data_5B5W # _entry.id 5B5W # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.380 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5B5W pdb_00005b5w 10.2210/pdb5b5w/pdb WWPDB D_1300000592 ? ? # _pdbx_database_related.content_type unspecified _pdbx_database_related.db_id 5B5V _pdbx_database_related.db_name PDB _pdbx_database_related.details . # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5B5W _pdbx_database_status.recvd_initial_deposition_date 2016-05-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _audit_author.name _audit_author.pdbx_ordinal 'KIM, S.-Y.' 1 'Tachioka, Y.' 2 'Mori, T.' 3 'Hakoshima, T.' 4 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country UK _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Sci Rep' _citation.journal_id_ASTM ? _citation.journal_id_CSD ? _citation.journal_id_ISSN 2045-2322 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 6 _citation.language ? _citation.page_first 28488 _citation.page_last 28488 _citation.title 'Structural basis for autoinhibition and its relief of MOB1 in the Hippo pathway' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1038/srep28488 _citation.pdbx_database_id_PubMed 27335147 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Kim, S.Y.' 1 ? primary 'Tachioka, Y.' 2 ? primary 'Mori, T.' 3 ? primary 'Hakoshima, T.' 4 ? # _cell.angle_alpha 90.00 _cell.angle_alpha_esd ? _cell.angle_beta 101.99 _cell.angle_beta_esd ? _cell.angle_gamma 90.00 _cell.angle_gamma_esd ? _cell.entry_id 5B5W _cell.details ? _cell.formula_units_Z ? _cell.length_a 78.747 _cell.length_a_esd ? _cell.length_b 71.760 _cell.length_b_esd ? _cell.length_c 57.855 _cell.length_c_esd ? _cell.volume ? _cell.volume_esd ? _cell.Z_PDB 4 _cell.reciprocal_angle_alpha ? _cell.reciprocal_angle_beta ? _cell.reciprocal_angle_gamma ? _cell.reciprocal_angle_alpha_esd ? _cell.reciprocal_angle_beta_esd ? _cell.reciprocal_angle_gamma_esd ? _cell.reciprocal_length_a ? _cell.reciprocal_length_b ? _cell.reciprocal_length_c ? _cell.reciprocal_length_a_esd ? _cell.reciprocal_length_b_esd ? _cell.reciprocal_length_c_esd ? _cell.pdbx_unique_axis ? # _symmetry.entry_id 5B5W _symmetry.cell_setting ? _symmetry.Int_Tables_number 5 _symmetry.space_group_name_Hall ? _symmetry.space_group_name_H-M 'C 1 2 1' _symmetry.pdbx_full_space_group_name_H-M ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'MOB kinase activator 1B' 21592.697 1 ? ? 'UNP residues 33-216' ? 2 polymer man 'Serine/threonine-protein kinase LATS1' 10379.002 1 2.7.11.1 ? 'UNP residues 622-704' ? 3 non-polymer syn 'ZINC ION' 65.409 1 ? ? ? ? # loop_ _entity_name_com.entity_id _entity_name_com.name 1 'Mob1 homolog 1A,Mps one binder kinase activator-like 1A' 2 'Large tumor suppressor homolog 1,WARTS protein kinase,h-warts' # loop_ _entity_poly.entity_id _entity_poly.type _entity_poly.nstd_linkage _entity_poly.nstd_monomer _entity_poly.pdbx_seq_one_letter_code _entity_poly.pdbx_seq_one_letter_code_can _entity_poly.pdbx_strand_id _entity_poly.pdbx_target_identifier 1 'polypeptide(L)' no no ;GPEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCS APKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFV QEFNLIDRRELAPLQELIEKLTSKDR ; ;GPEATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCS APKYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFV QEFNLIDRRELAPLQELIEKLTSKDR ; A ? 2 'polypeptide(L)' no no ;GPKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAK MDKSM ; ;GPKDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAK MDKSM ; U ? # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 PRO n 1 3 GLU n 1 4 ALA n 1 5 THR n 1 6 LEU n 1 7 GLY n 1 8 SER n 1 9 GLY n 1 10 ASN n 1 11 LEU n 1 12 ARG n 1 13 MET n 1 14 ALA n 1 15 VAL n 1 16 MET n 1 17 LEU n 1 18 PRO n 1 19 GLU n 1 20 GLY n 1 21 GLU n 1 22 ASP n 1 23 LEU n 1 24 ASN n 1 25 GLU n 1 26 TRP n 1 27 VAL n 1 28 ALA n 1 29 VAL n 1 30 ASN n 1 31 THR n 1 32 VAL n 1 33 ASP n 1 34 PHE n 1 35 PHE n 1 36 ASN n 1 37 GLN n 1 38 ILE n 1 39 ASN n 1 40 MET n 1 41 LEU n 1 42 TYR n 1 43 GLY n 1 44 THR n 1 45 ILE n 1 46 THR n 1 47 ASP n 1 48 PHE n 1 49 CYS n 1 50 THR n 1 51 GLU n 1 52 GLU n 1 53 SER n 1 54 CYS n 1 55 PRO n 1 56 VAL n 1 57 MET n 1 58 SER n 1 59 ALA n 1 60 GLY n 1 61 PRO n 1 62 LYS n 1 63 TYR n 1 64 GLU n 1 65 TYR n 1 66 HIS n 1 67 TRP n 1 68 ALA n 1 69 ASP n 1 70 GLY n 1 71 THR n 1 72 ASN n 1 73 ILE n 1 74 LYS n 1 75 LYS n 1 76 PRO n 1 77 ILE n 1 78 LYS n 1 79 CYS n 1 80 SER n 1 81 ALA n 1 82 PRO n 1 83 LYS n 1 84 TYR n 1 85 ILE n 1 86 ASP n 1 87 TYR n 1 88 LEU n 1 89 MET n 1 90 THR n 1 91 TRP n 1 92 VAL n 1 93 GLN n 1 94 ASP n 1 95 GLN n 1 96 LEU n 1 97 ASP n 1 98 ASP n 1 99 GLU n 1 100 THR n 1 101 LEU n 1 102 PHE n 1 103 PRO n 1 104 SER n 1 105 LYS n 1 106 ILE n 1 107 GLY n 1 108 VAL n 1 109 PRO n 1 110 PHE n 1 111 PRO n 1 112 LYS n 1 113 ASN n 1 114 PHE n 1 115 MET n 1 116 SER n 1 117 VAL n 1 118 ALA n 1 119 LYS n 1 120 THR n 1 121 ILE n 1 122 LEU n 1 123 LYS n 1 124 ARG n 1 125 LEU n 1 126 PHE n 1 127 ARG n 1 128 VAL n 1 129 TYR n 1 130 ALA n 1 131 HIS n 1 132 ILE n 1 133 TYR n 1 134 HIS n 1 135 GLN n 1 136 HIS n 1 137 PHE n 1 138 ASP n 1 139 PRO n 1 140 VAL n 1 141 ILE n 1 142 GLN n 1 143 LEU n 1 144 GLN n 1 145 GLU n 1 146 GLU n 1 147 ALA n 1 148 HIS n 1 149 LEU n 1 150 ASN n 1 151 THR n 1 152 SER n 1 153 PHE n 1 154 LYS n 1 155 HIS n 1 156 PHE n 1 157 ILE n 1 158 PHE n 1 159 PHE n 1 160 VAL n 1 161 GLN n 1 162 GLU n 1 163 PHE n 1 164 ASN n 1 165 LEU n 1 166 ILE n 1 167 ASP n 1 168 ARG n 1 169 ARG n 1 170 GLU n 1 171 LEU n 1 172 ALA n 1 173 PRO n 1 174 LEU n 1 175 GLN n 1 176 GLU n 1 177 LEU n 1 178 