1 ? 70 HELX_P HELX_P10 AB1 GLN A 252 ? ARG A 267 ? GLN A 3457 ARG A 3472 1 ? 16 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # _atom_sites.entry_id 5AYH _atom_sites.fract_transf_matrix[1][1] 0.009678 _atom_sites.fract_transf_matrix[1][2] 0.005588 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011175 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.014345 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 MET 1 3206 ? ? ? A . n A 1 2 LYS 2 3207 ? ? ? A . n A 1 3 GLU 3 3208 ? ? ? A . n A 1 4 THR 4 3209 ? ? ? A . n A 1 5 VAL 5 3210 ? ? ? A . n A 1 6 ASP 6 3211 ? ? ? A . n A 1 7 GLN 7 3212 ? ? ? A . n A 1 8 VAL 8 3213 ? ? ? A . n A 1 9 GLU 9 3214 ? ? ? A . n A 1 10 GLU 10 3215 ? ? ? A . n A 1 11 LEU 11 3216 ? ? ? A . n A 1 12 ARG 12 3217 ? ? ? A . n A 1 13 ARG 13 3218 ? ? ? A . n A 1 14 ASP 14 3219 3219 ASP ASP A . n A 1 15 LEU 15 3220 3220 LEU LEU A . n A 1 16 ARG 16 3221 3221 ARG ARG A . n A 1 17 ILE 17 3222 3222 ILE ILE A . n A 1 18 LYS 18 3223 3223 LYS LYS A . n A 1 19 SER 19 3224 3224 SER SER A . n A 1 20 GLN 20 3225 3225 GLN GLN A . n A 1 21 GLU 21 3226 3226 GLU GLU A . n A 1 22 LEU 22 3227 3227 LEU LEU A . n A 1 23 GLU 23 3228 3228 GLU GLU A . n A 1 24 VAL 24 3229 3229 VAL VAL A . n A 1 25 LYS 25 3230 3230 LYS LYS A . n A 1 26 ASN 26 3231 3231 ASN ASN A . n A 1 27 ALA 27 3232 3232 ALA ALA A . n A 1 28 ALA 28 3233 3233 ALA ALA A . n A 1 29 ALA 29 3234 3234 ALA ALA A . n A 1 30 ASN 30 3235 3235 ASN ASN A . n A 1 31 ASP 31 3236 3236 ASP ASP A . n A 1 32 LYS 32 3237 3237 LYS LYS A . n A 1 33 LEU 33 3238 3238 LEU LEU A . n A 1 34 LYS 34 3239 3239 LYS LYS A . n A 1 35 LYS 35 3240 3240 LYS LYS A . n A 1 36 MET 36 3241 3241 MET MET A . n A 1 37 VAL 37 3242 3242 VAL VAL A . n A 1 38 LYS 38 3243 3243 LYS LYS A . n A 1 39 ASP 39 3244 3244 ASP ASP A . n A 1 40 GLN 40 3245 3245 GLN GLN A . n A 1 41 GLN 41 3246 3246 GLN GLN A . n A 1 42 GLU 42 3247 3247 GLU GLU A . n A 1 43 ALA 43 3248 3248 ALA ALA A . n A 1 44 GLU 44 3249 3249 GLU GLU A . n A 1 45 LYS 45 3250 3250 LYS LYS A . n A 1 46 LYS 46 3251 3251 LYS LYS A . n A 1 47 LYS 47 3252 3252 LYS LYS A . n A 1 48 VAL 48 3253 3253 VAL VAL A . n A 1 49 MET 49 3254 3254 MET MET A . n A 1 50 SER 50 3255 3255 SER SER A . n A 1 51 GLN 51 3256 3256 GLN GLN A . n A 1 52 GLU 52 3257 3257 GLU GLU A . n A 1 53 ILE 53 3258 3258 ILE ILE A . n A 1 54 GLN 54 3259 3259 GLN GLN A . n A 1 55 GLU 55 3260 3260 GLU GLU A . n A 1 56 GLN 56 3261 3261 GLN GLN A . n A 1 57 LEU 57 3262 3262 LEU LEU A . n A 1 58 HIS 58 3263 3263 HIS HIS A . n A 1 59 LYS 59 3264 3264 LYS LYS A . n A 1 60 GLN 60 3265 3265 GLN GLN A . n A 1 61 GLN 61 3266 3266 GLN GLN A . n A 1 62 GLU 62 3267 3267 GLU GLU A . n A 1 63 VAL 63 3268 3268 VAL VAL A . n A 1 64 ILE 64 3269 3269 