data_5B5I # _entry.id 5B5I # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.321 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code PDB 5B5I WWPDB D_1300000560 # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5B5I _pdbx_database_status.recvd_initial_deposition_date 2016-05-10 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Tsutsui, N.' 1 'Nagata, K.' 2 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'FEBS J.' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 1742-4658 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 283 _citation.language ? _citation.page_first 4325 _citation.page_last 4339 _citation.title ;Crystal structure of a crustacean hyperglycemic hormone (CHH) precursor suggests structural variety in the C-terminal regions of CHH superfamily members. ; _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1111/febs.13926 _citation.pdbx_database_id_PubMed 27743429 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Tsutsui, N.' 1 ? primary 'Sakamoto, T.' 2 ? primary 'Arisaka, F.' 3 ? primary 'Tanokura, M.' 4 ? primary 'Nagasawa, H.' 5 ? primary 'Nagata, K.' 6 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 90.00 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5B5I _cell.details ? _cell.formula_units_Z ? _cell.length_a 38.679 _cell.length_a_esd ? _cell.length_b 55.793 _cell.length_b_esd ? _cell.length_c 55.793 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 8 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5B5I _symmetry.cell_setting ? _symmetry.Int_Tables_number 19 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'P 21 21 21' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'Crustacean hyperglycemic hormones 1' 8501.666 2 ? ? ? ? 2 non-polymer syn ETHANOL 46.068 1 ? ? ? ? 3 water nat water 18.015 26 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name Pej-SGP-I # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code GSLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVATECRSNCYNNPVFRQCMAYVVPAHLHNEHREAVQMVG _entity_poly.pdbx_seq_one_letter_code_can GSLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVATECRSNCYNNPVFRQCMAYVVPAHLHNEHREAVQMVG _entity_poly.pdbx_strand_id A,B _entity_poly.pdbx_target_identifier ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 SER n 1 3 LEU n 1 4 PHE n 1 5 ASP n 1 6 PRO n 1 7 SER n 1 8 CYS n 1 9 THR n 1 10 GLY n 1 11 VAL n 1 12 PHE n 1 13 ASP n 1 14 ARG n 1 15 GLN n 1 16 LEU n 1 17 LEU n 1 18 ARG n 1 19 ARG n 1 20 LEU n 1 21 GLY n 1 22 ARG n 1 23 VAL n 1 24 CYS n 1 25 ASP n 1 26 ASP n 1 27 CYS n 1 28 PHE n 1 29 ASN n 1 30 VAL n 1 31 PHE n 1 32 ARG n 1 33 GLU n 1 34 PRO n 1 35 ASN n 1 36 VAL n 1 37 ALA n 1 38 THR n 1 39 GLU n 1 40 CYS n 1 41 ARG n 1 42 SER n 1 43 ASN n 1 44 CYS n 1 45 TYR n 1 46 ASN n 1 47 ASN n 1 48 PRO n 1 49 VAL n 1 50 PHE n 1 51 ARG n 1 52 GLN n 1 53 CYS n 1 54 MET n 1 55 ALA n 1 56 TYR n 1 57 VAL n 1 58 VAL n 1 59 PRO n 1 60 ALA n 1 61 HIS n 1 62 LEU n 1 63 HIS n 1 64 ASN n 1 65 GLU n 1 66 HIS n 1 67 ARG n 1 68 GLU n 1 69 ALA n 1 70 VAL n 1 71 GLN n 1 72 MET n 1 73 VAL n 1 74 GLY n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 74 _entity_src_gen.gene_src_common_name 'Kuruma prawn' _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene ? _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Marsupenaeus japonicus' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 27405 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code CHH1_PENJP _struct_ref.pdbx_db_accession O15980 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code SLFDPSCTGVFDRQLLRRLGRVCDDCFNVFREPNVATECRSNCYNNPVFRQCMAYVVPAHLHNEHREAVQMVG _struct_ref.pdbx_align_begin 47 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5B5I A 2 ? 74 ? O15980 47 ? 119 ? 1 73 2 1 5B5I B 2 ? 74 ? O15980 47 ? 119 ? 1 73 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5B5I GLY A 1 ? UNP O15980 ? ? 'expression tag' 0 1 2 5B5I GLY B 1 ? UNP O15980 ? ? 'expression tag' 0 2 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 EOH non-polymer . ETHANOL ? 'C2 H6 O' 46.068 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5B5I _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.90 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 30.52 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, SITTING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '0.8-1.0 M NaCl, 50 mM potassium sodium tartrate, 50 mM tartaric acid, 5% ethanol, 25% 1,2-ethanediol' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 95 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2009-04-25 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 0.9792 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'PHOTON FACTORY BEAMLINE BL-5A' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 0.9792 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL-5A _diffrn_source.pdbx_synchrotron_site 'Photon Factory' # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5B5I _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 1.6 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 16354 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 99.9 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 14.1 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 38.72 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 1.60 _reflns_shell.d_res_low 1.63 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5B5I _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 1.599 _refine.ls_d_res_low 7.944 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 16354 _refine.ls_number_reflns_R_free 847 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 99.93 _refine.ls_percent_reflns_R_free 5.18 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.1902 _refine.ls_R_factor_R_free 0.2057 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.1894 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 0.00 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method NONE _refine.pdbx_method_to_determine_struct ? _refine.pdbx_starting_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 18.24 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.09 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1099 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 3 _refine_hist.number_atoms_solvent 26 _refine_hist.number_atoms_total 1128 _refine_hist.d_res_high 1.599 _refine_hist.d_res_low 7.944 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.007 ? 