ILE n 1 179 GLU n 1 180 LYS n 1 181 LEU n 1 182 THR n 1 183 SER n 1 184 LYS n 1 185 ASP n 1 186 ARG n 2 1 GLY n 2 2 PRO n 2 3 LYS n 2 4 ASP n 2 5 GLU n 2 6 GLU n 2 7 ARG n 2 8 ARG n 2 9 GLU n 2 10 SER n 2 11 ARG n 2 12 ILE n 2 13 GLN n 2 14 SER n 2 15 TYR n 2 16 SER n 2 17 PRO n 2 18 GLN n 2 19 ALA n 2 20 PHE n 2 21 LYS n 2 22 PHE n 2 23 PHE n 2 24 MET n 2 25 GLU n 2 26 GLN n 2 27 HIS n 2 28 VAL n 2 29 GLU n 2 30 ASN n 2 31 VAL n 2 32 LEU n 2 33 LYS n 2 34 SER n 2 35 HIS n 2 36 GLN n 2 37 GLN n 2 38 ARG n 2 39 LEU n 2 40 HIS n 2 41 ARG n 2 42 LYS n 2 43 LYS n 2 44 GLN n 2 45 LEU n 2 46 GLU n 2 47 ASN n 2 48 GLU n 2 49 MET n 2 50 MET n 2 51 ARG n 2 52 VAL n 2 53 GLY n 2 54 LEU n 2 55 SER n 2 56 GLN n 2 57 ASP n 2 58 ALA n 2 59 GLN n 2 60 ASP n 2 61 GLN n 2 62 MET n 2 63 ARG n 2 64 LYS n 2 65 MET n 2 66 LEU n 2 67 CYS n 2 68 GLN n 2 69 LYS n 2 70 GLU n 2 71 SER n 2 72 ASN n 2 73 TYR n 2 74 ILE n 2 75 ARG n 2 76 LEU n 2 77 LYS n 2 78 ARG n 2 79 ALA n 2 80 LYS n 2 81 MET n 2 82 ASP n 2 83 LYS n 2 84 SER n 2 85 MET n # loop_ _entity_src_gen.entity_id _entity_src_gen.pdbx_src_id _entity_src_gen.pdbx_alt_source_flag _entity_src_gen.pdbx_seq_type _entity_src_gen.pdbx_beg_seq_num _entity_src_gen.pdbx_end_seq_num _entity_src_gen.gene_src_common_name _entity_src_gen.gene_src_genus _entity_src_gen.pdbx_gene_src_gene _entity_src_gen.gene_src_species _entity_src_gen.gene_src_strain _entity_src_gen.gene_src_tissue _entity_src_gen.gene_src_tissue_fraction _entity_src_gen.gene_src_details _entity_src_gen.pdbx_gene_src_fragment _entity_src_gen.pdbx_gene_src_scientific_name _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id _entity_src_gen.pdbx_gene_src_variant _entity_src_gen.pdbx_gene_src_cell_line _entity_src_gen.pdbx_gene_src_atcc _entity_src_gen.pdbx_gene_src_organ _entity_src_gen.pdbx_gene_src_organelle _entity_src_gen.pdbx_gene_src_cell _entity_src_gen.pdbx_gene_src_cellular_location _entity_src_gen.host_org_common_name _entity_src_gen.pdbx_host_org_scientific_name _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id _entity_src_gen.host_org_genus _entity_src_gen.pdbx_host_org_gene _entity_src_gen.pdbx_host_org_organ _entity_src_gen.host_org_species _entity_src_gen.pdbx_host_org_tissue _entity_src_gen.pdbx_host_org_tissue_fraction _entity_src_gen.pdbx_host_org_strain _entity_src_gen.pdbx_host_org_variant _entity_src_gen.pdbx_host_org_cell_line _entity_src_gen.pdbx_host_org_atcc _entity_src_gen.pdbx_host_org_culture_collection _entity_src_gen.pdbx_host_org_cell _entity_src_gen.pdbx_host_org_organelle _entity_src_gen.pdbx_host_org_cellular_location _entity_src_gen.pdbx_host_org_vector_type _entity_src_gen.pdbx_host_org_vector _entity_src_gen.host_org_details _entity_src_gen.expression_system_id _entity_src_gen.plasmid_name _entity_src_gen.plasmid_details _entity_src_gen.pdbx_description 1 1 sample 'Biological sequence' 1 186 Mouse ? 'Mob1b, Mobkl1a' ? ? ? ? ? ? 'Mus musculus' 10090 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? 2 1 sample 'Biological sequence' 1 85 Human ? 'LATS1, WARTS' ? ? ? ? ? ? 'Homo sapiens' 9606 ? ? ? ? ? ? ? ? 'Escherichia coli' 562 ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? ? # loop_ _struct_ref.id _struct_ref.db_name _struct_ref.db_code _struct_ref.pdbx_db_accession _struct_ref.pdbx_db_isoform _struct_ref.entity_id _struct_ref.pdbx_seq_one_letter_code _struct_ref.pdbx_align_begin 1 UNP MOB1B_MOUSE Q8BPB0 ? 1 ;EATLGSGNLRMAVMLPEGEDLNEWVAVNTVDFFNQINMLYGTITDFCTEESCPVMSAGPKYEYHWADGTNIKKPIKCSAP KYIDYLMTWVQDQLDDETLFPSKIGVPFPKNFMSVAKTILKRLFRVYAHIYHQHFDPVIQLQEEAHLNTSFKHFIFFVQE FNLIDRRELAPLQELIEKLTSKDR ; 33 2 UNP LATS1_HUMAN O95835 ? 2 ;KDEERRESRIQSYSPQAFKFFMEQHVENVLKSHQQRLHRKKQLENEMMRVGLSQDAQDQMRKMLCQKESNYIRLKRAKMD KSM ; 622 # loop_ _struct_ref_seq.align_id _struct_ref_seq.ref_id _struct_ref_seq.pdbx_PDB_id_code _struct_ref_seq.pdbx_strand_id _struct_ref_seq.seq_align_beg _struct_ref_seq.pdbx_seq_align_beg_ins_code _struct_ref_seq.seq_align_end _struct_ref_seq.pdbx_seq_align_end_ins_code _struct_ref_seq.pdbx_db_accession _struct_ref_seq.db_align_beg _struct_ref_seq.pdbx_db_align_beg_ins_code _struct_ref_seq.db_align_end _struct_ref_seq.pdbx_db_align_end_ins_code _struct_ref_seq.pdbx_auth_seq_align_beg _struct_ref_seq.pdbx_auth_seq_align_end 1 1 5B5W A 3 ? 186 ? Q8BPB0 33 ? 216 ? 33 216 2 2 5B5W U 3 ? 85 ? O95835 622 ? 704 ? 621 703 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5B5W GLY A 1 ? UNP Q8BPB0 ? ? 'expression tag' 31 1 1 5B5W PRO A 2 ? UNP Q8BPB0 ? ? 'expression tag' 32 2 2 5B5W GLY U 1 ? UNP O95835 ? ? 'expression tag' 619 3 2 5B5W PRO U 2 ? UNP O95835 ? ? 'expression tag' 620 4 # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5B5W _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 2.50 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 50.81 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH ? _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 277 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details 'PEG 4000' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'RAYONIX MX225HE' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2013-11-26 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'SPRING-8 BEAMLINE BL41XU' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL41XU _diffrn_source.pdbx_synchrotron_site SPring-8 # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5B5W _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.957 _reflns.d_resolution_low 30 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 6660 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 94.1 