data_5B5X # _entry.id 5B5X # _audit_conform.dict_name mmcif_pdbx.dic _audit_conform.dict_version 5.387 _audit_conform.dict_location http://mmcif.pdb.org/dictionaries/ascii/mmcif_pdbx.dic # loop_ _database_2.database_id _database_2.database_code _database_2.pdbx_database_accession _database_2.pdbx_DOI PDB 5B5X pdb_00005b5x 10.2210/pdb5b5x/pdb WWPDB D_1300000591 ? ? # loop_ _pdbx_audit_revision_history.ordinal _pdbx_audit_revision_history.data_content_type _pdbx_audit_revision_history.major_revision _pdbx_audit_revision_history.minor_revision _pdbx_audit_revision_history.revision_date 1 'Structure model' 1 0 2016-12-07 2 'Structure model' 1 1 2017-01-18 3 'Structure model' 1 2 2024-03-20 # _pdbx_audit_revision_details.ordinal 1 _pdbx_audit_revision_details.revision_ordinal 1 _pdbx_audit_revision_details.data_content_type 'Structure model' _pdbx_audit_revision_details.provider repository _pdbx_audit_revision_details.type 'Initial release' _pdbx_audit_revision_details.description ? _pdbx_audit_revision_details.details ? # loop_ _pdbx_audit_revision_group.ordinal _pdbx_audit_revision_group.revision_ordinal _pdbx_audit_revision_group.data_content_type _pdbx_audit_revision_group.group 1 2 'Structure model' 'Database references' 2 3 'Structure model' 'Data collection' 3 3 'Structure model' 'Database references' # loop_ _pdbx_audit_revision_category.ordinal _pdbx_audit_revision_category.revision_ordinal _pdbx_audit_revision_category.data_content_type _pdbx_audit_revision_category.category 1 3 'Structure model' chem_comp_atom 2 3 'Structure model' chem_comp_bond 3 3 'Structure model' database_2 # loop_ _pdbx_audit_revision_item.ordinal _pdbx_audit_revision_item.revision_ordinal _pdbx_audit_revision_item.data_content_type _pdbx_audit_revision_item.item 1 3 'Structure model' '_database_2.pdbx_DOI' 2 3 'Structure model' '_database_2.pdbx_database_accession' # _pdbx_database_status.status_code REL _pdbx_database_status.status_code_sf REL _pdbx_database_status.status_code_mr ? _pdbx_database_status.entry_id 5B5X _pdbx_database_status.recvd_initial_deposition_date 2016-05-24 _pdbx_database_status.SG_entry N _pdbx_database_status.deposit_site PDBJ _pdbx_database_status.process_site PDBJ _pdbx_database_status.status_code_cs ? _pdbx_database_status.methods_development_category ? _pdbx_database_status.pdb_format_compatible Y _pdbx_database_status.status_code_nmr_data ? # loop_ _pdbx_database_related.db_name _pdbx_database_related.details _pdbx_database_related.db_id _pdbx_database_related.content_type PDB . 5K5W unspecified PDB . 5B5Y unspecified PDB . 5B5Z unspecified PDB . 5B60 unspecified # loop_ _audit_author.name _audit_author.pdbx_ordinal 'Jin, S.' 1 'Sun, J.' 2 'Wunder, T.' 3 'Tang, D.' 4 'Mueller-Cajar, O.M.' 5 'Gao, Y.' 6 # _citation.abstract ? _citation.abstract_id_CAS ? _citation.book_id_ISBN ? _citation.book_publisher ? _citation.book_publisher_city ? _citation.book_title ? _citation.coordinate_linkage ? _citation.country US _citation.database_id_Medline ? _citation.details ? _citation.id primary _citation.journal_abbrev 'Proc. Natl. Acad. Sci. U.S.A.' _citation.journal_id_ASTM PNASA6 _citation.journal_id_CSD 0040 _citation.journal_id_ISSN 1091-6490 _citation.journal_full ? _citation.journal_issue ? _citation.journal_volume 113 _citation.language ? _citation.page_first 14716 _citation.page_last 