1133 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.944 ? 1536 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 19.107 ? 699 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.048 ? 159 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.005 ? 209 ? f_plane_restr ? ? # loop_ _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.percent_reflns_obs _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_R_work _refine_ls_shell.R_factor_R_free _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.pdbx_refine_id _refine_ls_shell.R_factor_obs 1.5993 1.6986 6 100.0000 2528 . 0.1413 0.1482 . 140 . 2668 . 'X-RAY DIFFRACTION' . 1.6986 1.8282 6 100.0000 2520 . 0.1482 0.1539 . 169 . 2689 . 'X-RAY DIFFRACTION' . 1.8282 2.0095 6 100.0000 2573 . 0.1567 0.1719 . 137 . 2710 . 'X-RAY DIFFRACTION' . 2.0095 2.2941 6 100.0000 2562 . 0.1704 0.1696 . 134 . 2696 . 'X-RAY DIFFRACTION' . 2.2941 2.8676 6 100.0000 2583 . 0.1954 0.2343 . 146 . 2729 . 'X-RAY DIFFRACTION' . 2.8676 7.9444 6 100.0000 2741 . 0.2135 0.2429 . 121 . 2862 . 'X-RAY DIFFRACTION' . # _struct.entry_id 5B5I _struct.title 'The crystal structure of a crustacean hyperglycemic hormone precursor from the kuruma prawn' _struct.pdbx_descriptor 'Crustacean hyperglycemic hormones 1' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5B5I _struct_keywords.text 'crustacea, hyperglycemic, hormone, neuropeptide' _struct_keywords.pdbx_keywords HORMONE # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 1 ? C N N 2 ? D N N 3 ? E N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 13 ? PHE A 28 ? ASP A 12 PHE A 27 1 ? 16 HELX_P HELX_P2 AA2 GLU A 33 ? SER A 42 ? GLU A 32 SER A 41 1 ? 10 HELX_P HELX_P3 AA3 ASN A 43 ? ASN A 46 ? ASN A 42 ASN A 45 5 ? 4 HELX_P HELX_P4 AA4 ASN A 47 ? HIS A 63 ? ASN A 46 HIS A 62 1 ? 17 HELX_P HELX_P5 AA5 ASP B 13 ? PHE B 28 ? ASP B 12 PHE B 27 1 ? 16 HELX_P HELX_P6 AA6 GLU B 33 ? SER B 42 ? GLU B 32 SER B 41 1 ? 10 HELX_P HELX_P7 AA7 ASN B 43 ? ASN B 46 ? ASN B 42 ASN B 45 5 ? 4 HELX_P HELX_P8 AA8 ASN B 47 ? HIS B 63 ? ASN B 46 HIS B 62 1 ? 17 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order disulf1 disulf ? ? A CYS 8 SG ? ? ? 1_555 A CYS 44 SG ? ? A CYS 7 A CYS 43 1_555 ? ? ? ? ? ? ? 2.028 ? disulf2 disulf ? ? A CYS 24 SG ? ? ? 1_555 A CYS 40 SG ? ? A CYS 23 A CYS 39 1_555 ? ? ? ? ? ? ? 2.049 ? disulf3 disulf ? ? A CYS 27 SG ? ? ? 1_555 A CYS 53 SG ? ? A CYS 26 A CYS 52 1_555 ? ? ? ? ? ? ? 2.029 ? disulf4 disulf ? ? B CYS 8 SG ? ? ? 1_555 B CYS 44 SG ? ? B CYS 7 B CYS 43 1_555 ? ? ? ? ? ? ? 2.012 ? disulf5 disulf ? ? B CYS 24 SG ? ? ? 1_555 B CYS 40 SG ? ? B CYS 23 B CYS 39 1_555 ? ? ? ? ? ? ? 2.033 ? disulf6 disulf ? ? B CYS 27 SG ? ? ? 1_555 B CYS 53 SG ? ? B CYS 26 B CYS 52 1_555 ? ? ? ? ? ? ? 2.058 ? # _struct_conn_type.id disulf _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id EOH _struct_site.pdbx_auth_seq_id 101 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 2 _struct_site.details 'binding site for residue EOH A 101' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 2 CYS A 44 ? CYS A 43 . ? 