ILE ILE A . n A 1 65 ALA 65 3270 3270 ALA ALA A . n A 1 66 ASP 66 3271 3271 ASP ASP A . n A 1 67 LYS 67 3272 3272 LYS LYS A . n A 1 68 GLN 68 3273 3273 GLN GLN A . n A 1 69 MET 69 3274 3274 MET MET A . n A 1 70 SER 70 3275 3275 SER SER A . n A 1 71 VAL 71 3276 3276 VAL VAL A . n A 1 72 LYS 72 3277 3277 LYS LYS A . n A 1 73 GLU 73 3278 3278 GLU GLU A . n A 1 74 ASP 74 3279 3279 ASP ASP A . n A 1 75 LEU 75 3280 3280 LEU LEU A . n A 1 76 ASP 76 3281 3281 ASP ASP A . n A 1 77 LYS 77 3282 3282 LYS LYS A . n A 1 78 VAL 78 3283 3283 VAL VAL A . n A 1 79 GLU 79 3284 3284 GLU GLU A . n A 1 80 PRO 80 3285 3285 PRO PRO A . n A 1 81 ALA 81 3286 3286 ALA ALA A . n A 1 82 VAL 82 3287 3287 VAL VAL A . n A 1 83 ILE 83 3288 3288 ILE ILE A . n A 1 84 GLU 84 3289 3289 GLU GLU A . n A 1 85 ALA 85 3290 3290 ALA ALA A . n A 1 86 GLN 86 3291 3291 GLN GLN A . n A 1 87 ASN 87 3292 3292 ASN ASN A . n A 1 88 ALA 88 3293 3293 ALA ALA A . n A 1 89 VAL 89 3294 3294 VAL VAL A . n A 1 90 LYS 90 3295 3295 LYS LYS A . n A 1 91 SER 91 3296 3296 SER SER A . n A 1 92 ILE 92 3297 3297 ILE ILE A . n A 1 93 LYS 93 3298 3298 LYS LYS A . n A 1 94 LYS 94 3299 3299 LYS LYS A . n A 1 95 GLN 95 3300 3300 GLN GLN A . n A 1 96 HIS 96 3301 3301 HIS HIS A . n A 1 97 LEU 97 3302 3302 LEU LEU A . n A 1 98 VAL 98 3303 3303 VAL VAL A . n A 1 99 GLU 99 3304 3304 GLU GLU A . n A 1 100 VAL 100 3305 3305 VAL VAL A . n A 1 101 ARG 101 3306 3306 ARG ARG A . n A 1 102 SER 102 3307 3307 SER SER A . n A 1 103 MET 103 3308 3308 MET MET A . n A 1 104 ALA 104 3309 3309 ALA ALA A . n A 1 105 ASN 105 3310 3310 ASN ASN A . n A 1 106 PRO 106 3311 3311 PRO PRO A . n A 1 107 PRO 107 3312 3312 PRO PRO A . n A 1 108 ALA 108 3313 3313 ALA ALA A . n A 1 109 ALA 109 3314 3314 ALA ALA A . n A 1 110 VAL 110 3315 3315 VAL VAL A . n A 1 111 LYS 111 3316 3316 LYS LYS A . n A 1 112 LEU 112 3317 3317 LEU LEU A . n A 1 113 ALA 113 3318 3318 ALA ALA A . n A 1 114 LEU 114 3319 3319 LEU LEU A . n A 1 115 GLU 115 3320 3320 GLU GLU A . n A 1 116 SER 116 3321 3321 SER SER A . n A 1 117 ILE 117 3322 3322 ILE ILE A . n A 1 118 CYS 118 3323 3323 CYS CYS A . n A 1 119 LEU 119 3324 3324 LEU LEU A . n A 1 120 LEU 120 3325 3325 LEU LEU A . n A 1 121 LEU 121 3326 3326 LEU LEU A . n A 1 122 GLY 122 3327 3327 GLY GLY A . n A 1 123 GLU 123 3328 3328 GLU GLU A . n A 1 124 SER 124 3329 3329 SER SER A . n A 1 125 THR 125 3330 3330 THR THR A . n A 1 126 THR 126 3331 3331 THR THR A . n A 1 127 ASP 127 3332 3332 ASP ASP A . n A 1 128 TRP 128 3333 3333 TRP TRP A . n A 1 129 LYS 129 3334 3334 LYS LYS A . n A 1 130 GLN 130 3335 3335 GLN GLN A . n A 1 131 ILE 131 3336 3336 ILE ILE A . n A 1 132 ARG 132 3337 3337 ARG ARG A . n A 1 133 SER 133 3338 3338 SER SER A . n A 1 134 ILE 134 3339 3339 