14721 _citation.title 'Structural insights into the LCIB protein family reveals a new group of beta-carbonic anhydrases' _citation.year 2016 _citation.database_id_CSD ? _citation.pdbx_database_id_DOI 10.1073/pnas.1616294113 _citation.pdbx_database_id_PubMed 27911826 _citation.unpublished_flag ? # loop_ _citation_author.citation_id _citation_author.name _citation_author.ordinal _citation_author.identifier_ORCID primary 'Jin, S.' 1 ? primary 'Sun, J.' 2 ? primary 'Wunder, T.' 3 ? primary 'Tang, D.' 4 ? primary 'Cousins, A.B.' 5 ? primary 'Sze, S.K.' 6 ? primary 'Mueller-Cajar, O.' 7 ? primary 'Gao, Y.G.' 8 ? # loop_ _entity.id _entity.type _entity.src_method _entity.pdbx_description _entity.formula_weight _entity.pdbx_number_of_molecules _entity.pdbx_ec _entity.pdbx_mutation _entity.pdbx_fragment _entity.details 1 polymer man 'limiting CO2-inducible protein LCIC' 33254.035 1 ? ? 'UNP residues 40-344' ? 2 non-polymer man 'ZINC ION' 65.409 1 ? ? ? ? 3 non-polymer man 'SULFATE ION' 96.063 1 ? ? ? ? 4 water nat water 18.015 14 ? ? ? ? # _entity_name_com.entity_id 1 _entity_name_com.name 'Low-CO2 inducible protein LCIC, carbon dioxide concentrating mechanism related protein 2' # _entity_poly.entity_id 1 _entity_poly.type 'polypeptide(L)' _entity_poly.nstd_linkage no _entity_poly.nstd_monomer no _entity_poly.pdbx_seq_one_letter_code ;GHMASQALTVSQSKAVAPSNGAPAPLAQVEEVDIARHMNDRHAHILRYFPTALGVDDFMARTEIVLGGFGFTGDNTIAMT NLCRDEVTQVVKDKIEAAFGSSFNTNGLGAVLTCGVTGMKAGLSHSPVCAGGRERYVFFAFPHIAINSEGEVGAISRPGR PKMSCACGALQKCLVELKAEGVDAAVRAPGLHDPIEPEYSILKQRLARRIRYEKLDPQLMDLPSLTALAERTISDDLEYL IEKAVNPATSDYAVITGVEIHNWAAHLEEGGDPSMEFIAPTKAYVVVNGVKTHLDLMMVPPMSFRQLQ ; _entity_poly.pdbx_seq_one_letter_code_can ;GHMASQALTVSQSKAVAPSNGAPAPLAQVEEVDIARHMNDRHAHILRYFPTALGVDDFMARTEIVLGGFGFTGDNTIAMT NLCRDEVTQVVKDKIEAAFGSSFNTNGLGAVLTCGVTGMKAGLSHSPVCAGGRERYVFFAFPHIAINSEGEVGAISRPGR PKMSCACGALQKCLVELKAEGVDAAVRAPGLHDPIEPEYSILKQRLARRIRYEKLDPQLMDLPSLTALAERTISDDLEYL IEKAVNPATSDYAVITGVEIHNWAAHLEEGGDPSMEFIAPTKAYVVVNGVKTHLDLMMVPPMSFRQLQ ; _entity_poly.pdbx_strand_id A _entity_poly.pdbx_target_identifier ? # loop_ _pdbx_entity_nonpoly.entity_id _pdbx_entity_nonpoly.name _pdbx_entity_nonpoly.comp_id 2 'ZINC ION' ZN 3 'SULFATE ION' SO4 4 water HOH # loop_ _entity_poly_seq.entity_id _entity_poly_seq.num _entity_poly_seq.mon_id _entity_poly_seq.hetero 1 1 GLY n 1 2 HIS n 1 3 MET n 1 4 ALA n 1 5 SER n 1 6 GLN n 1 7 ALA n 1 8 LEU n 1 9 THR n 1 10 VAL n 1 11 SER n 1 12 GLN n 1 13 SER n 1 14 LYS n 1 15 ALA n 1 16 VAL n 1 17 ALA n 1 18 PRO n 1 19 SER n 1 20 ASN n 1 21 GLY n 1 22 ALA n 1 23 PRO n 1 24 ALA n 1 25 PRO n 1 26 LEU n 1 27 ALA n 1 28 GLN n 1 29 VAL n 1 30 GLU n 1 31 GLU n 1 32 VAL n 1 33 ASP n 1 34 ILE n 1 35 ALA n 1 36 ARG n 1 37 HIS n 1 38 MET n 1 39 ASN n 1 40 ASP n 1 41 ARG n 1 42 HIS n 1 43 ALA n 1 44 HIS n 1 45 ILE n 1 46 LEU n 1 47 ARG n 1 48 TYR n 1 49 PHE n 1 50 PRO n 1 51 THR n 1 52 ALA n 1 53 LEU n 1 54 GLY n 1 55 VAL n 1 56 ASP n 1 57 ASP n 1 58 PHE n 1 59 MET n 1 60 ALA n 1 61 ARG n 1 62 THR n 1 63 GLU n 1 64 ILE n 1 65 VAL n 1 66 LEU n 1 67 GLY n 1 68 GLY n 1 69 PHE n 1 70 GLY n 1 71 PHE n 1 72 THR n 1 73 GLY n 1 74 ASP n 1 75 ASN n 1 76 THR n 1 77 ILE n 1 78 ALA n 1 79 MET n 1 80 THR n 1 81 ASN n 1 82 LEU n 1 83 CYS n 1 84 ARG n 1 85 ASP n 1 86 GLU n 1 87 VAL n 1 88 THR n 1 89 GLN n 1 90 VAL n 1 91 VAL n 1 92 