1_555 ? 2 AC1 2 VAL B 58 ? VAL B 57 . ? 1_555 ? # _atom_sites.entry_id 5B5I _atom_sites.fract_transf_matrix[1][1] 0.025854 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.017923 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017923 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 0 ? ? ? A . n A 1 2 SER 2 1 1 SER SER A . n A 1 3 LEU 3 2 2 LEU LEU A . n A 1 4 PHE 4 3 3 PHE PHE A . n A 1 5 ASP 5 4 4 ASP ASP A . n A 1 6 PRO 6 5 5 PRO PRO A . n A 1 7 SER 7 6 6 SER SER A . n A 1 8 CYS 8 7 7 CYS CYS A . n A 1 9 THR 9 8 8 THR THR A . n A 1 10 GLY 10 9 9 GLY GLY A . n A 1 11 VAL 11 10 10 VAL VAL A . n A 1 12 PHE 12 11 11 PHE PHE A . n A 1 13 ASP 13 12 12 ASP ASP A . n A 1 14 ARG 14 13 13 ARG ARG A . n A 1 15 GLN 15 14 14 GLN GLN A . n A 1 16 LEU 16 15 15 LEU LEU A . n A 1 17 LEU 17 16 16 LEU LEU A . n A 1 18 ARG 18 17 17 ARG ARG A . n A 1 19 ARG 19 18 18 ARG ARG A . n A 1 20 LEU 20 19 19 LEU LEU A . n A 1 21 GLY 21 20 20 GLY GLY A . n A 1 22 ARG 22 21 21 ARG ARG A . n A 1 23 VAL 23 22 22 VAL VAL A . n A 1 24 CYS 24 23 23 CYS CYS A . n A 1 25 ASP 25 24 24 ASP ASP A . n A 1 26 ASP 26 25 25 ASP ASP A . n A 1 27 CYS 27 26 26 CYS CYS A . n A 1 28 PHE 28 27 27 PHE PHE A . n A 1 29 ASN 29 28 28 ASN ASN A . n A 1 30 VAL 30 29 29 VAL VAL A . n A 1 31 PHE 31 30 30 PHE PHE A . n A 1 32 ARG 32 31 31 ARG ARG A . n A 1 33 GLU 33 32 32 GLU GLU A . n A 1 34 PRO 34 33 33 PRO PRO A . n A 1 35 ASN 35 34 34 ASN ASN A . n A 1 36 VAL 36 35 35 VAL VAL A . n A 1 37 ALA 37 36 36 ALA ALA A . n A 1 38 THR 38 37 37 THR THR A . n A 1 39 GLU 39 38 38 GLU GLU A . n A 1 40 CYS 40 39 39 CYS CYS A . n A 1 41 ARG 41 40 40 ARG ARG A . n A 1 42 SER 42 41 41 SER SER A . n A 1 43 ASN 43 42 42 ASN ASN A . n A 1 44 CYS 44 43 43 CYS CYS A . n A 1 45 TYR 45 44 44 TYR TYR A . n A 1 46 ASN 46 45 45 ASN ASN A . n A 1 47 ASN 47 46 46 ASN ASN A . n A 1 48 PRO 48 47 47 PRO PRO A . n A 1 49 VAL 49 48 48 VAL VAL A . n A 1 50 PHE 50 49 49 PHE PHE A . n A 1 51 ARG 51 50 50 ARG ARG A . n A 1 52 GLN 52 51 51 GLN GLN A . n A 1 53 CYS 53 52 52 CYS CYS A . n A 1 54 MET 54 53 53 MET MET A . n A 1 55 ALA 55 54 54 ALA ALA A . n A 1 56 TYR 56 55 55 TYR TYR A . n A 1 57 VAL 57 56 56 VAL VAL A . n A 1 58 VAL 58 57 57 VAL VAL A . n A 1 59 PRO 59 58 58 PRO PRO A . n A 1 60 ALA 60 59 59 ALA ALA A . n A 1 61 HIS 61 60 60 HIS HIS A . n A 1 62 LEU 62 61 61 LEU LEU A . n A 1 63 HIS 63 62 62 HIS HIS A . n A 1 64 ASN 64 63 63 ASN ASN A . n A 1 65 GLU 65 64 64 GLU GLU A . n A 1 66 HIS 66 65 65 HIS HIS A . n A 1 67 ARG 67 66 66 ARG ARG A . n A 1 68 GLU 68 67 67 GLU GLU A . n A 1 69 ALA 69 68 ? ? ? A . n A 1 70 VAL 70 69 ? ? ? A . n A 1 71 GLN 71 70 ? ? ? A . n A 1 72 MET 72 71 ? ? ? A . n A 1 73 VAL 73 72 ? ? ? A . n A 1 74 GLY 74 73 ? ? ? A . n B 1 1 GLY 1 0 ? ? ? B . n B 1 2 SER 2 1 1 SER SER B . n B 1 3 LEU 3 2 2 LEU LEU B . n B 1 4 PHE 4 3 3 PHE PHE B . n B 1 5 ASP 5 4 4 ASP ASP B . n B 1 6 PRO 6 5 5 PRO PRO B . n B 1 7 SER 7 6 6 SER SER B . n B 1 8 CYS 8 7 7 CYS CYS B . n B 1 9 THR 9 8 8 THR THR B . n B 1 10 GLY 10 9 9 GLY GLY B . n B 1 11 VAL 11 10 10 VAL VAL B . n B 1 12 PHE 12 11 11 PHE PHE B . n B 1 13 ASP 13 12 