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 3.2 _reflns.pdbx_Rmerge_I_obs 0.074 _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 21.4 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high . _reflns_shell.d_res_low ? _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.aniso_B[1][1] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][2] ? _refine.aniso_B[2][3] ? _refine.aniso_B[3][3] ? _refine.B_iso_max ? _refine.B_iso_mean ? _refine.B_iso_min ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.details ? _refine.diff_density_max ? _refine.diff_density_max_esd ? _refine.diff_density_min ? _refine.diff_density_min_esd ? _refine.diff_density_rms ? _refine.diff_density_rms_esd ? _refine.entry_id 5B5W _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.ls_abs_structure_details ? _refine.ls_abs_structure_Flack ? _refine.ls_abs_structure_Flack_esd ? _refine.ls_abs_structure_Rogers ? _refine.ls_abs_structure_Rogers_esd ? _refine.ls_d_res_high 2.957 _refine.ls_d_res_low 28.296 _refine.ls_extinction_coef ? _refine.ls_extinction_coef_esd ? _refine.ls_extinction_expression ? _refine.ls_extinction_method ? _refine.ls_goodness_of_fit_all ? _refine.ls_goodness_of_fit_all_esd ? _refine.ls_goodness_of_fit_obs ? _refine.ls_goodness_of_fit_obs_esd ? _refine.ls_hydrogen_treatment ? _refine.ls_matrix_type ? _refine.ls_number_constraints ? _refine.ls_number_parameters ? _refine.ls_number_reflns_all ? _refine.ls_number_reflns_obs 6109 _refine.ls_number_reflns_R_free 348 _refine.ls_number_reflns_R_work ? _refine.ls_number_restraints ? _refine.ls_percent_reflns_obs 91.52 _refine.ls_percent_reflns_R_free 5.70 _refine.ls_R_factor_all ? _refine.ls_R_factor_obs 0.2357 _refine.ls_R_factor_R_free 0.2704 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_R_factor_R_work 0.2336 _refine.ls_R_Fsqd_factor_obs ? _refine.ls_R_I_factor_obs ? _refine.ls_redundancy_reflns_all ? _refine.ls_redundancy_reflns_obs ? _refine.ls_restrained_S_all ? _refine.ls_restrained_S_obs ? _refine.ls_shift_over_esd_max ? _refine.ls_shift_over_esd_mean ? _refine.ls_structure_factor_coef ? _refine.ls_weighting_details ? _refine.ls_weighting_scheme ? _refine.ls_wR_factor_all ? _refine.ls_wR_factor_obs ? _refine.ls_wR_factor_R_free ? _refine.ls_wR_factor_R_work ? _refine.occupancy_max ? _refine.occupancy_min ? _refine.solvent_model_details ? _refine.solvent_model_param_bsol ? _refine.solvent_model_param_ksol ? _refine.ls_R_factor_gt ? _refine.ls_goodness_of_fit_gt ? _refine.ls_goodness_of_fit_ref ? _refine.ls_shift_over_su_max ? _refine.ls_shift_over_su_max_lt ? _refine.ls_shift_over_su_mean ? _refine.ls_shift_over_su_mean_lt ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.36 _refine.pdbx_ls_sigma_Fsqd ? _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.pdbx_method_to_determine_struct 'MOLECULAR REPLACEMENT' _refine.pdbx_starting_model 1PI1 _refine.pdbx_stereochemistry_target_values ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_real_space_R ? _refine.pdbx_density_correlation ? _refine.pdbx_pd_number_of_powder_patterns ? _refine.pdbx_pd_number_of_points ? _refine.pdbx_pd_meas_number_of_points ? _refine.pdbx_pd_proc_ls_prof_R_factor ? _refine.pdbx_pd_proc_ls_prof_wR_factor ? _refine.pdbx_pd_Marquardt_correlation_coeff ? _refine.pdbx_pd_Fsqrd_R_factor ? _refine.pdbx_pd_ls_matrix_band_width ? _refine.pdbx_overall_phase_error 37.98 _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_TLS_residual_ADP_flag ? _refine.pdbx_diffrn_id 1 _refine.overall_SU_B ? _refine.overall_SU_ML 0.42 _refine.overall_SU_R_Cruickshank_DPI ? _refine.overall_SU_R_free ? _refine.overall_FOM_free_R_set ? _refine.overall_FOM_work_R_set ? _refine.pdbx_average_fsc_overall ? _refine.pdbx_average_fsc_work ? _refine.pdbx_average_fsc_free ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1966 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 1 _refine_hist.number_atoms_solvent 0 _refine_hist.number_atoms_total 1967 _refine_hist.d_res_high 2.957 _refine_hist.d_res_low 28.296 # loop_ _refine_ls_restr.pdbx_refine_id _refine_ls_restr.criterion _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.number _refine_ls_restr.rejects _refine_ls_restr.type _refine_ls_restr.weight _refine_ls_restr.pdbx_restraint_function 'X-RAY DIFFRACTION' ? 0.003 ? 2018 ? f_bond_d ? ? 'X-RAY DIFFRACTION' ? 0.745 ? 2709 ? f_angle_d ? ? 'X-RAY DIFFRACTION' ? 14.642 ? 767 ? f_dihedral_angle_d ? ? 'X-RAY DIFFRACTION' ? 0.027 ? 286 ? f_chiral_restr ? ? 'X-RAY DIFFRACTION' ? 0.003 ? 349 ? f_plane_restr ? ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_all _refine_ls_shell.number_reflns_obs _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.R_factor_R_work _refine_ls_shell.redundancy_reflns_all _refine_ls_shell.redundancy_reflns_obs _refine_ls_shell.wR_factor_all _refine_ls_shell.wR_factor_obs _refine_ls_shell.wR_factor_R_free _refine_ls_shell.wR_factor_R_work _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.pdbx_phase_error _refine_ls_shell.pdbx_fsc_work _refine_ls_shell.pdbx_fsc_free 'X-RAY DIFFRACTION' 2.9570 3.7242 . . 141 2686 85.00 . . . 0.3695 . 0.3226 . . . . . . . . . . 'X-RAY DIFFRACTION' 3.7242 28.2977 . . 207 3075 97.00 . . . 0.2503 . 0.2115 . . . . . . . . . . # _struct.entry_id 5B5W _struct.title 'Crystal structure of MOB1-LATS1 NTR domain complex' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5B5W _struct_keywords.text 'MOB1 LATS1 Hippo pathway, METAL BINDING PROTEIN-APOTOSIS complex' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN/APOTOSIS' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 ASP A 22 ? THR A 46 ? ASP A 52 THR A 76 1 ? 