LYS n 1 93 ASP n 1 94 LYS n 1 95 ILE n 1 96 GLU n 1 97 ALA n 1 98 ALA n 1 99 PHE n 1 100 GLY n 1 101 SER n 1 102 SER n 1 103 PHE n 1 104 ASN n 1 105 THR n 1 106 ASN n 1 107 GLY n 1 108 LEU n 1 109 GLY n 1 110 ALA n 1 111 VAL n 1 112 LEU n 1 113 THR n 1 114 CYS n 1 115 GLY n 1 116 VAL n 1 117 THR n 1 118 GLY n 1 119 MET n 1 120 LYS n 1 121 ALA n 1 122 GLY n 1 123 LEU n 1 124 SER n 1 125 HIS n 1 126 SER n 1 127 PRO n 1 128 VAL n 1 129 CYS n 1 130 ALA n 1 131 GLY n 1 132 GLY n 1 133 ARG n 1 134 GLU n 1 135 ARG n 1 136 TYR n 1 137 VAL n 1 138 PHE n 1 139 PHE n 1 140 ALA n 1 141 PHE n 1 142 PRO n 1 143 HIS n 1 144 ILE n 1 145 ALA n 1 146 ILE n 1 147 ASN n 1 148 SER n 1 149 GLU n 1 150 GLY n 1 151 GLU n 1 152 VAL n 1 153 GLY n 1 154 ALA n 1 155 ILE n 1 156 SER n 1 157 ARG n 1 158 PRO n 1 159 GLY n 1 160 ARG n 1 161 PRO n 1 162 LYS n 1 163 MET n 1 164 SER n 1 165 CYS n 1 166 ALA n 1 167 CYS n 1 168 GLY n 1 169 ALA n 1 170 LEU n 1 171 GLN n 1 172 LYS n 1 173 CYS n 1 174 LEU n 1 175 VAL n 1 176 GLU n 1 177 LEU n 1 178 LYS n 1 179 ALA n 1 180 GLU n 1 181 GLY n 1 182 VAL n 1 183 ASP n 1 184 ALA n 1 185 ALA n 1 186 VAL n 1 187 ARG n 1 188 ALA n 1 189 PRO n 1 190 GLY n 1 191 LEU n 1 192 HIS n 1 193 ASP n 1 194 PRO n 1 195 ILE n 1 196 GLU n 1 197 PRO n 1 198 GLU n 1 199 TYR n 1 200 SER n 1 201 ILE n 1 202 LEU n 1 203 LYS n 1 204 GLN n 1 205 ARG n 1 206 LEU n 1 207 ALA n 1 208 ARG n 1 209 ARG n 1 210 ILE n 1 211 ARG n 1 212 TYR n 1 213 GLU n 1 214 LYS n 1 215 LEU n 1 216 ASP n 1 217 PRO n 1 218 GLN n 1 219 LEU n 1 220 MET n 1 221 ASP n 1 222 LEU n 1 223 PRO n 1 224 SER n 1 225 LEU n 1 226 THR n 1 227 ALA n 1 228 LEU n 1 229 ALA n 1 230 GLU n 1 231 ARG n 1 232 THR n 1 233 ILE n 1 234 SER n 1 235 ASP n 1 236 ASP n 1 237 LEU n 1 238 GLU n 1 239 TYR n 1 240 LEU n 1 241 ILE n 1 242 GLU n 1 243 LYS n 1 244 ALA n 1 245 VAL n 1 246 ASN n 1 247 PRO n 1 248 ALA n 1 249 THR n 1 250 SER n 1 251 ASP n 1 252 TYR n 1 253 ALA n 1 254 VAL n 1 255 ILE n 1 256 THR n 1 257 GLY n 1 258 VAL n 1 259 GLU n 1 260 ILE n 1 261 HIS n 1 262 ASN n 1 263 TRP n 1 264 ALA n 1 265 ALA n 1 266 HIS n 1 267 LEU n 1 268 GLU n 1 269 GLU n 1 270 GLY n 1 271 GLY n 1 272 ASP n 1 273 PRO n 1 274 SER n 1 275 MET n 1 276 GLU n 1 277 PHE n 1 278 ILE n 1 279 ALA n 1 280 PRO n 1 281 THR n 1 282 LYS n 1 283 ALA n 1 284 TYR n 1 285 VAL n 1 286 VAL n 1 287 VAL n 1 288 ASN n 1 289 GLY n 1 290 VAL n 1 291 LYS n 1 292 THR n 1 293 HIS n 1 294 LEU n 1 295 ASP n 1 296 LEU n 1 297 MET n 1 298 MET n 1 299 VAL n 1 300 PRO n 1 301 PRO n 1 302 MET n 1 303 SER n 1 304 PHE n 1 305 ARG n 1 306 GLN n 1 307 LEU n 1 308 GLN n # _entity_src_gen.entity_id 1 _entity_src_gen.pdbx_src_id 1 _entity_src_gen.pdbx_alt_source_flag sample _entity_src_gen.pdbx_seq_type 'Biological sequence' _entity_src_gen.pdbx_beg_seq_num 1 _entity_src_gen.pdbx_end_seq_num 308 _entity_src_gen.gene_src_common_name ? _entity_src_gen.gene_src_genus ? _entity_src_gen.pdbx_gene_src_gene LciC _entity_src_gen.gene_src_species ? _entity_src_gen.gene_src_strain ? _entity_src_gen.gene_src_tissue ? _entity_src_gen.gene_src_tissue_fraction ? _entity_src_gen.gene_src_details ? _entity_src_gen.pdbx_gene_src_fragment ? _entity_src_gen.pdbx_gene_src_scientific_name 'Chlamydomonas reinhardtii' _entity_src_gen.pdbx_gene_src_ncbi_taxonomy_id 3055 _entity_src_gen.pdbx_gene_src_variant ? _entity_src_gen.pdbx_gene_src_cell_line ? _entity_src_gen.pdbx_gene_src_atcc ? _entity_src_gen.pdbx_gene_src_organ ? _entity_src_gen.pdbx_gene_src_organelle ? _entity_src_gen.pdbx_gene_src_cell ? _entity_src_gen.pdbx_gene_src_cellular_location ? _entity_src_gen.host_org_common_name ? _entity_src_gen.pdbx_host_org_scientific_name 'Escherichia coli' _entity_src_gen.pdbx_host_org_ncbi_taxonomy_id 562 _entity_src_gen.host_org_genus ? _entity_src_gen.pdbx_host_org_gene ? _entity_src_gen.pdbx_host_org_organ ? _entity_src_gen.host_org_species ? _entity_src_gen.pdbx_host_org_tissue ? _entity_src_gen.pdbx_host_org_tissue_fraction ? _entity_src_gen.pdbx_host_org_strain ? _entity_src_gen.pdbx_host_org_variant ? _entity_src_gen.pdbx_host_org_cell_line ? _entity_src_gen.pdbx_host_org_atcc ? _entity_src_gen.pdbx_host_org_culture_collection ? _entity_src_gen.pdbx_host_org_cell ? _entity_src_gen.pdbx_host_org_organelle ? _entity_src_gen.pdbx_host_org_cellular_location ? _entity_src_gen.pdbx_host_org_vector_type ? _entity_src_gen.pdbx_host_org_vector ? _entity_src_gen.host_org_details ? _entity_src_gen.expression_system_id ? _entity_src_gen.plasmid_name ? _entity_src_gen.plasmid_details ? _entity_src_gen.pdbx_description ? # loop_ _chem_comp.id _chem_comp.type _chem_comp.mon_nstd_flag _chem_comp.name _chem_comp.pdbx_synonyms _chem_comp.formula _chem_comp.formula_weight ALA 'L-peptide linking' y ALANINE ? 'C3 H7 N O2' 89.093 ARG 'L-peptide linking' y ARGININE ? 'C6 H15 N4 O2 1' 175.209 ASN 'L-peptide linking' y ASPARAGINE ? 'C4 H8 N2 O3' 132.118 ASP 'L-peptide linking' y 'ASPARTIC ACID' ? 'C4 H7 N O4' 133.103 CYS 'L-peptide linking' y CYSTEINE ? 'C3 H7 N O2 S' 121.158 GLN 'L-peptide linking' y GLUTAMINE ? 'C5 H10 N2 O3' 146.144 GLU 'L-peptide linking' y 'GLUTAMIC ACID' ? 'C5 H9 N O4' 147.129 GLY 'peptide linking' y GLYCINE ? 'C2 H5 N O2' 75.067 HIS 'L-peptide linking' y HISTIDINE ? 'C6 H10 N3 O2 1' 156.162 HOH non-polymer . WATER ? 'H2 O' 18.015 ILE 'L-peptide linking' y ISOLEUCINE ? 'C6 H13 N O2' 131.173 LEU 'L-peptide linking' y LEUCINE ? 'C6 H13 N O2' 131.173 LYS 'L-peptide linking' y LYSINE ? 'C6 H15 N2 O2 1' 147.195 MET 'L-peptide linking' y METHIONINE ? 'C5 H11 N O2 S' 149.211 PHE 'L-peptide linking' y PHENYLALANINE ? 'C9 H11 N O2' 165.189 PRO 'L-peptide linking' y PROLINE ? 'C5 H9 N O2' 115.130 SER 'L-peptide linking' y SERINE ? 'C3 H7 N O3' 105.093 SO4 non-polymer . 'SULFATE ION' ? 'O4 S -2' 96.063 THR 'L-peptide linking' y THREONINE ? 'C4 H9 N O3' 119.119 TRP 'L-peptide linking' y TRYPTOPHAN ? 'C11 H12 N2 O2' 204.225 TYR 'L-peptide linking' y TYROSINE ? 'C9 H11 N O3' 181.189 VAL 'L-peptide linking' y VALINE ? 'C5 H11 N O2' 117.146 ZN non-polymer . 'ZINC ION' ? 'Zn 2' 65.409 # loop_ _pdbx_poly_seq_scheme.asym_id _pdbx_poly_seq_scheme.entity_id _pdbx_poly_seq_scheme.seq_id _pdbx_poly_seq_scheme.mon_id _pdbx_poly_seq_scheme.ndb_seq_num _pdbx_poly_seq_scheme.pdb_seq_num _pdbx_poly_seq_scheme.auth_seq_num _pdbx_poly_seq_scheme.pdb_mon_id _pdbx_poly_seq_scheme.auth_mon_id _pdbx_poly_seq_scheme.pdb_strand_id _pdbx_poly_seq_scheme.pdb_ins_code _pdbx_poly_seq_scheme.hetero A 1 1 GLY 1 37 ? ? ? A . n A 1 2 HIS 2 38 ? ? ? A . n A 1 3 MET 3 39 ? ? ? A . n A 1 4 ALA 4 40 ? ? ? A . n A 1 5 SER 5 41 ? ? ? A . n A 1 6 GLN 6 42 ? ? ? A . n A 1 7 ALA 7 43 ? ? ? A . n A 1 8 LEU 8 44 ? ? ? A . n A 1 9 THR 9 45 ? ? ? A . n A 