ILE ILE A . n A 1 135 ILE 135 3340 3340 ILE ILE A . n A 1 136 MET 136 3341 3341 MET MET A . n A 1 137 ARG 137 3342 3342 ARG ARG A . n A 1 138 GLU 138 3343 3343 GLU GLU A . n A 1 139 ASN 139 3344 3344 ASN ASN A . n A 1 140 PHE 140 3345 3345 PHE PHE A . n A 1 141 ILE 141 3346 3346 ILE ILE A . n A 1 142 PRO 142 3347 3347 PRO PRO A . n A 1 143 THR 143 3348 3348 THR THR A . n A 1 144 ILE 144 3349 3349 ILE ILE A . n A 1 145 VAL 145 3350 3350 VAL VAL A . n A 1 146 ASN 146 3351 3351 ASN ASN A . n A 1 147 PHE 147 3352 3352 PHE PHE A . n A 1 148 SER 148 3353 3353 SER SER A . n A 1 149 ALA 149 3354 3354 ALA ALA A . n A 1 150 GLU 150 3355 3355 GLU GLU A . n A 1 151 GLU 151 3356 3356 GLU GLU A . n A 1 152 ILE 152 3357 3357 ILE ILE A . n A 1 153 SER 153 3358 3358 SER SER A . n A 1 154 ASP 154 3359 3359 ASP ASP A . n A 1 155 ALA 155 3360 3360 ALA ALA A . n A 1 156 ILE 156 3361 3361 ILE ILE A . n A 1 157 ARG 157 3362 3362 ARG ARG A . n A 1 158 GLU 158 3363 3363 GLU GLU A . n A 1 159 LYS 159 3364 3364 LYS LYS A . n A 1 160 MET 160 3365 3365 MET MET A . n A 1 161 LYS 161 3366 3366 LYS LYS A . n A 1 162 LYS 162 3367 3367 LYS LYS A . n A 1 163 ASN 163 3368 3368 ASN ASN A . n A 1 164 TYR 164 3369 3369 TYR TYR A . n A 1 165 MET 165 3370 3370 MET MET A . n A 1 166 SER 166 3371 3371 SER SER A . n A 1 167 ASN 167 3372 3372 ASN ASN A . n A 1 168 PRO 168 3373 3373 PRO PRO A . n A 1 169 SER 169 3374 3374 SER SER A . n A 1 170 TYR 170 3375 3375 TYR TYR A . n A 1 171 ASN 171 3376 3376 ASN ASN A . n A 1 172 TYR 172 3377 3377 TYR TYR A . n A 1 173 GLU 173 3378 3378 GLU GLU A . n A 1 174 ILE 174 3379 3379 ILE ILE A . n A 1 175 VAL 175 3380 3380 VAL VAL A . n A 1 176 ASN 176 3381 3381 ASN ASN A . n A 1 177 ARG 177 3382 3382 ARG ARG A . n A 1 178 ALA 178 3383 3383 ALA ALA A . n A 1 179 SER 179 3384 3384 SER SER A . n A 1 180 LEU 180 3385 3385 LEU LEU A . n A 1 181 ALA 181 3386 3386 ALA ALA A . n A 1 182 CYS 182 3387 3387 CYS CYS A . n A 1 183 GLY 183 3388 3388 GLY GLY A . n A 1 184 PRO 184 3389 3389 PRO PRO A . n A 1 185 MET 185 3390 3390 MET MET A . n A 1 186 VAL 186 3391 3391 VAL VAL A . n A 1 187 LYS 187 3392 3392 LYS LYS A . n A 1 188 TRP 188 3393 3393 TRP TRP A . n A 1 189 ALA 189 3394 3394 ALA ALA A . n A 1 190 ILE 190 3395 3395 ILE ILE A . n A 1 191 ALA 191 3396 3396 ALA ALA A . n A 1 192 GLN 192 3397 3397 GLN GLN A . n A 1 193 LEU 193 3398 3398 LEU LEU A . n A 1 194 ASN 194 3399 3399 ASN ASN A . n A 1 195 TYR 195 3400 3400 TYR TYR A . n A 1 196 ALA 196 3401 3401 ALA ALA A . n A 1 197 ASP 197 3402 3402 ASP ASP A . n A 1 198 MET 198 3403 3403 MET MET A . n A 1 199 LEU 199 3404 3404 LEU LEU A . n A 1 200 LYS 200 3405 3405 LYS LYS A . n A 1 201 ARG 201 3406 3406 ARG ARG A . n A 1 202 VAL 202 3407 3407 VAL VAL