25 HELX_P HELX_P2 AA2 SER A 80 ? ASP A 98 ? SER A 110 ASP A 128 1 ? 19 HELX_P HELX_P3 AA3 ASN A 113 ? HIS A 136 ? ASN A 143 HIS A 166 1 ? 24 HELX_P HELX_P4 AA4 HIS A 136 ? GLN A 142 ? HIS A 166 GLN A 172 1 ? 7 HELX_P HELX_P5 AA5 GLU A 145 ? ASN A 164 ? GLU A 175 ASN A 194 1 ? 20 HELX_P HELX_P6 AA6 ASP A 167 ? PRO A 173 ? ASP A 197 PRO A 203 5 ? 7 HELX_P HELX_P7 AA7 LEU A 174 ? THR A 182 ? LEU A 204 THR A 212 1 ? 9 HELX_P HELX_P8 AA8 GLN B 18 ? ARG B 51 ? GLN U 636 ARG U 669 1 ? 34 HELX_P HELX_P9 AA9 SER B 55 ? ALA B 79 ? SER U 673 ALA U 697 1 ? 25 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 49 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 79 A ZN 301 1_555 ? ? ? ? ? ? ? 2.507 ? ? metalc2 metalc ? ? A CYS 54 SG ? ? ? 1_555 C ZN . ZN ? ? A CYS 84 A ZN 301 1_555 ? ? ? ? ? ? ? 2.311 ? ? metalc3 metalc ? ? A HIS 131 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 161 A ZN 301 1_555 ? ? ? ? ? ? ? 2.029 ? ? metalc4 metalc ? ? A HIS 136 NE2 ? ? ? 1_555 C ZN . ZN ? ? A HIS 166 A ZN 301 1_555 ? ? ? ? ? ? ? 2.031 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # _struct_sheet.id AA1 _struct_sheet.type ? _struct_sheet.number_strands 2 _struct_sheet.details ? # _struct_sheet_order.sheet_id AA1 _struct_sheet_order.range_id_1 1 _struct_sheet_order.range_id_2 2 _struct_sheet_order.offset ? _struct_sheet_order.sense anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 SER A 58 ? ALA A 59 ? SER A 88 ALA A 89 AA1 2 TYR A 63 ? GLU A 64 ? TYR A 93 GLU A 94 # _pdbx_struct_sheet_hbond.sheet_id AA1 _pdbx_struct_sheet_hbond.range_id_1 1 _pdbx_struct_sheet_hbond.range_id_2 2 _pdbx_struct_sheet_hbond.range_1_label_atom_id N _pdbx_struct_sheet_hbond.range_1_label_comp_id ALA _pdbx_struct_sheet_hbond.range_1_label_asym_id A _pdbx_struct_sheet_hbond.range_1_label_seq_id 59 _pdbx_struct_sheet_hbond.range_1_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_1_auth_atom_id N _pdbx_struct_sheet_hbond.range_1_auth_comp_id ALA _pdbx_struct_sheet_hbond.range_1_auth_asym_id A _pdbx_struct_sheet_hbond.range_1_auth_seq_id 89 _pdbx_struct_sheet_hbond.range_2_label_atom_id O _pdbx_struct_sheet_hbond.range_2_label_comp_id TYR _pdbx_struct_sheet_hbond.range_2_label_asym_id A _pdbx_struct_sheet_hbond.range_2_label_seq_id 63 _pdbx_struct_sheet_hbond.range_2_PDB_ins_code ? _pdbx_struct_sheet_hbond.range_2_auth_atom_id O _pdbx_struct_sheet_hbond.range_2_auth_comp_id TYR _pdbx_struct_sheet_hbond.range_2_auth_asym_id A _pdbx_struct_sheet_hbond.range_2_auth_seq_id 93 # _struct_site.id AC1 _struct_site.pdbx_evidence_code Software _struct_site.pdbx_auth_asym_id A _struct_site.pdbx_auth_comp_id ZN _struct_site.pdbx_auth_seq_id 301 _struct_site.pdbx_auth_ins_code ? _struct_site.pdbx_num_residues 4 _struct_site.details 'binding site for residue ZN A 301' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 49 ? CYS A 79 . ? 1_555 ? 2 AC1 4 CYS A 54 ? CYS A 84 . ? 1_555 ? 3 AC1 4 HIS A 131 ? HIS A 161 . ? 1_555 ? 4 AC1 4 HIS A 136 ? HIS A 166 . ? 1_555 ? # _atom_sites.entry_id 5B5W _atom_sites.fract_transf_matrix[1][1] 0.012699 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.002697 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.013935 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.017670 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 31 ? ? ? A . n A 1 2 PRO 2 32 ? ? ? A . n A 1 3 GLU 3 33 ? ? ? A . n A 1 4 ALA 4 34 ? ? ? A . n A 1 5 THR 5 35 ? ? ? A . n A 1 6 LEU 6 36 ? ? ? A . n A 1 7 GLY 7 37 ? ? ? A . n A 1 8 SER 8 38 ? ? ? A . n A 1 9 GLY 9 39 39 GLY GLY A . n A 1 10 ASN 10 40 40 ASN ASN A . n A 1 11 LEU 11 41 41 LEU LEU A . n A 1 12 ARG 12 42 42 ARG ARG A . n A 1 13 MET 13 43 43 MET MET A . n A 1 14 ALA 14 44 44 ALA ALA A . n A 1 15 VAL 15 45 45 VAL VAL A . n A 1 16 MET 16 46 46 MET MET A . n A 1 17 LEU 17 47 47 LEU LEU A . n A 1 18 PRO 18 48 48 PRO PRO A . n A 1 19 GLU 19 49 49 GLU GLU A . n A 1 20 GLY 20 50 50 GLY GLY A . n A 1 21 GLU 21 51 51 GLU GLU A . n A 1 22 ASP 22 52 52 ASP ASP A . n A 1 23 LEU 23 53 53 LEU LEU A . n A 1 24 ASN 24 54 54 ASN ASN A . n A 1 25 GLU 25 55 55 GLU GLU A . n A 1 26 TRP 26 56 56 TRP TRP A . n A 1 27 VAL 27 57 57 VAL VAL A . n A 1 28 ALA 28 58 58 ALA ALA A . n A 1 29 VAL 29 59 59 VAL VAL A . n A 1 30 ASN 30 60 60 ASN ASN A . n A 1 31 THR 31 61 61 THR THR A . n A 1 32 VAL 32 62 62 VAL VAL A . n A 1 33 ASP 33 63 63 ASP ASP A . n A 1 34 PHE 34 64 64 PHE PHE A . n A 1 35 PHE 35 65 65 PHE PHE A . n A 1 36 ASN 36 66 66 ASN ASN A . n A 1 37 GLN 37 67 67 GLN GLN A . n A 1 38 ILE 38 68 68 ILE ILE A . n A 1 39 ASN 39 69 69 ASN ASN A . n A 1 40 MET 40 70 70 MET MET A . n A 1 41 LEU 41 71 71 LEU LEU A . n A 1 42 TYR 42 72 72 TYR TYR A . n A 1 43 GLY 43 73 73 GLY GLY A . n A 1 44 THR 44 74 74 THR THR A . n A 1 45 ILE 45 75 75 ILE ILE A . n A 1 46 THR 46 76 76 THR THR A . n A 1 47 ASP 47 77 77 ASP ASP A . n A 1 48 PHE 48 78 78 PHE PHE A . n A 1 49 CYS 49 79 79 CYS CYS A . n A 1 50 THR 50 80 80 THR THR A . n A 1 51 GLU 51 81 81 GLU GLU A . n A 1 52 GLU 52 82 82 GLU GLU A . n A 1 53 SER 53 83 83 SER SER A . n A 1 54 CYS 54 84 84 CYS CYS A . n A 1 55 PRO 55 85 85 PRO PRO A . n A 1 56 VAL 56 86 86 VAL VAL A . n A 1 57 MET 57 87 87 MET MET A . n A 1 58 SER 58 88 88 SER SER A . n A 1 59 ALA 59 89 89 ALA ALA A . n A 1 60 GLY 60 90 90 GLY GLY A . n A 1 61 PRO 61 91 91 PRO PRO A . n A 1 62 LYS 62 92 92 LYS LYS A . n A 1 63 TYR 63 93 93 TYR TYR A . n A 1 64 GLU 64 94 94 GLU GLU A . n A 1 65 TYR 65 95 95 TYR TYR A . n A 1 66 HIS 66 96 96 HIS HIS A . n A 1 67 TRP 67 97 97 TRP TRP A . n A 1 68 ALA 68 98 