1 10 VAL 10 46 ? ? ? A . n A 1 11 SER 11 47 ? ? ? A . n A 1 12 GLN 12 48 ? ? ? A . n A 1 13 SER 13 49 ? ? ? A . n A 1 14 LYS 14 50 ? ? ? A . n A 1 15 ALA 15 51 ? ? ? A . n A 1 16 VAL 16 52 ? ? ? A . n A 1 17 ALA 17 53 ? ? ? A . n A 1 18 PRO 18 54 ? ? ? A . n A 1 19 SER 19 55 ? ? ? A . n A 1 20 ASN 20 56 ? ? ? A . n A 1 21 GLY 21 57 ? ? ? A . n A 1 22 ALA 22 58 ? ? ? A . n A 1 23 PRO 23 59 ? ? ? A . n A 1 24 ALA 24 60 ? ? ? A . n A 1 25 PRO 25 61 ? ? ? A . n A 1 26 LEU 26 62 ? ? ? A . n A 1 27 ALA 27 63 ? ? ? A . n A 1 28 GLN 28 64 ? ? ? A . n A 1 29 VAL 29 65 ? ? ? A . n A 1 30 GLU 30 66 ? ? ? A . n A 1 31 GLU 31 67 ? ? ? A . n A 1 32 VAL 32 68 ? ? ? A . n A 1 33 ASP 33 69 ? ? ? A . n A 1 34 ILE 34 70 ? ? ? A . n A 1 35 ALA 35 71 ? ? ? A . n A 1 36 ARG 36 72 ? ? ? A . n A 1 37 HIS 37 73 ? ? ? A . n A 1 38 MET 38 74 ? ? ? A . n A 1 39 ASN 39 75 ? ? ? A . n A 1 40 ASP 40 76 ? ? ? A . n A 1 41 ARG 41 77 ? ? ? A . n A 1 42 HIS 42 78 ? ? ? A . n A 1 43 ALA 43 79 ? ? ? A . n A 1 44 HIS 44 80 ? ? ? A . n A 1 45 ILE 45 81 81 ILE ILE A . n A 1 46 LEU 46 82 82 LEU LEU A . n A 1 47 ARG 47 83 83 ARG ARG A . n A 1 48 TYR 48 84 84 TYR TYR A . n A 1 49 PHE 49 85 85 PHE PHE A . n A 1 50 PRO 50 86 86 PRO PRO A . n A 1 51 THR 51 87 87 THR THR A . n A 1 52 ALA 52 88 88 ALA ALA A . n A 1 53 LEU 53 89 89 LEU LEU A . n A 1 54 GLY 54 90 90 GLY GLY A . n A 1 55 VAL 55 91 91 VAL VAL A . n A 1 56 ASP 56 92 92 ASP ASP A . n A 1 57 ASP 57 93 93 ASP ASP A . n A 1 58 PHE 58 94 94 PHE PHE A . n A 1 59 MET 59 95 95 MET MET A . n A 1 60 ALA 60 96 96 ALA ALA A . n A 1 61 ARG 61 97 97 ARG ARG A . n A 1 62 THR 62 98 98 THR THR A . n A 1 63 GLU 63 99 99 GLU GLU A . n A 1 64 ILE 64 100 100 ILE ILE A . n A 1 65 VAL 65 101 101 VAL VAL A . n A 1 66 LEU 66 102 102 LEU LEU A . n A 1 67 GLY 67 103 103 GLY GLY A . n A 1 68 GLY 68 104 104 GLY GLY A . n A 1 69 PHE 69 105 105 PHE PHE A . n A 1 70 GLY 70 106 106 GLY GLY A . n A 1 71 PHE 71 107 107 PHE PHE A . n A 1 72 THR 72 108 108 THR THR A . n A 1 73 GLY 73 109 109 GLY GLY A . n A 1 74 ASP 74 110 110 ASP ASP A . n A 1 75 ASN 75 111 111 ASN ASN A . n A 1 76 THR 76 112 112 THR THR A . n A 1 77 ILE 77 113 113 ILE ILE A . n A 1 78 ALA 78 114 114 ALA ALA A . n A 1 79 MET 79 115 115 MET MET A . n A 1 80 THR 80 116 116 THR THR A . n A 1 81 ASN 81 117 117 ASN ASN A . n A 1 82 LEU 82 118 118 LEU LEU A . n A 1 83 CYS 83 119 119 CYS CYS A . n A 1 84 ARG 84 120 120 ARG ARG A . n A 1 85 ASP 85 121 121 ASP ASP A . n A 1 86 GLU 86 122 122 GLU GLU A . n A 1 87 VAL 87 123 123 VAL VAL A . n A 1 88 THR 88 124 124 THR THR A . n A 1 89 GLN 89 125 125 GLN GLN A . n A 1 90 VAL 90 126 126 VAL VAL A . n A 1 91 VAL 91 127 127 VAL VAL A . n A 1 92 LYS 92 128 128 LYS LYS A . n A 1 93 ASP 93 129 129 ASP ASP A . n A 1 94 LYS 94 130 130 LYS LYS A . n A 1 95 ILE 95 131 131 ILE ILE A . n A 1 96 GLU 96 132 132 GLU GLU A . n A 1 97 ALA 97 133 133 ALA ALA A . n A 1 98 ALA 98 134 134 ALA ALA A . n A 1 99 PHE 99 135 135 PHE PHE A . n A 1 100 GLY 100 136 136 GLY GLY A . n A 1 101 SER 101 137 137 SER SER A . n A 1 102 SER 102 138 138 SER SER A . n A 1 103 PHE 103 139 139 PHE PHE A . n A 1 104 ASN 104 140 140 ASN ASN A . n A 1 105 THR 105 141 141 THR THR A . n A 1 106 ASN 106 142 142 ASN ASN A . n A 1 107 GLY 107 143 143 GLY GLY A . n A 1 108 LEU 108 144 144 LEU LEU A . n A 1 109 GLY 109 145 145 GLY GLY A . n A 