A . n A 1 203 GLU 203 3408 3408 GLU GLU A . n A 1 204 PRO 204 3409 3409 PRO PRO A . n A 1 205 LEU 205 3410 3410 LEU LEU A . n A 1 206 ARG 206 3411 3411 ARG ARG A . n A 1 207 ASN 207 3412 3412 ASN ASN A . n A 1 208 GLU 208 3413 3413 GLU GLU A . n A 1 209 LEU 209 3414 3414 LEU LEU A . n A 1 210 GLN 210 3415 3415 GLN GLN A . n A 1 211 LYS 211 3416 3416 LYS LYS A . n A 1 212 LEU 212 3417 3417 LEU LEU A . n A 1 213 GLU 213 3418 3418 GLU GLU A . n A 1 214 ASP 214 3419 3419 ASP ASP A . n A 1 215 ASP 215 3420 3420 ASP ASP A . n A 1 216 ALA 216 3421 3421 ALA ALA A . n A 1 217 LYS 217 3422 3422 LYS LYS A . n A 1 218 ASP 218 3423 3423 ASP ASP A . n A 1 219 ASN 219 3424 3424 ASN ASN A . n A 1 220 GLN 220 3425 3425 GLN GLN A . n A 1 221 GLN 221 3426 3426 GLN GLN A . n A 1 222 LYS 222 3427 3427 LYS LYS A . n A 1 223 ALA 223 3428 3428 ALA ALA A . n A 1 224 ASN 224 3429 3429 ASN ASN A . n A 1 225 GLU 225 3430 3430 GLU GLU A . n A 1 226 VAL 226 3431 3431 VAL VAL A . n A 1 227 GLU 227 3432 3432 GLU GLU A . n A 1 228 GLN 228 3433 3433 GLN GLN A . n A 1 229 MET 229 3434 3434 MET MET A . n A 1 230 ILE 230 3435 3435 ILE ILE A . n A 1 231 ARG 231 3436 3436 ARG ARG A . n A 1 232 ASP 232 3437 3437 ASP ASP A . n A 1 233 LEU 233 3438 3438 LEU LEU A . n A 1 234 GLU 234 3439 3439 GLU GLU A . n A 1 235 ALA 235 3440 3440 ALA ALA A . n A 1 236 SER 236 3441 3441 SER SER A . n A 1 237 ILE 237 3442 3442 ILE ILE A . n A 1 238 ALA 238 3443 3443 ALA ALA A . n A 1 239 ARG 239 3444 3444 ARG ARG A . n A 1 240 TYR 240 3445 3445 TYR TYR A . n A 1 241 LYS 241 3446 3446 LYS LYS A . n A 1 242 GLU 242 3447 3447 GLU GLU A . n A 1 243 GLU 243 3448 3448 GLU GLU A . n A 1 244 TYR 244 3449 3449 TYR TYR A . n A 1 245 ALA 245 3450 3450 ALA ALA A . n A 1 246 VAL 246 3451 3451 VAL VAL A . n A 1 247 LEU 247 3452 3452 LEU LEU A . n A 1 248 ILE 248 3453 3453 ILE ILE A . n A 1 249 SER 249 3454 3454 SER SER A . n A 1 250 GLU 250 3455 3455 GLU GLU A . n A 1 251 ALA 251 3456 3456 ALA ALA A . n A 1 252 GLN 252 3457 3457 GLN GLN A . n A 1 253 ALA 253 3458 3458 ALA ALA A . n A 1 254 ILE 254 3459 3459 ILE ILE A . n A 1 255 LYS 255 3460 3460 LYS LYS A . n A 1 256 ALA 256 3461 3461 ALA ALA A . n A 1 257 ASP 257 3462 3462 ASP ASP A . n A 1 258 LEU 258 3463 3463 LEU LEU A . n A 1 259 ALA 259 3464 3464 ALA ALA A . n A 1 260 ALA 260 3465 3465 ALA ALA A . n A 1 261 VAL 261 3466 3466 VAL VAL A . n A 1 262 GLU 262 3467 3467 GLU GLU A . n A 1 263 ALA 263 3468 3468 ALA ALA A . n A 1 264 LYS 264 3469 3469 LYS LYS A . n A 1 265 VAL 265 3470 3470 VAL VAL A . n A 1 266 ASN 266 3471 3471 ASN ASN A . n A 1 267 ARG 267 3472 3472 ARG ARG A . n A 1 268 SER 268 3473 ? ? ? A . n A 1 269 THR 269 3474 ? ? ? A . n A 1 270 ALA 270 3475 ? ? ? A . n A 1 271 HIS 271 3476 ? ? ? A . n A 1 272 HIS 272 3477 ? ? ? A . n A 1 273 HIS 273 3478 ? ? ? A . n A 1 274 HIS 274 3479 ? ? ? A . n A 1 275 HIS 275 3480 ? ? ? A . n A 1 276 HIS 276 3481 ? ? ? A . n # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_defined_assembly _pdbx_struct_assembly.method_details ? _pdbx_struct_assembly.oligomeric_details monomeric _pdbx_struct_assembly.oligomeric_count 1 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 0 ? 1 MORE 0 ? 1 'SSA (A^2)' 15670 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2015-12-16 2 'Structure model' 1 1 2016-05-18 3 'Structure model' 1 2 2020-02-26 4 'Structure model' 1 3 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' 4 3 'Structure model' 'Derived calculations' 5 4 'Structure model' 'Data collection' 6 4 'Structure model' 'Database references' 7 4 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' citation 2 3 'Structure model' diffrn_source 3 3 'Structure model' pdbx_struct_oper_list 4 4 'Structure model' chem_comp_atom 5 4 'Structure model' chem_comp_bond 6 4 'Structure model' database_2 7 4 'Structure model' pdbx_initial_refinement_model # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_citation.journal_id_CSD' 2 3 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 3 3 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 4 4 'Structure model' '_database_2.pdbx_DOI' 5 4 'Structure model' '_database_2.pdbx_database_accession' # loop_ _pdbx_refine_tls.id _pdbx_refine_tls.pdbx_refine_id _pdbx_refine_tls.details _pdbx_refine_tls.method _pdbx_refine_tls.origin_x _pdbx_refine_tls.origin_y _pdbx_refine_tls.origin_z _pdbx_refine_tls.T[1][1] _pdbx_refine_tls.T[1][1]_esd _pdbx_refine_tls.T[1][2] _pdbx_refine_tls.T[1][2]_esd _pdbx_refine_tls.T[1][3] _pdbx_refine_tls.T[1][3]_esd _pdbx_refine_tls.T[2][2] _pdbx_refine_tls.T[2][2]_esd _pdbx_refine_tls.T[2][3] _pdbx_refine_tls.T[2][3]_esd _pdbx_refine_tls.T[3][3] _pdbx_refine_tls.T[3][3]_esd _pdbx_refine_tls.L[1][1] _pdbx_refine_tls.L[1][1]_esd _pdbx_refine_tls.L[1][2] _pdbx_refine_tls.L[1][2]_esd _pdbx_refine_tls.L[1][3] _pdbx_refine_tls.L[1][3]_esd _pdbx_refine_tls.L[2][2] _pdbx_refine_tls.L[2][2]_esd _pdbx_refine_tls.L[2][3] _pdbx_refine_tls.L[2][3]_esd _pdbx_refine_tls.L[3][3] _pdbx_refine_tls.L[3][3]_esd _pdbx_refine_tls.S[1][1] _pdbx_refine_tls.S[1][1]_esd _pdbx_refine_tls.S[1][2] _pdbx_refine_tls.S[1][2]_esd _pdbx_refine_tls.S[1][3] _pdbx_refine_tls.S[1][3]_esd _pdbx_refine_tls.S[2][1] _pdbx_refine_tls.S[2][1]_esd _pdbx_refine_tls.S[2][2] _pdbx_refine_tls.S[2][2]_esd _pdbx_refine_tls.S[2][3] _pdbx_refine_tls.S[2][3]_esd _pdbx_refine_tls.S[3][1] _pdbx_refine_tls.S[3][1]_esd _pdbx_refine_tls.S[3][2] _pdbx_refine_tls.S[3][2]_esd _pdbx_refine_tls.S[3][3] _pdbx_refine_tls.S[3][3]_esd 1 'X-RAY DIFFRACTION' ? refined 182.3963 63.6125 72.3820 0.1064 ? 