98 ALA ALA A . n A 1 69 ASP 69 99 99 ASP ASP A . n A 1 70 GLY 70 100 100 GLY GLY A . n A 1 71 THR 71 101 ? ? ? A . n A 1 72 ASN 72 102 ? ? ? A . n A 1 73 ILE 73 103 ? ? ? A . n A 1 74 LYS 74 104 104 LYS LYS A . n A 1 75 LYS 75 105 105 LYS LYS A . n A 1 76 PRO 76 106 106 PRO PRO A . n A 1 77 ILE 77 107 107 ILE ILE A . n A 1 78 LYS 78 108 108 LYS LYS A . n A 1 79 CYS 79 109 109 CYS CYS A . n A 1 80 SER 80 110 110 SER SER A . n A 1 81 ALA 81 111 111 ALA ALA A . n A 1 82 PRO 82 112 112 PRO PRO A . n A 1 83 LYS 83 113 113 LYS LYS A . n A 1 84 TYR 84 114 114 TYR TYR A . n A 1 85 ILE 85 115 115 ILE ILE A . n A 1 86 ASP 86 116 116 ASP ASP A . n A 1 87 TYR 87 117 117 TYR TYR A . n A 1 88 LEU 88 118 118 LEU LEU A . n A 1 89 MET 89 119 119 MET MET A . n A 1 90 THR 90 120 120 THR THR A . n A 1 91 TRP 91 121 121 TRP TRP A . n A 1 92 VAL 92 122 122 VAL VAL A . n A 1 93 GLN 93 123 123 GLN GLN A . n A 1 94 ASP 94 124 124 ASP ASP A . n A 1 95 GLN 95 125 125 GLN GLN A . n A 1 96 LEU 96 126 126 LEU LEU A . n A 1 97 ASP 97 127 127 ASP ASP A . n A 1 98 ASP 98 128 128 ASP ASP A . n A 1 99 GLU 99 129 129 GLU GLU A . n A 1 100 THR 100 130 130 THR THR A . n A 1 101 LEU 101 131 131 LEU LEU A . n A 1 102 PHE 102 132 132 PHE PHE A . n A 1 103 PRO 103 133 133 PRO PRO A . n A 1 104 SER 104 134 134 SER SER A . n A 1 105 LYS 105 135 135 LYS LYS A . n A 1 106 ILE 106 136 136 ILE ILE A . n A 1 107 GLY 107 137 137 GLY GLY A . n A 1 108 VAL 108 138 138 VAL VAL A . n A 1 109 PRO 109 139 139 PRO PRO A . n A 1 110 PHE 110 140 140 PHE PHE A . n A 1 111 PRO 111 141 141 PRO PRO A . n A 1 112 LYS 112 142 142 LYS LYS A . n A 1 113 ASN 113 143 143 ASN ASN A . n A 1 114 PHE 114 144 144 PHE PHE A . n A 1 115 MET 115 145 145 MET MET A . n A 1 116 SER 116 146 146 SER SER A . n A 1 117 VAL 117 147 147 VAL VAL A . n A 1 118 ALA 118 148 148 ALA ALA A . n A 1 119 LYS 119 149 149 LYS LYS A . n A 1 120 THR 120 150 150 THR THR A . n A 1 121 ILE 121 151 151 ILE ILE A . n A 1 122 LEU 122 152 152 LEU LEU A . n A 1 123 LYS 123 153 153 LYS LYS A . n A 1 124 ARG 124 154 154 ARG ARG A . n A 1 125 LEU 125 155 155 LEU LEU A . n A 1 126 PHE 126 156 156 PHE PHE A . n A 1 127 ARG 127 157 157 ARG ARG A . n A 1 128 VAL 128 158 158 VAL VAL A . n A 1 129 TYR 129 159 159 TYR TYR A . n A 1 130 ALA 130 160 160 ALA ALA A . n A 1 131 HIS 131 161 161 HIS HIS A . n A 1 132 ILE 132 162 162 ILE ILE A . n A 1 133 TYR 133 163 163 TYR TYR A . n A 1 134 HIS 134 164 164 HIS HIS A . n A 1 135 GLN 135 165 165 GLN GLN A . n A 1 136 HIS 136 166 166 HIS HIS A . n A 1 137 PHE 137 167 167 PHE PHE A . n A 1 138 ASP 138 168 168 ASP ASP A . n A 1 139 PRO 139 169 169 PRO PRO A . n A 1 140 VAL 140 170 170 VAL VAL A . n A 1 141 ILE 141 171 171 ILE ILE A . n A 1 142 GLN 142 172 172 GLN GLN A . n A 1 143 LEU 143 173 173 LEU LEU A . n A 1 144 GLN 144 174 174 GLN GLN A . n A 1 145 GLU 145 175 175 GLU GLU A . n A 1 146 GLU 146 176 176 GLU GLU A . n A 1 147 ALA 147 177 177 ALA ALA A . n A 1 148 HIS 148 178 178 HIS HIS A . n A 1 149 LEU 149 179 179 LEU LEU A . n A 1 150 ASN 150 180 180 ASN ASN A . n A 1 151 THR 151 181 181 THR THR A . n A 1 152 SER 152 182 182 SER SER A . n A 1 153 PHE 153 183 183 PHE PHE A . n A 1 154 LYS 154 184 184 LYS LYS A . n A 1 155 HIS 155 185 185 HIS HIS A . n A 1 156 PHE 156 186 186 PHE PHE A . n A 1 157 ILE 157 187 187 ILE ILE A . n A 1 158 PHE 158 188 188 PHE PHE A . n A 1 159 PHE 159 189 189 PHE PHE A . n A 1 160 VAL 160 190 190 VAL VAL A . n A 1 161 GLN 161 191 191 GLN GLN A . n A 1 162 GLU 162 192 192 GLU GLU A . n A 1 163 PHE 163 193 193 PHE PHE A . n A 1 164 ASN 164 194 194 ASN ASN A . n A 1 165 LEU 165 195 195 LEU LEU A . n A 1 166 ILE 166 196 196 ILE ILE A . n A 1 167 ASP 167 197 197 ASP ASP A . n A 1 168 ARG 168 198 198 ARG ARG A . n A 1 169 ARG 169 199 199 ARG ARG A . n A 1 170 GLU 170 200 200 GLU GLU A . n A 1 171 LEU 171 201 201 LEU LEU A . n A 1 172 ALA 172 202 202 ALA ALA A . n A 1 173 PRO 173 203 203 PRO PRO A . n A 1 174 LEU 174 204 204 LEU LEU A . n A 1 175 GLN 175 205 205 GLN GLN A . n A 1 176 GLU 176 206 206 GLU GLU A . n A 1 177 LEU 177 207 207 LEU LEU A . n A 1 178 ILE 178 208 208 ILE ILE A . n A 1 179 GLU 179 209 209 GLU GLU A . n A 1 180 LYS 180 210 210 LYS LYS A . n A 1 181 LEU 181 211 211 LEU LEU A . n A 1 182 THR 182 212 212 THR THR A . n A 1 183 SER 183 213 213 SER SER A . n A 1 184 LYS 184 214 ? ? ? A . n A 1 185 ASP 185 215 ? ? ? A . n A 1 186 ARG 186 216 ? ? ? A . n B 2 1 GLY 1 619 ? ? ? U . n B 2 2 PRO 2 620 ? ? ? U . n B 2 3 LYS 3 621 ? ? ? U . n B 2 4 ASP 4 622 ? ? ? U . n B 2 5 GLU 5 623 ? ? ? U . n B 2 6 GLU 6 624 ? ? ? U . n B 2 7 ARG 7 625 ? ? ? U . n B 2 8 ARG 8 626 ? ? ? U . n B 2 9 GLU 9 627 ? ? ? U . n B 2 10 SER 10 628 ? ? ? U . n B 2 11 ARG 11 629 ? ? ? U . n B 2 12 ILE 12 630 ? ? ? U . n B 2 13 GLN 13 631 ? ? ? U . n B 2 14 SER 14 632 ? ? ? U . n B 2 15 TYR 15 633 ? ? ? U . n B 2 16 SER 16 634 ? ? ? U . n B 2 17 PRO 17 635 635 PRO PRO U . n B 2 18 GLN 18 636 636 GLN GLN U . n B 2 19 ALA 19 637 637 ALA ALA U . n B 2 20 PHE 20 638 638 PHE PHE U . n B 2 21 LYS 21 639 639 LYS LYS U . n B 2 22 PHE 22 640 640 PHE PHE U . n B 2 23 PHE 23 641 641 PHE PHE U . n B 2 24 MET 24 642 642 MET MET U . n B 2 25 GLU 25 643 643 GLU GLU U . n B 2 26 GLN 26 644 644 GLN GLN U . n B 2 27 HIS 27 645 645 HIS HIS U . n B 2 28 VAL 28 646 646 VAL VAL U . n B 2 29 GLU 29 647 647 GLU GLU U . n B 2 30 ASN 30 648 648 ASN ASN U . n B 2 31 VAL 31 649 649 VAL VAL U . n B 2 32 LEU 32 650 650 LEU LEU U . n B 2 33 LYS 33 651 651 LYS LYS U . n B 2 34 SER 34 652 652 SER SER U . n B 2 35 HIS 35 653 653 HIS HIS U . n B 2 36 GLN 36 654 