1 110 ALA 110 146 146 ALA ALA A . n A 1 111 VAL 111 147 147 VAL VAL A . n A 1 112 LEU 112 148 148 LEU LEU A . n A 1 113 THR 113 149 149 THR THR A . n A 1 114 CYS 114 150 150 CYS CYS A . n A 1 115 GLY 115 151 151 GLY GLY A . n A 1 116 VAL 116 152 152 VAL VAL A . n A 1 117 THR 117 153 153 THR THR A . n A 1 118 GLY 118 154 154 GLY GLY A . n A 1 119 MET 119 155 155 MET MET A . n A 1 120 LYS 120 156 156 LYS LYS A . n A 1 121 ALA 121 157 157 ALA ALA A . n A 1 122 GLY 122 158 158 GLY GLY A . n A 1 123 LEU 123 159 159 LEU LEU A . n A 1 124 SER 124 160 160 SER SER A . n A 1 125 HIS 125 161 ? ? ? A . n A 1 126 SER 126 162 ? ? ? A . n A 1 127 PRO 127 163 ? ? ? A . n A 1 128 VAL 128 164 ? ? ? A . n A 1 129 CYS 129 165 ? ? ? A . n A 1 130 ALA 130 166 ? ? ? A . n A 1 131 GLY 131 167 ? ? ? A . n A 1 132 GLY 132 168 ? ? ? A . n A 1 133 ARG 133 169 169 ARG ARG A . n A 1 134 GLU 134 170 170 GLU GLU A . n A 1 135 ARG 135 171 171 ARG ARG A . n A 1 136 TYR 136 172 172 TYR TYR A . n A 1 137 VAL 137 173 173 VAL VAL A . n A 1 138 PHE 138 174 174 PHE PHE A . n A 1 139 PHE 139 175 175 PHE PHE A . n A 1 140 ALA 140 176 176 ALA ALA A . n A 1 141 PHE 141 177 177 PHE PHE A . n A 1 142 PRO 142 178 178 PRO PRO A . n A 1 143 HIS 143 179 179 HIS HIS A . n A 1 144 ILE 144 180 180 ILE ILE A . n A 1 145 ALA 145 181 181 ALA ALA A . n A 1 146 ILE 146 182 182 ILE ILE A . n A 1 147 ASN 147 183 183 ASN ASN A . n A 1 148 SER 148 184 ? ? ? A . n A 1 149 GLU 149 185 ? ? ? A . n A 1 150 GLY 150 186 ? ? ? A . n A 1 151 GLU 151 187 ? ? ? A . n A 1 152 VAL 152 188 ? ? ? A . n A 1 153 GLY 153 189 ? ? ? A . n A 1 154 ALA 154 190 ? ? ? A . n A 1 155 ILE 155 191 ? ? ? A . n A 1 156 SER 156 192 ? ? ? A . n A 1 157 ARG 157 193 ? ? ? A . n A 1 158 PRO 158 194 ? ? ? A . n A 1 159 GLY 159 195 ? ? ? A . n A 1 160 ARG 160 196 ? ? ? A . n A 1 161 PRO 161 197 ? ? ? A . n A 1 162 LYS 162 198 ? ? ? A . n A 1 163 MET 163 199 ? ? ? A . n A 1 164 SER 164 200 ? ? ? A . n A 1 165 CYS 165 201 ? ? ? A . n A 1 166 ALA 166 202 202 ALA ALA A . n A 1 167 CYS 167 203 203 CYS CYS A . n A 1 168 GLY 168 204 204 GLY GLY A . n A 1 169 ALA 169 205 205 ALA ALA A . n A 1 170 LEU 170 206 206 LEU LEU A . n A 1 171 GLN 171 207 207 GLN GLN A . n A 1 172 LYS 172 208 208 LYS LYS A . n A 1 173 CYS 173 209 209 CYS CYS A . n A 1 174 LEU 174 210 210 LEU LEU A . n A 1 175 VAL 175 211 211 VAL VAL A . n A 1 176 GLU 176 212 212 GLU GLU A . n A 1 177 LEU 177 213 213 LEU LEU A . n A 1 178 LYS 178 214 214 LYS LYS A . n A 1 179 ALA 179 215 215 ALA ALA A . n A 1 180 GLU 180 216 216 GLU GLU A . n A 1 181 GLY 181 217 217 GLY GLY A . n A 1 182 VAL 182 218 218 VAL VAL A . n A 1 183 ASP 183 219 219 ASP ASP A . n A 1 184 ALA 184 220 220 ALA ALA A . n A 1 185 ALA 185 221 221 ALA ALA A . n A 1 186 VAL 186 222 222 VAL VAL A . n A 1 187 ARG 187 223 223 ARG ARG A . n A 1 188 ALA 188 224 224 ALA ALA A . n A 1 189 PRO 189 225 225 PRO PRO A . n A 1 190 GLY 190 226 226 GLY GLY A . n A 1 191 LEU 191 227 227 LEU LEU A . n A 1 192 HIS 192 228 228 HIS HIS A . n A 1 193 ASP 193 229 229 ASP ASP A . n A 1 194 PRO 194 230 230 PRO PRO A . n A 1 195 ILE 195 231 231 ILE ILE A . n A 1 196 GLU 196 232 232 GLU GLU A . n A 1 197 PRO 197 233 233 PRO PRO A . n A 1 198 GLU 198 234 234 GLU GLU A . n A 1 199 TYR 199 235 235 TYR TYR A . n A 1 200 SER 200 236 236 SER SER A . n A 1 201 ILE 201 237 237 ILE ILE A . n A 