0.1180 ? 0.1545 ? 2.5618 ? -0.6315 ? 1.9300 ? 1.0811 ? -0.8977 ? 1.2454 ? 1.9932 ? -0.6992 ? 1.5224 ? 0.0824 ? 1.5120 ? 0.7479 ? -0.6666 ? 0.4490 ? -1.1274 ? 0.4659 ? 1.5193 ? 0.3356 ? 2 'X-RAY DIFFRACTION' ? refined 141.7453 77.7587 82.7482 0.7173 ? -0.0653 ? 0.1321 ? 0.6993 ? -0.0584 ? 0.5903 ? 8.6913 ? -5.2166 ? -3.0806 ? 3.4414 ? 1.7496 ? 6.3933 ? 0.2628 ? -2.0743 ? 0.5641 ? 0.2343 ? 0.6438 ? 0.1443 ? -1.1432 ? 0.5218 ? -0.6877 ? 3 'X-RAY DIFFRACTION' ? refined 89.5591 87.3137 73.1052 0.5853 ? -0.0133 ? 0.1545 ? 0.7283 ? -0.0578 ? 0.7902 ? 9.9174 ? 1.5418 ? -0.0191 ? 2.5551 ? 0.7300 ? 3.4960 ? -0.3081 ? 1.0371 ? -0.6124 ? -0.5569 ? 0.0878 ? -0.3131 ? 0.4146 ? 0.0717 ? 0.3024 ? 4 'X-RAY DIFFRACTION' ? refined 99.0840 91.1523 80.8969 0.6778 ? 0.1964 ? 0.0778 ? 1.0107 ? 0.0092 ? 0.8540 ? 3.1065 ? -0.2454 ? -2.5787 ? 0.7642 ? 0.9670 ? 2.6253 ? -0.7061 ? -0.9473 ? 1.4754 ? 0.1915 ? 0.5349 ? 0.2134 ? 0.2641 ? 0.0145 ? 0.1132 ? 5 'X-RAY DIFFRACTION' ? refined 150.6686 69.4748 75.0761 0.3100 ? -0.1044 ? 0.0260 ? 0.5924 ? -0.1293 ? 0.3460 ? 4.1709 ? -2.5052 ? 1.7146 ? 7.0155 ? 0.0675 ? 6.1836 ? 1.0077 ? 0.6634 ? -0.4557 ? -0.4570 ? -0.0123 ? -0.0292 ? -0.2136 ? 0.9364 ? -0.4534 ? 6 'X-RAY DIFFRACTION' ? refined 187.6319 51.5024 79.9325 1.4738 ? 1.2200 ? 0.1307 ? 3.5986 ? -0.0968 ? 1.1885 ? 1.1669 ? 1.7508 ? -0.7181 ? 2.6540 ? -1.0754 ? 0.4424 ? -0.8798 ? -1.4486 ? -1.2741 ? -0.0581 ? -0.9174 ? -0.6967 ? 1.4758 ? 1.5829 ? 0.0230 ? # loop_ _pdbx_refine_tls_group.id _pdbx_refine_tls_group.pdbx_refine_id _pdbx_refine_tls_group.refine_tls_id _pdbx_refine_tls_group.beg_label_asym_id _pdbx_refine_tls_group.beg_label_seq_id _pdbx_refine_tls_group.beg_auth_asym_id _pdbx_refine_tls_group.beg_auth_seq_id _pdbx_refine_tls_group.end_label_asym_id _pdbx_refine_tls_group.end_label_seq_id _pdbx_refine_tls_group.end_auth_asym_id _pdbx_refine_tls_group.end_auth_seq_id _pdbx_refine_tls_group.selection _pdbx_refine_tls_group.selection_details 1 'X-RAY DIFFRACTION' 1 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 3219 through 3237 ) ; 2 'X-RAY DIFFRACTION' 2 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 3238 through 3277 ) ; 3 'X-RAY DIFFRACTION' 3 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 3278 through 3357 ) ; 4 'X-RAY DIFFRACTION' 4 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 3358 through 3417 ) ; 5 'X-RAY DIFFRACTION' 5 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 3418 through 3453 ) ; 6 'X-RAY DIFFRACTION' 6 ? ? ? ? ? ? ? ? ? ;chain 'A' and (resid 3454 through 3472 ) ; # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(phenix.refine: 1.9_1692)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHASER ? ? ? . 