654 GLN GLN U . n B 2 37 GLN 37 655 655 GLN GLN U . n B 2 38 ARG 38 656 656 ARG ARG U . n B 2 39 LEU 39 657 657 LEU LEU U . n B 2 40 HIS 40 658 658 HIS HIS U . n B 2 41 ARG 41 659 659 ARG ARG U . n B 2 42 LYS 42 660 660 LYS LYS U . n B 2 43 LYS 43 661 661 LYS LYS U . n B 2 44 GLN 44 662 662 GLN GLN U . n B 2 45 LEU 45 663 663 LEU LEU U . n B 2 46 GLU 46 664 664 GLU GLU U . n B 2 47 ASN 47 665 665 ASN ASN U . n B 2 48 GLU 48 666 666 GLU GLU U . n B 2 49 MET 49 667 667 MET MET U . n B 2 50 MET 50 668 668 MET MET U . n B 2 51 ARG 51 669 669 ARG ARG U . n B 2 52 VAL 52 670 670 VAL VAL U . n B 2 53 GLY 53 671 671 GLY GLY U . n B 2 54 LEU 54 672 672 LEU LEU U . n B 2 55 SER 55 673 673 SER SER U . n B 2 56 GLN 56 674 674 GLN GLN U . n B 2 57 ASP 57 675 675 ASP ASP U . n B 2 58 ALA 58 676 676 ALA ALA U . n B 2 59 GLN 59 677 677 GLN GLN U . n B 2 60 ASP 60 678 678 ASP ASP U . n B 2 61 GLN 61 679 679 GLN GLN U . n B 2 62 MET 62 680 680 MET MET U . n B 2 63 ARG 63 681 681 ARG ARG U . n B 2 64 LYS 64 682 682 LYS LYS U . n B 2 65 MET 65 683 683 MET MET U . n B 2 66 LEU 66 684 684 LEU LEU U . n B 2 67 CYS 67 685 685 CYS CYS U . n B 2 68 GLN 68 686 686 GLN GLN U . n B 2 69 LYS 69 687 687 LYS LYS U . n B 2 70 GLU 70 688 688 GLU GLU U . n B 2 71 SER 71 689 689 SER SER U . n B 2 72 ASN 72 690 690 ASN ASN U . n B 2 73 TYR 73 691 691 TYR TYR U . n B 2 74 ILE 74 692 692 ILE ILE U . n B 2 75 ARG 75 693 693 ARG ARG U . n B 2 76 LEU 76 694 694 LEU LEU U . n B 2 77 LYS 77 695 695 LYS LYS U . n B 2 78 ARG 78 696 696 ARG ARG U . n B 2 79 ALA 79 697 697 ALA ALA U . n B 2 80 LYS 80 698 698 LYS LYS U . n B 2 81 MET 81 699 ? ? ? U . n B 2 82 ASP 82 700 ? ? ? U . n B 2 83 LYS 83 701 ? ? ? U . n B 2 84 SER 84 702 ? ? ? U . n B 2 85 MET 85 703 ? ? ? U . n # _pdbx_nonpoly_scheme.asym_id C _pdbx_nonpoly_scheme.entity_id 3 _pdbx_nonpoly_scheme.mon_id ZN _pdbx_nonpoly_scheme.ndb_seq_num 1 _pdbx_nonpoly_scheme.pdb_seq_num 301 _pdbx_nonpoly_scheme.auth_seq_num 1 _pdbx_nonpoly_scheme.pdb_mon_id ZN _pdbx_nonpoly_scheme.auth_mon_id ZN _pdbx_nonpoly_scheme.pdb_strand_id A _pdbx_nonpoly_scheme.pdb_ins_code . # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1 _pdbx_struct_assembly_gen.asym_id_list A,B,C # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2480 ? 1 MORE -16 ? 1 'SSA (A^2)' 13520 ? # _pdbx_struct_oper_list.id 1 _pdbx_struct_oper_list.type 'identity operation' _pdbx_struct_oper_list.name 1_555 _pdbx_struct_oper_list.symmetry_operation x,y,z _pdbx_struct_oper_list.matrix[1][1] 1.0000000000 _pdbx_struct_oper_list.matrix[1][2] 0.0000000000 _pdbx_struct_oper_list.matrix[1][3] 0.0000000000 _pdbx_struct_oper_list.vector[1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][1] 0.0000000000 _pdbx_struct_oper_list.matrix[2][2] 1.0000000000 _pdbx_struct_oper_list.matrix[2][3] 0.0000000000 _pdbx_struct_oper_list.vector[2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][1] 0.0000000000 _pdbx_struct_oper_list.matrix[3][2] 0.0000000000 _pdbx_struct_oper_list.matrix[3][3] 1.0000000000 _pdbx_struct_oper_list.vector[3] 0.0000000000 # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 49 ? A CYS 79 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 SG ? A CYS 54 ? A CYS 84 ? 1_555 111.3 ? 2 SG ? A CYS 49 ? A CYS 79 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 131 ? A HIS 161 ? 1_555 110.9 ? 3 SG ? A CYS 54 ? A CYS 84 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 131 ? A HIS 161 ? 1_555 107.1 ? 4 SG ? A CYS 49 ? A CYS 79 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 136 ? A HIS 166 ? 1_555 140.9 ? 5 SG ? A CYS 54 ? A CYS 84 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 136 ? A HIS 166 ? 1_555 85.5 ? 6 NE2 ? A HIS 131 ? A HIS 161 ? 1_555 ZN ? C ZN . ? A ZN 301 ? 1_555 NE2 ? A HIS 136 ? A HIS 166 ? 1_555 96.1 ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-07-06 2 'Structure model' 1 1 2020-02-26 3 'Structure model' 1 2 2023-11-08 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' Advisory 2 2 'Structure model' 'Data collection' 3 2 'Structure model' 'Derived calculations' 4 3 'Structure model' Advisory 5 3 'Structure model' 'Data collection' 6 3 'Structure model' 'Database references' 7 3 'Structure model' 'Refinement description' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 2 'Structure model' diffrn_source 2 2 'Structure model' pdbx_struct_oper_list 3 2 'Structure model' pdbx_unobs_or_zero_occ_atoms 4 3 'Structure model' chem_comp_atom 5 3 'Structure model' chem_comp_bond 6 3 'Structure model' database_2 7 3 'Structure model' pdbx_initial_refinement_model 8 3 'Structure model' pdbx_unobs_or_zero_occ_atoms # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 2 'Structure model' '_diffrn_source.pdbx_synchrotron_site' 2 2 'Structure model' '_pdbx_struct_oper_list.symmetry_operation' 3 3 'Structure model' '_database_2.pdbx_DOI' 4 3 'Structure model' '_database_2.pdbx_database_accession' # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 4 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 GLU A 81 ? ? 