1 202 LEU 202 238 238 LEU LEU A . n A 1 203 LYS 203 239 239 LYS LYS A . n A 1 204 GLN 204 240 240 GLN GLN A . n A 1 205 ARG 205 241 241 ARG ARG A . n A 1 206 LEU 206 242 242 LEU LEU A . n A 1 207 ALA 207 243 243 ALA ALA A . n A 1 208 ARG 208 244 244 ARG ARG A . n A 1 209 ARG 209 245 245 ARG ARG A . n A 1 210 ILE 210 246 246 ILE ILE A . n A 1 211 ARG 211 247 247 ARG ARG A . n A 1 212 TYR 212 248 248 TYR TYR A . n A 1 213 GLU 213 249 249 GLU GLU A . n A 1 214 LYS 214 250 250 LYS LYS A . n A 1 215 LEU 215 251 251 LEU LEU A . n A 1 216 ASP 216 252 252 ASP ASP A . n A 1 217 PRO 217 253 253 PRO PRO A . n A 1 218 GLN 218 254 254 GLN GLN A . n A 1 219 LEU 219 255 255 LEU LEU A . n A 1 220 MET 220 256 256 MET MET A . n A 1 221 ASP 221 257 257 ASP ASP A . n A 1 222 LEU 222 258 258 LEU LEU A . n A 1 223 PRO 223 259 259 PRO PRO A . n A 1 224 SER 224 260 260 SER SER A . n A 1 225 LEU 225 261 261 LEU LEU A . n A 1 226 THR 226 262 262 THR THR A . n A 1 227 ALA 227 263 263 ALA ALA A . n A 1 228 LEU 228 264 264 LEU LEU A . n A 1 229 ALA 229 265 265 ALA ALA A . n A 1 230 GLU 230 266 266 GLU GLU A . n A 1 231 ARG 231 267 267 ARG ARG A . n A 1 232 THR 232 268 268 THR THR A . n A 1 233 ILE 233 269 269 ILE ILE A . n A 1 234 SER 234 270 270 SER SER A . n A 1 235 ASP 235 271 271 ASP ASP A . n A 1 236 ASP 236 272 272 ASP ASP A . n A 1 237 LEU 237 273 273 LEU LEU A . n A 1 238 GLU 238 274 274 GLU GLU A . n A 1 239 TYR 239 275 275 TYR TYR A . n A 1 240 LEU 240 276 276 LEU LEU A . n A 1 241 ILE 241 277 277 ILE ILE A . n A 1 242 GLU 242 278 278 GLU GLU A . n A 1 243 LYS 243 279 279 LYS LYS A . n A 1 244 ALA 244 280 280 ALA ALA A . n A 1 245 VAL 245 281 281 VAL VAL A . n A 1 246 ASN 246 282 282 ASN ASN A . n A 1 247 PRO 247 283 283 PRO PRO A . n A 1 248 ALA 248 284 284 ALA ALA A . n A 1 249 THR 249 285 285 THR THR A . n A 1 250 SER 250 286 286 SER SER A . n A 1 251 ASP 251 287 287 ASP ASP A . n A 1 252 TYR 252 288 288 TYR TYR A . n A 1 253 ALA 253 289 289 ALA ALA A . n A 1 254 VAL 254 290 290 VAL VAL A . n A 1 255 ILE 255 291 291 ILE ILE A . n A 1 256 THR 256 292 292 THR THR A . n A 1 257 GLY 257 293 293 GLY GLY A . n A 1 258 VAL 258 294 294 VAL VAL A . n A 1 259 GLU 259 295 295 GLU GLU A . n A 1 260 ILE 260 296 296 ILE ILE A . n A 1 261 HIS 261 297 297 HIS HIS A . n A 1 262 ASN 262 298 298 ASN ASN A . n A 1 263 TRP 263 299 ? ? ? A . n A 1 264 ALA 264 300 ? ? ? A . n A 1 265 ALA 265 301 ? ? ? A . n A 1 266 HIS 266 302 ? ? ? A . n A 1 267 LEU 267 303 ? ? ? A . n A 1 268 GLU 268 304 ? ? ? A . n A 1 269 GLU 269 305 ? ? ? A . n A 1 270 GLY 270 306 ? ? ? A . n A 1 271 GLY 271 307 ? ? ? A . n A 1 272 ASP 272 308 ? ? ? A . n A 1 273 PRO 273 309 ? ? ? A . n A 1 274 SER 274 310 ? ? ? A . n A 1 275 MET 275 311 311 MET MET A . n A 1 276 GLU 276 312 312 GLU GLU A . n A 1 277 PHE 277 313 313 PHE PHE A . n A 1 278 ILE 278 314 314 ILE ILE A . n A 1 279 ALA 279 315 315 ALA ALA A . n A 1 280 PRO 280 316 316 PRO PRO A . n A 1 281 THR 281 317 317 THR THR A . n A 1 282 LYS 282 318 318 LYS LYS A . n A 1 283 ALA 283 319 319 ALA ALA A . n A 1 284 TYR 284 320 320 TYR TYR A . n A 1 285 VAL 285 321 321 VAL VAL A . n A 1 286 VAL 286 322 322 VAL VAL A . n A 1 287 VAL 287 323 323 VAL VAL A . n A 1 288 ASN 288 324 324 ASN ASN A . n A 1 289 GLY 289 325 325 GLY GLY A . n A 1 290 VAL 290 326 326 VAL VAL A . n A 1 291 LYS 291 327 327 LYS