4 ? 'model building' ? ? ? ? ? ? ? ? ? ? ? Coot ? ? ? . 5 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 LEU A 3220 ? ? -106.09 55.95 2 1 GLU A 3328 ? ? -63.76 69.21 3 1 THR A 3330 ? ? -101.66 -166.07 4 1 THR A 3331 ? ? -154.21 4.93 5 1 GLU A 3343 ? ? 59.82 19.55 6 1 TYR A 3369 ? ? -91.71 -78.23 # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ASP 3219 ? CG ? A ASP 14 CG 2 1 Y 1 A ASP 3219 ? OD1 ? A ASP 14 OD1 3 1 Y 1 A ASP 3219 ? OD2 ? A ASP 14 OD2 4 1 Y 1 A ARG 3221 ? CG ? A ARG 16 CG 5 1 Y 1 A ARG 3221 ? CD ? A ARG 16 CD 6 1 Y 1 A ARG 3221 ? NE ? A ARG 16 NE 7 1 Y 1 A ARG 3221 ? CZ ? A ARG 16 CZ 8 1 Y 1 A ARG 3221 ? NH1 ? A ARG 16 NH1 9 1 Y 1 A ARG 3221 ? NH2 ? A ARG 16 NH2 10 1 Y 1 A GLU 3226 ? CG ? A GLU 21 CG 11 1 Y 1 A GLU 3226 ? CD ? A GLU 21 CD 12 1 Y 1 A GLU 3226 ? OE1 ? A GLU 21 OE1 13 1 Y 1 A GLU 3226 ? OE2 ? A GLU 21 OE2 14 1 Y 1 A GLU 3228 ? CG ? A GLU 23 CG 15 1 Y 1 A GLU 3228 ? CD ? A GLU 23 CD 16 1 Y 1 A GLU 3228 ? OE1 ? A GLU 23 OE1 17 1 Y 1 A GLU 3228 ? OE2 ? A GLU 23 OE2 18 1 Y 1 A LYS 3230 ? CD ? A LYS 25 CD 19 1 Y 1 A LYS 3230 ? CE ? A LYS 25 CE 20 1 Y 1 A LYS 3230 ? NZ ? A LYS 25 NZ 21 1 Y 1 A LYS 3239 ? CD ? A LYS 34 CD 22 1 Y 1 A LYS 3239 ? CE ? A LYS 34 CE 23 1 Y 1 A LYS 3239 ? NZ ? A LYS 34 NZ 24 1 Y 1 A VAL 3242 ? CG1 ? A VAL 37 CG1 25 1 Y 1 A VAL 3242 ? CG2 ? A VAL 37 CG2 26 1 Y 1 A LYS 3243 ? CG ? A LYS 38 CG 27 1 Y 1 A LYS 3243 ? CD ? A LYS 38 CD 28 1 Y 1 A LYS 3243 ? CE ? A LYS 38 CE 29 1 Y 1 A LYS 3243 ? NZ ? A LYS 38 NZ 30 1 Y 1 A GLN 3246 ? CD ? A GLN 41 CD 31 1 Y 1 A GLN 3246 ? OE1 ? A GLN 41 OE1 32 1 Y 1 A GLN 3246 ? NE2 ? A GLN 41 NE2 33 1 Y 1 A LEU 3262 ? CD1 ? A LEU 57 CD1 34 1 Y 1 A LEU 3280 ? CG ? A LEU 75 CG 35 1 Y 1 A LEU 3280 ? CD1 ? A LEU 75 CD1 36 1 Y 1 A LEU 3280 ? CD2 ? A LEU 75 CD2 37 1 Y 1 A LYS 3282 ? CD ? A LYS 77 CD 38 1 Y 1 A LYS 3282 ? CE ? A LYS 77 CE 39 1 Y 1 A LYS 3282 ? NZ ? A LYS 77 NZ 40 1 Y 1 A LYS 3299 ? CE ? A LYS 94 CE 41 1 Y 1 A LYS 3299 ? NZ ? A LYS 94 NZ 42 1 Y 1 A GLN 3300 ? CG ? A GLN 95 CG 43 1 Y 1 A GLN 3300 ? CD ? A GLN 95 CD 44 1 Y 1 A GLN 3300 ? OE1 ? A GLN 95 OE1 45 1 Y 1 A GLN 3300 ? NE2 ? A GLN 95 NE2 46 1 Y 1 A ARG 3306 ? NH1 ? A ARG 101 NH1 47 1 Y 1 A ARG 3306 ? NH2 ? A ARG 101 NH2 48 1 Y 1 A LYS 3316 ? CG ? A LYS 111 CG 49 1 Y 1 A LYS 3316 ? CD ? A LYS 111 CD 50 1 Y 1 A LYS 3316 ? CE ? A LYS 111 CE 51 1 Y 1 A LYS 3316 ? NZ ? A LYS 111 NZ 52 1 Y 1 A ILE 3339 ? CG1 ? A ILE 134 CG1 53 1 Y 1 A ILE 3339 ? CD1 ? A ILE 134 CD1 54 1 Y 1 A ILE 3340 ? CG1 ? A ILE 135 CG1 55 1 Y 1 A ILE 3340 ? CG2 ? A ILE 135 CG2 56 1 Y 1 A ILE 3340 ? CD1 ? A ILE 135 CD1 57 1 Y 1 A GLU 3343 ? CG ? A GLU 138 CG 58 1 Y 1 A GLU 3343 ? CD ? A GLU 138 CD 59 1 Y 1 A GLU 3343 ? OE1 ? A GLU 138 OE1 60 