68.50 -12.76 2 1 HIS A 164 ? ? -91.00 -65.44 3 1 GLN A 174 ? ? -65.61 98.98 4 1 GLU A 175 ? ? -148.72 -13.09 5 1 ILE A 208 ? ? -49.29 -72.68 6 1 ALA U 697 ? ? -98.06 -102.92 # _pdbx_unobs_or_zero_occ_atoms.id 1 _pdbx_unobs_or_zero_occ_atoms.PDB_model_num 1 _pdbx_unobs_or_zero_occ_atoms.polymer_flag Y _pdbx_unobs_or_zero_occ_atoms.occupancy_flag 0 _pdbx_unobs_or_zero_occ_atoms.auth_asym_id A _pdbx_unobs_or_zero_occ_atoms.auth_comp_id TYR _pdbx_unobs_or_zero_occ_atoms.auth_seq_id 117 _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code ? _pdbx_unobs_or_zero_occ_atoms.auth_atom_id CE1 _pdbx_unobs_or_zero_occ_atoms.label_alt_id ? _pdbx_unobs_or_zero_occ_atoms.label_asym_id A _pdbx_unobs_or_zero_occ_atoms.label_comp_id TYR _pdbx_unobs_or_zero_occ_atoms.label_seq_id 87 _pdbx_unobs_or_zero_occ_atoms.label_atom_id CE1 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 31 ? A GLY 1 2 1 Y 1 A PRO 32 ? A PRO 2 3 1 Y 1 A GLU 33 ? A GLU 3 4 1 Y 1 A ALA 34 ? A ALA 4 5 1 Y 1 A THR 35 ? A THR 5 6 1 Y 1 A LEU 36 ? A LEU 6 7 1 Y 1 A GLY 37 ? A GLY 7 8 1 Y 1 A SER 38 ? A SER 8 9 1 Y 1 A THR 101 ? A THR 71 10 1 Y 1 A ASN 102 ? A ASN 72 11 1 Y 1 A ILE 103 ? A ILE 73 12 1 Y 1 A LYS 214 ? A LYS 184 13 1 Y 1 A ASP 215 ? A ASP 185 14 1 Y 1 A ARG 216 ? A ARG 186 15 1 Y 1 U GLY 619 ? B GLY 1 16 1 Y 1 U PRO 620 ? B PRO 2 17 1 Y 1 U LYS 621 ? B LYS 3 18 1 Y 1 U ASP 622 ? B ASP 4 19 1 Y 1 U GLU 623 ? B GLU 5 20 1 Y 1 U GLU 624 ? B GLU 6 21 1 Y 1 U ARG 625 ? B ARG 7 22 1 Y 1 U ARG 626 ? B ARG 8 23 1 Y 1 U GLU 627 ? B GLU 9 24 1 Y 1 U SER 628 ? B SER 10 25 1 Y 1 U ARG 629 ? B ARG 11 26 1 Y 1 U ILE 630 ? B ILE 12 27 1 Y 1 U GLN 631 ? B GLN 13 28 1 Y 1 U SER 632 ? B SER 14 29 1 Y 1 U TYR 633 ? B TYR 15 30 1 Y 1 U SER 634 ? B SER 16 31 1 Y 1 U MET 699 ? B MET 81 32 1 Y 1 U ASP 700 ? B ASP 82 33 1 Y 1 U LYS 701 ? B LYS 83 34 1 Y 1 U SER 702 ? B SER 84 35 1 Y 1 U MET 703 ? B MET 85 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 ILE N N N N 158 ILE CA C N S 159 ILE C C N N 160 ILE O O N N 161 ILE CB C N S 162 ILE CG1 C N N 163 ILE CG2 C N N 164 ILE CD1 C N N 165 ILE OXT O N N 166 ILE H H N N 167 ILE H2 H N N 168 ILE HA H N N 169 ILE HB H N N 170 ILE HG12 H N N 171 ILE HG13 H N N 172 ILE HG21 H N N 173 ILE HG22 H N N 174 ILE HG23 H N N 175 ILE HD11 H N N 176 ILE HD12 H N N 177 ILE HD13 H N N 178 ILE HXT H N N 179 LEU N N N N 180 LEU CA C N S 181 LEU C C N N 182 LEU O O N N 183 LEU CB C N N 184 LEU CG C N N 185 LEU CD1 C N N 186 LEU CD2 C N N 187 LEU OXT O N N 188 LEU H H N N 189 LEU H2 H N N 190 LEU HA H N N 191 LEU HB2 H N N 192 LEU HB3 H N N 193 LEU HG H N N 194 LEU HD11 H N N 195 LEU HD12 H N N 196 LEU HD13 H N N 197 LEU HD21 H N N 198 LEU HD22 H N N 199 LEU HD23 H N N 200 LEU HXT H N N 201 LYS N N N N 202 LYS CA C N S 203 LYS C C N N 204 LYS O O N N 205 LYS CB C N N 206 LYS CG C N N 207 LYS CD C N N 208 LYS CE C N N 209 LYS NZ N N N 210 LYS OXT O N N 211 LYS H H N N 212 LYS H2 H N N 213 LYS HA H N N 214 LYS HB2 H N N 215 LYS HB3 H N N 216 LYS HG2 H N N 217 LYS HG3 H N N 218 LYS HD2 H N N 219 LYS HD3 H N N 220 LYS HE2 H N N 221 LYS HE3 H N N 222 LYS HZ1 H N N 223 LYS HZ2 H N N 224 LYS HZ3 H N N 225 LYS HXT H N N 226 MET N N N N 227 MET CA C N S 228 MET C C N N 229 MET O O N N 230 MET CB C N N 231 MET CG C N N 232 MET SD S N N 233 MET CE C N N 234 MET OXT O N N 235 MET H H N N 236 MET H2 H N N 237 MET HA H N N 238 MET HB2 H N N 239 MET HB3 H N N 240 MET HG2 H N N 241 MET HG3 H N N 242 MET HE1 H N N 243 MET HE2 H N N 244 MET HE3 H N N 245 MET HXT H N N 246 PHE N N N N 247 PHE CA C N S 248 PHE C C N N 249 PHE O O N N 250 PHE CB C N N 251 PHE CG C Y N 252 PHE CD1 C Y N 253 PHE CD2 C Y N 254 PHE CE1 C Y N 255 PHE CE2 C Y N 256 PHE CZ C Y N 257 PHE OXT O N N 258 PHE H H N N 259 PHE H2 H N N 260 PHE HA H N N 261 PHE HB2 H N N 262 PHE HB3 H N N 263 PHE HD1 H N N 264 PHE HD2 H N N 265 PHE HE1 H N N 266 PHE HE2 H N N 267 PHE HZ H N N 268 PHE HXT H N N 269 PRO N N N N 270 PRO CA C N S 271 PRO C C N N 272 PRO O O N N 273 PRO CB C N N 274 PRO CG C N N 275 PRO CD C N N 276 PRO OXT O N N 277 PRO H H N N 278 PRO HA H N N 279 PRO HB2 H N N 280 PRO HB3 H N N 281 PRO HG2 H N N 282 PRO HG3 H N N 283 PRO HD2 H N N 284 PRO HD3 H N N 285 PRO HXT H N N 286 SER N N N N 287 SER CA C N S 288 SER C C N N 289 SER O O N N 290 SER CB C N N 291 SER OG O N N 292 SER OXT O N N 293 SER H H N N 294 SER H2 H N N 295 SER HA H N N 296 SER HB2 H N N 297 SER HB3 H N N 298 SER HG H N N 299 SER HXT H N N 300 THR N N N N 301 THR CA C N S 302 THR C C N N 303 THR O O N N 304 THR CB C N R 305 THR OG1 O N N 306 THR CG2 C N N 307 THR OXT O N N 308 THR H H N N 309 THR H2 H N N 310 THR HA H N N 311 THR HB H N N 312 THR HG1 H N N 313 THR HG21 H N N 314 THR HG22 H N N 315 THR HG23 H N N 316 THR HXT H N N 317 TRP N N N N 318 TRP CA C N S 319 TRP C C N N 320 TRP O O N N 321 TRP CB C N N 322 TRP CG C Y N 323 TRP CD1 C Y N 324 TRP CD2 C Y N 325 TRP NE1 N Y N 326 TRP CE2 C Y N 327 TRP CE3 C Y N 328 TRP CZ2 C Y N 329 TRP CZ3 C Y N 330 TRP CH2 C Y N 331 TRP OXT O N N 332 TRP H H N N 333 TRP H2 H N N 334 TRP HA H N N 335 TRP HB2 H N N 336 TRP HB3 H N N 337 TRP HD1 H N N 338 TRP HE1 H N N 339 TRP HE3 H N N 340 TRP HZ2 H N N 341 TRP HZ3 H N N 342 TRP HH2 H N N 343 TRP HXT H N N 344 TYR N N N N 345 TYR CA C N S 346 TYR C C N N 347 TYR O O N N 348 TYR CB C N N 349 TYR CG C Y N 350 TYR CD1 C Y N 351 TYR CD2 C Y N 352 TYR CE1 C Y N 353 TYR CE2 C Y N 354 TYR CZ C Y N 355 TYR OH O N N 356 TYR OXT O N N 357 TYR H H N N 358 TYR H2 H N N 359 TYR HA H N N 360 TYR HB2 H N N 361 TYR HB3 H N N 362 TYR HD1 H N N 363 TYR HD2 H N N 364 TYR HE1 H N N 365 TYR HE2 H N N 366 TYR HH H N N 367 TYR HXT H N N 368 VAL N N N N 369 VAL CA C N S 370 VAL C C N N 371 VAL O O N N 372 VAL CB C N N 373 VAL CG1 C N N 374 VAL CG2 C N N 375 VAL OXT O N N 376 VAL H H N N 377 VAL H2 H N N 378 VAL HA H N N 379 VAL HB H N N 380 VAL HG11 H N N 381 VAL HG12 H N N 382 VAL HG13 H N N 383 VAL HG21 H N N 384 VAL HG22 H N N 385 VAL HG23 H N N 386 VAL HXT H N N 387 ZN ZN ZN N N 388 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 ILE N CA sing N N 150 ILE N H sing N N 151 ILE N H2 sing N N 152 ILE CA C sing N N 153 ILE CA