12 ASP ASP B . n B 1 14 ARG 14 13 13 ARG ARG B . n B 1 15 GLN 15 14 14 GLN GLN B . n B 1 16 LEU 16 15 15 LEU LEU B . n B 1 17 LEU 17 16 16 LEU LEU B . n B 1 18 ARG 18 17 17 ARG ARG B . n B 1 19 ARG 19 18 18 ARG ARG B . n B 1 20 LEU 20 19 19 LEU LEU B . n B 1 21 GLY 21 20 20 GLY GLY B . n B 1 22 ARG 22 21 21 ARG ARG B . n B 1 23 VAL 23 22 22 VAL VAL B . n B 1 24 CYS 24 23 23 CYS CYS B . n B 1 25 ASP 25 24 24 ASP ASP B . n B 1 26 ASP 26 25 25 ASP ASP B . n B 1 27 CYS 27 26 26 CYS CYS B . n B 1 28 PHE 28 27 27 PHE PHE B . n B 1 29 ASN 29 28 28 ASN ASN B . n B 1 30 VAL 30 29 29 VAL VAL B . n B 1 31 PHE 31 30 30 PHE PHE B . n B 1 32 ARG 32 31 31 ARG ARG B . n B 1 33 GLU 33 32 32 GLU GLU B . n B 1 34 PRO 34 33 33 PRO PRO B . n B 1 35 ASN 35 34 34 ASN ASN B . n B 1 36 VAL 36 35 35 VAL VAL B . n B 1 37 ALA 37 36 36 ALA ALA B . n B 1 38 THR 38 37 37 THR THR B . n B 1 39 GLU 39 38 38 GLU GLU B . n B 1 40 CYS 40 39 39 CYS CYS B . n B 1 41 ARG 41 40 40 ARG ARG B . n B 1 42 SER 42 41 41 SER SER B . n B 1 43 ASN 43 42 42 ASN ASN B . n B 1 44 CYS 44 43 43 CYS CYS B . n B 1 45 TYR 45 44 44 TYR TYR B . n B 1 46 ASN 46 45 45 ASN ASN B . n B 1 47 ASN 47 46 46 ASN ASN B . n B 1 48 PRO 48 47 47 PRO PRO B . n B 1 49 VAL 49 48 48 VAL VAL B . n B 1 50 PHE 50 49 49 PHE PHE B . n B 1 51 ARG 51 50 50 ARG ARG B . n B 1 52 GLN 52 51 51 GLN GLN B . n B 1 53 CYS 53 52 52 CYS CYS B . n B 1 54 MET 54 53 53 MET MET B . n B 1 55 ALA 55 54 54 ALA ALA B . n B 1 56 TYR 56 55 55 TYR TYR B . n B 1 57 VAL 57 56 56 VAL VAL B . n B 1 58 VAL 58 57 57 VAL VAL B . n B 1 59 PRO 59 58 58 PRO PRO B . n B 1 60 ALA 60 59 59 ALA ALA B . n B 1 61 HIS 61 60 60 HIS HIS B . n B 1 62 LEU 62 61 61 LEU LEU B . n B 1 63 HIS 63 62 62 HIS HIS B . n B 1 64 ASN 64 63 63 ASN ASN B . n B 1 65 GLU 65 64 64 GLU GLU B . n B 1 66 HIS 66 65 65 HIS HIS B . n B 1 67 ARG 67 66 66 ARG ARG B . n B 1 68 GLU 68 67 67 GLU GLU B . n B 1 69 ALA 69 68 68 ALA ALA B . n B 1 70 VAL 70 69 ? ? ? B . n B 1 71 GLN 71 70 ? ? ? B . n B 1 72 MET 72 71 ? ? ? B . n B 1 73 VAL 73 72 ? ? ? B . n B 1 74 GLY 74 73 ? ? ? B . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code C 2 EOH 1 101 1 EOH EOH A . D 3 HOH 1 201 12 HOH HOH A . D 3 HOH 2 202 1 HOH HOH A . D 3 HOH 3 203 17 HOH HOH A . D 3 HOH 4 204 19 HOH HOH A . D 3 HOH 5 205 15 HOH HOH A . D 3 HOH 6 206 5 HOH HOH A . D 3 HOH 7 207 7 HOH HOH A . D 3 HOH 8 208 24 HOH HOH A . D 3 HOH 9 209 27 HOH HOH A . D 3 HOH 10 210 4 HOH HOH A . D 3 HOH 11 211 14 HOH HOH A . D 3 HOH 12 212 16 HOH HOH A . E 3 HOH 1 101 26 HOH HOH B . E 3 HOH 2 102 25 HOH HOH B . E 3 HOH 3 103 13 HOH HOH B . E 3 HOH 4 104 22 HOH HOH B . E 3 HOH 5 105 23 HOH HOH B . E 3 HOH 6 106 29 HOH HOH B . E 3 HOH 7 107 2 HOH HOH B . E 3 HOH 8 108 10 HOH HOH B . E 3 HOH 9 109 9 HOH HOH B . E 3 HOH 10 110 8 HOH HOH B . E 3 HOH 11 111 3 HOH HOH B . E 3 HOH 12 112 11 HOH HOH B . E 3 HOH 13 113 28 HOH HOH B . E 3 HOH 14 114 30 HOH HOH B . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D,E # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2350 ? 1 MORE -12 ? 