1 Y 1 A GLU 3343 ? OE2 ? A GLU 138 OE2 61 1 Y 1 A ILE 3357 ? CG1 ? A ILE 152 CG1 62 1 Y 1 A ILE 3357 ? CG2 ? A ILE 152 CG2 63 1 Y 1 A ILE 3357 ? CD1 ? A ILE 152 CD1 64 1 Y 1 A ARG 3362 ? CG ? A ARG 157 CG 65 1 Y 1 A ARG 3362 ? CD ? A ARG 157 CD 66 1 Y 1 A ARG 3362 ? NE ? A ARG 157 NE 67 1 Y 1 A ARG 3362 ? CZ ? A ARG 157 CZ 68 1 Y 1 A ARG 3362 ? NH1 ? A ARG 157 NH1 69 1 Y 1 A ARG 3362 ? NH2 ? A ARG 157 NH2 70 1 Y 1 A VAL 3391 ? CG2 ? A VAL 186 CG2 71 1 Y 1 A LYS 3392 ? CE ? A LYS 187 CE 72 1 Y 1 A LYS 3392 ? NZ ? A LYS 187 NZ 73 1 Y 1 A LYS 3405 ? CG ? A LYS 200 CG 74 1 Y 1 A LYS 3405 ? CD ? A LYS 200 CD 75 1 Y 1 A LYS 3405 ? CE ? A LYS 200 CE 76 1 Y 1 A LYS 3405 ? NZ ? A LYS 200 NZ 77 1 Y 1 A ILE 3435 ? CD1 ? A ILE 230 CD1 78 1 Y 1 A SER 3454 ? OG ? A SER 249 OG 79 1 Y 1 A LYS 3460 ? CD ? A LYS 255 CD 80 1 Y 1 A LYS 3460 ? CE ? A LYS 255 CE 81 1 Y 1 A LYS 3460 ? NZ ? A LYS 255 NZ 82 1 Y 1 A ASP 3462 ? CG ? A ASP 257 CG 83 1 Y 1 A ASP 3462 ? OD1 ? A ASP 257 OD1 84 1 Y 1 A ASP 3462 ? OD2 ? A ASP 257 OD2 85 1 Y 1 A GLU 3467 ? CG ? A GLU 262 CG 86 1 Y 1 A GLU 3467 ? CD ? A GLU 262 CD 87 1 Y 1 A GLU 3467 ? OE1 ? A GLU 262 OE1 88 1 Y 1 A GLU 3467 ? OE2 ? A GLU 262 OE2 89 1 Y 1 A LYS 3469 ? CG ? A LYS 264 CG 90 1 Y 1 A LYS 3469 ? CD ? A LYS 264 CD 91 1 Y 1 A LYS 3469 ? CE ? A LYS 264 CE 92 1 Y 1 A LYS 3469 ? NZ ? A LYS 264 NZ 93 1 Y 1 A ASN 3471 ? CG ? A ASN 266 CG 94 1 Y 1 A ASN 3471 ? OD1 ? A ASN 266 OD1 95 1 Y 1 A ASN 3471 ? ND2 ? A ASN 266 ND2 96 1 Y 1 A ARG 3472 ? CG ? A ARG 267 CG 97 1 Y 1 A ARG 3472 ? CD ? A ARG 267 CD 98 1 Y 1 A ARG 3472 ? NE ? A ARG 267 NE 99 1 Y 1 A ARG 3472 ? CZ ? A ARG 267 CZ 100 1 Y 1 A ARG 3472 ? NH1 ? A ARG 267 NH1 101 1 Y 1 A ARG 3472 ? NH2 ? A ARG 267 NH2 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A MET 3206 ? A MET 1 2 1 Y 1 A LYS 3207 ? A LYS 2 3 1 Y 1 A GLU 3208 ? A GLU 3 4 1 Y 1 A THR 3209 ? A THR 4 5 1 Y 1 A VAL 3210 ? A VAL 5 6 1 Y 1 A ASP 3211 ? A ASP 6 7 1 Y 1 A GLN 3212 ? A GLN 7 8 1 Y 1 A VAL 3213 ? A VAL 8 9 1 Y 1 A GLU 3214 ? A GLU 9 10 1 Y 1 A GLU 3215 ? A GLU 10 11 1 Y 1 A LEU 3216 ? A LEU 11 12 1 Y 1 A ARG 3217 ? A ARG 12 13 1 Y 1 A ARG 3218 ? A ARG 13 14 1 Y 1 A SER 3473 ? A SER 268 15 1 Y 1 A THR 3474 ? A THR 269 16 1 Y 1 A ALA 3475 ? A ALA 270 17 1 Y 1 A HIS 3476 ? A HIS 271 18 1 Y 1 A HIS 3477 ? A HIS 272 19 1 Y 1 A HIS 3478 ? A HIS 273 20 1 Y 1 A HIS 3479 ? A HIS 274 21 1 Y 1 A HIS 3480 ? A HIS 275 22 1 Y 1 A HIS 3481 ? A HIS 276 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_audit_support.funding_organization JSPS _pdbx_audit_support.country Japan _pdbx_audit_support.grant_number 26291014 _pdbx_audit_support.ordinal 1 # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 3WUQ _pdbx_initial_refinement_model.details ? #