CB sing N N 154 ILE CA HA sing N N 155 ILE C O doub N N 156 ILE C OXT sing N N 157 ILE CB CG1 sing N N 158 ILE CB CG2 sing N N 159 ILE CB HB sing N N 160 ILE CG1 CD1 sing N N 161 ILE CG1 HG12 sing N N 162 ILE CG1 HG13 sing N N 163 ILE CG2 HG21 sing N N 164 ILE CG2 HG22 sing N N 165 ILE CG2 HG23 sing N N 166 ILE CD1 HD11 sing N N 167 ILE CD1 HD12 sing N N 168 ILE CD1 HD13 sing N N 169 ILE OXT HXT sing N N 170 LEU N CA sing N N 171 LEU N H sing N N 172 LEU N H2 sing N N 173 LEU CA C sing N N 174 LEU CA CB sing N N 175 LEU CA HA sing N N 176 LEU C O doub N N 177 LEU C OXT sing N N 178 LEU CB CG sing N N 179 LEU CB HB2 sing N N 180 LEU CB HB3 sing N N 181 LEU CG CD1 sing N N 182 LEU CG CD2 sing N N 183 LEU CG HG sing N N 184 LEU CD1 HD11 sing N N 185 LEU CD1 HD12 sing N N 186 LEU CD1 HD13 sing N N 187 LEU CD2 HD21 sing N N 188 LEU CD2 HD22 sing N N 189 LEU CD2 HD23 sing N N 190 LEU OXT HXT sing N N 191 LYS N CA sing N N 192 LYS N H sing N N 193 LYS N H2 sing N N 194 LYS CA C sing N N 195 LYS CA CB sing N N 196 LYS CA HA sing N N 197 LYS C O doub N N 198 LYS C OXT sing N N 199 LYS CB CG sing N N 200 LYS CB HB2 sing N N 201 LYS CB HB3 sing N N 202 LYS CG CD sing N N 203 LYS CG HG2 sing N N 204 LYS CG HG3 sing N N 205 LYS CD CE sing N N 206 LYS CD HD2 sing N N 207 LYS CD HD3 sing N N 208 LYS CE NZ sing N N 209 LYS CE HE2 sing N N 210 LYS CE HE3 sing N N 211 LYS NZ HZ1 sing N N 212 LYS NZ HZ2 sing N N 213 LYS NZ HZ3 sing N N 214 LYS OXT HXT sing N N 215 MET N CA sing N N 216 MET N H sing N N 217 MET N H2 sing N N 218 MET CA C sing N N 219 MET CA CB sing N N 220 MET CA HA sing N N 221 MET C O doub N N 222 MET C OXT sing N N 223 MET CB CG sing N N 224 MET CB HB2 sing N N 225 MET CB HB3 sing N N 226 MET CG SD sing N N 227 MET CG HG2 sing N N 228 MET CG HG3 sing N N 229 MET SD CE sing N N 230 MET CE HE1 sing N N 231 MET CE HE2 sing N N 232 MET CE HE3 sing N N 233 MET OXT HXT sing N N 234 PHE N CA sing N N 235 PHE N H sing N N 236 PHE N H2 sing N N 237 PHE CA C sing N N 238 PHE CA CB sing N N 239 PHE CA HA sing N N 240 PHE C O doub N N 241 PHE C OXT sing N N 242 PHE CB CG sing N N 243 PHE CB HB2 sing N N 244 PHE CB HB3 sing N N 245 PHE CG CD1 doub Y N 246 PHE CG CD2 sing Y N 247 PHE CD1 CE1 sing Y N 248 PHE CD1 HD1 sing N N 249 PHE CD2 CE2 doub Y N 250 PHE CD2 HD2 sing N N 251 PHE CE1 CZ doub Y N 252 PHE CE1 HE1 sing N N 253 PHE CE2 CZ sing Y N 254 PHE CE2 HE2 sing N N 255 PHE CZ HZ sing N N 256 PHE OXT HXT sing N N 257 PRO N CA sing N N 258 PRO N CD sing N N 259 PRO N H sing N N 260 PRO CA C sing N N 261 PRO CA CB sing N N 262 PRO CA HA sing N N 263 PRO C O doub N N 264 PRO C OXT sing N N 265 PRO CB CG sing N N 266 PRO CB HB2 sing N N 267 PRO CB HB3 sing N N 268 PRO CG CD sing N N 269 PRO CG HG2 sing N N 270 PRO CG HG3 sing N N 271 PRO CD HD2 sing N N 272 PRO CD HD3 sing N N 273 PRO OXT HXT sing N N 274 SER N CA sing N N 275 SER N H sing N N 276 SER N H2 sing N N 277 SER CA C sing N N 278 SER CA CB sing N N 279 SER CA HA sing N N 280 SER C O doub N N 281 SER C OXT sing N N 282 SER CB OG sing N N 283 SER CB HB2 sing N N 284 SER CB HB3 sing N N 285 SER OG HG sing N N 286 SER OXT HXT sing N N 287 THR N CA sing N N 288 THR N H sing N N 289 THR N H2 sing N N 290 THR CA C sing N N 291 THR CA CB sing N N 292 THR CA HA sing N N 293 THR C O doub N N 294 THR C OXT sing N N 295 THR CB OG1 sing N N 296 THR CB CG2 sing N N 297 THR CB HB sing N N 298 THR OG1 HG1 sing N N 299 THR CG2 HG21 sing N N 300 THR CG2 HG22 sing N N 301 THR CG2 HG23 sing N N 302 THR OXT HXT sing N N 303 TRP N CA sing N N 304 TRP N H sing N N 305 TRP N H2 sing N N 306 TRP CA C sing N N 307 TRP CA CB sing N N 308 TRP CA HA sing N N 309 TRP C O doub N N 310 TRP C OXT sing N N 311 TRP CB CG sing N N 312 TRP CB HB2 sing N N 313 TRP CB HB3 sing N N 314 TRP CG CD1 doub Y N 315 TRP CG CD2 sing Y N 316 TRP CD1 NE1 sing Y N 317 TRP CD1 HD1 sing N N 318 TRP CD2 CE2 doub Y N 319 TRP CD2 CE3 sing Y N 320 TRP NE1 CE2 sing Y N 321 TRP NE1 HE1 sing N N 322 TRP CE2 CZ2 sing Y N 323 TRP CE3 CZ3 doub Y N 324 TRP CE3 HE3 sing N N 325 TRP CZ2 CH2 doub Y N 326 TRP CZ2 HZ2 sing N N 327 TRP CZ3 CH2 sing Y N 328 TRP CZ3 HZ3 sing N N 329 TRP CH2 HH2 sing N N 330 TRP OXT HXT sing N N 331 TYR N CA sing N N 332 TYR N H sing N N 333 TYR N H2 sing N N 334 TYR CA C sing N N 335 TYR CA CB sing N N 336 TYR CA HA sing N N 337 TYR C O doub N N 338 TYR C OXT sing N N 339 TYR CB CG sing N N 340 TYR CB HB2 sing N N 341 TYR CB HB3 sing N N 342 TYR CG CD1 doub Y N 343 TYR CG CD2 sing Y N 344 TYR CD1 CE1 sing Y N 345 TYR CD1 HD1 sing N N 346 TYR CD2 CE2 doub Y N 347 TYR CD2 HD2 sing N N 348 TYR CE1 CZ doub Y N 349 TYR CE1 HE1 sing N N 350 TYR CE2 CZ sing Y N 351 TYR CE2 HE2 sing N N 352 TYR CZ OH sing N N 353 TYR OH HH sing N N 354 TYR OXT HXT sing N N 355 VAL N CA sing N N 356 VAL N H sing N N 357 VAL N H2 sing N N 358 VAL CA C sing N N 359 VAL CA CB sing N N 360 VAL CA HA sing N N 361 VAL C O doub N N 362 VAL C OXT sing N N 363 VAL CB CG1 sing N N 364 VAL CB CG2 sing N N 365 VAL CB HB sing N N 366 VAL CG1 HG11 sing N N 367 VAL CG1 HG12 sing N N 368 VAL CG1 HG13 sing N N 369 VAL CG2 HG21 sing N N 370 VAL CG2 HG22 sing N N 371 VAL CG2 HG23 sing N N 372 VAL OXT HXT sing N N 373 # _pdbx_entity_nonpoly.entity_id 3 _pdbx_entity_nonpoly.name 'ZINC ION' _pdbx_entity_nonpoly.comp_id ZN # _pdbx_initial_refinement_model.id 1 _pdbx_initial_refinement_model.entity_id_list ? _pdbx_initial_refinement_model.type 'experimental model' _pdbx_initial_refinement_model.source_name PDB _pdbx_initial_refinement_model.accession_code 1PI1 _pdbx_initial_refinement_model.details ? #