1 'SSA (A^2)' 8460 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-10-19 2 'Structure model' 1 1 2016-10-26 3 'Structure model' 1 2 2016-12-21 4 'Structure model' 1 3 2020-02-26 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Database references' 3 4 'Structure model' 'Data collection' # _pdbx_audit_revision_category.ordinal 1 _pdbx_audit_revision_category.revision_ordinal 4 _pdbx_audit_revision_category.data_content_type 'Structure model' _pdbx_audit_revision_category.category diffrn_source # _pdbx_audit_revision_item.ordinal 1 _pdbx_audit_revision_item.revision_ordinal 4 _pdbx_audit_revision_item.data_content_type 'Structure model' _pdbx_audit_revision_item.item '_diffrn_source.pdbx_synchrotron_site' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? '(1.10.1_2155: ???)' 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? SCALEPACK ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? MOLREP ? ? ? . 4 # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 OE2 A GLU 67 ? ? NE2 B GLN 14 ? ? 1.94 2 1 O B HOH 104 ? ? O B HOH 107 ? ? 2.17 3 1 O B HOH 102 ? ? O B HOH 105 ? ? 2.18 # loop_ _pdbx_validate_rmsd_angle.id _pdbx_validate_rmsd_angle.PDB_model_num _pdbx_validate_rmsd_angle.auth_atom_id_1 _pdbx_validate_rmsd_angle.auth_asym_id_1 _pdbx_validate_rmsd_angle.auth_comp_id_1 _pdbx_validate_rmsd_angle.auth_seq_id_1 _pdbx_validate_rmsd_angle.PDB_ins_code_1 _pdbx_validate_rmsd_angle.label_alt_id_1 _pdbx_validate_rmsd_angle.auth_atom_id_2 _pdbx_validate_rmsd_angle.auth_asym_id_2 _pdbx_validate_rmsd_angle.auth_comp_id_2 _pdbx_validate_rmsd_angle.auth_seq_id_2 _pdbx_validate_rmsd_angle.PDB_ins_code_2 _pdbx_validate_rmsd_angle.label_alt_id_2 _pdbx_validate_rmsd_angle.auth_atom_id_3 _pdbx_validate_rmsd_angle.auth_asym_id_3 _pdbx_validate_rmsd_angle.auth_comp_id_3 _pdbx_validate_rmsd_angle.auth_seq_id_3 _pdbx_validate_rmsd_angle.PDB_ins_code_3 _pdbx_validate_rmsd_angle.label_alt_id_3 _pdbx_validate_rmsd_angle.angle_value _pdbx_validate_rmsd_angle.angle_target_value _pdbx_validate_rmsd_angle.angle_deviation _pdbx_validate_rmsd_angle.angle_standard_deviation _pdbx_validate_rmsd_angle.linker_flag 1 1 CG A MET 53 ? ? SD A MET 53 ? ? CE A MET 53 ? ? 88.57 100.20 -11.63 1.60 N 2 1 CG B MET 53 ? ? SD B MET 53 ? ? CE B MET 53 ? ? 87.44 100.20 -12.76 1.60 N # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 CYS A 7 ? ? -166.70 108.94 2 1 CYS B 7 ? ? -166.72 107.21 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 0 ? A GLY 1 2 1 Y 1 A ALA 68 ? A ALA 69 3 1 Y 1 A VAL 69 ? A VAL 70 4 1 Y 1 A GLN 70 ? A GLN 71 5 1 Y 1 A MET 71 ? A MET 72 6 1 Y 1 A VAL 72 ? A VAL 73 7 1 Y 1 A GLY 73 ? A GLY 74 8 1 Y 1 B GLY 0 ? B GLY 1 9 1 Y 1 B VAL 69 ? B VAL 70 10 1 Y 1 B GLN 70 ? B GLN 71 11 1 Y 1 B MET 71 ? B MET 72 12 1 Y 1 B VAL 72 ? B VAL 73 13 1 Y 1 B GLY 73 ? B GLY 74 # loop_ _pdbx_audit_support.funding_organization _pdbx_audit_support.country _pdbx_audit_support.grant_number _pdbx_audit_support.ordinal 'Ministry of Education, Culture, Sport, Science and Technology of Japan' Japan 25850143 1 'Ministry of Education, Culture, Sport, Science and Technology of Japan' Japan 15K07576 2 'Suntory Institute for Bioorganic Research' Japan ? 3 # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 ETHANOL EOH 3 water HOH #