LYS A . n A 1 292 THR 292 328 328 THR THR A . n A 1 293 HIS 293 329 329 HIS HIS A . n A 1 294 LEU 294 330 330 LEU LEU A . n A 1 295 ASP 295 331 331 ASP ASP A . n A 1 296 LEU 296 332 332 LEU LEU A . n A 1 297 MET 297 333 333 MET MET A . n A 1 298 MET 298 334 334 MET MET A . n A 1 299 VAL 299 335 335 VAL VAL A . n A 1 300 PRO 300 336 336 PRO PRO A . n A 1 301 PRO 301 337 337 PRO PRO A . n A 1 302 MET 302 338 338 MET MET A . n A 1 303 SER 303 339 339 SER SER A . n A 1 304 PHE 304 340 340 PHE PHE A . n A 1 305 ARG 305 341 341 ARG ARG A . n A 1 306 GLN 306 342 342 GLN GLN A . n A 1 307 LEU 307 343 343 LEU LEU A . n A 1 308 GLN 308 344 ? ? ? A . n # loop_ _pdbx_nonpoly_scheme.asym_id _pdbx_nonpoly_scheme.entity_id _pdbx_nonpoly_scheme.mon_id _pdbx_nonpoly_scheme.ndb_seq_num _pdbx_nonpoly_scheme.pdb_seq_num _pdbx_nonpoly_scheme.auth_seq_num _pdbx_nonpoly_scheme.pdb_mon_id _pdbx_nonpoly_scheme.auth_mon_id _pdbx_nonpoly_scheme.pdb_strand_id _pdbx_nonpoly_scheme.pdb_ins_code B 2 ZN 1 500 500 ZN ZN A . C 3 SO4 1 501 501 SO4 SO4 A . D 4 HOH 1 601 14 HOH HOH A . D 4 HOH 2 602 6 HOH HOH A . D 4 HOH 3 603 15 HOH HOH A . D 4 HOH 4 604 2 HOH HOH A . D 4 HOH 5 605 1 HOH HOH A . D 4 HOH 6 606 4 HOH HOH A . D 4 HOH 7 607 3 HOH HOH A . D 4 HOH 8 608 5 HOH HOH A . D 4 HOH 9 609 13 HOH HOH A . D 4 HOH 10 610 10 HOH HOH A . D 4 HOH 11 611 7 HOH HOH A . D 4 HOH 12 612 11 HOH HOH A . D 4 HOH 13 613 8 HOH HOH A . D 4 HOH 14 614 9 HOH HOH A . # loop_ _pdbx_unobs_or_zero_occ_atoms.id _pdbx_unobs_or_zero_occ_atoms.PDB_model_num _pdbx_unobs_or_zero_occ_atoms.polymer_flag _pdbx_unobs_or_zero_occ_atoms.occupancy_flag _pdbx_unobs_or_zero_occ_atoms.auth_asym_id _pdbx_unobs_or_zero_occ_atoms.auth_comp_id _pdbx_unobs_or_zero_occ_atoms.auth_seq_id _pdbx_unobs_or_zero_occ_atoms.PDB_ins_code _pdbx_unobs_or_zero_occ_atoms.auth_atom_id _pdbx_unobs_or_zero_occ_atoms.label_alt_id _pdbx_unobs_or_zero_occ_atoms.label_asym_id _pdbx_unobs_or_zero_occ_atoms.label_comp_id _pdbx_unobs_or_zero_occ_atoms.label_seq_id _pdbx_unobs_or_zero_occ_atoms.label_atom_id 1 1 Y 1 A ILE 81 ? CG1 ? A ILE 45 CG1 2 1 Y 1 A ILE 81 ? CG2 ? A ILE 45 CG2 3 1 Y 1 A ILE 81 ? CD1 ? A ILE 45 CD1 4 1 Y 1 A ARG 83 ? CG ? A ARG 47 CG 5 1 Y 1 A ARG 83 ? CD ? A ARG 47 CD 6 1 Y 1 A ARG 83 ? NE ? A ARG 47 NE 7 1 Y 1 A ARG 83 ? CZ ? A ARG 47 CZ 8 1 Y 1 A ARG 83 ? NH1 ? A ARG 47 NH1 9 1 Y 1 A ARG 83 ? NH2 ? A ARG 47 NH2 10 1 Y 1 A GLU 122 ? CG ? A GLU 86 CG 11 1 Y 1 A GLU 122 ? CD ? A GLU 86 CD 12 1 Y 1 A GLU 122 ? OE1 ? A GLU 86 OE1 13 1 Y 1 A GLU 122 ? OE2 ? A GLU 86 OE2 14 1 Y 1 A GLU 216 ? CG ? A GLU 180 CG 15 1 Y 1 A GLU 216 ? CD ? A GLU 180 CD 16 1 Y 1 A GLU 216 ? OE1 ? A GLU 180 OE1 17 1 Y 1 A GLU 216 ? OE2 ? A GLU 180 OE2 18 1 Y 1 A GLN 342 ? NE2 ? A GLN 306 NE2 # loop_ _software.citation_id _software.classification _software.compiler_name _software.compiler_version _software.contact_author _software.contact_author_email _software.date _software.description _software.dependencies _software.hardware _software.language _software.location _software.mods _software.name _software.os _software.os_version _software.type _software.version _software.pdbx_ordinal ? refinement ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? 1.9_1692 1 ? 'data reduction' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 2 ? 'data scaling' ? ? ? ? ? ? ? ? ? ? ? HKL-2000 ? ? ? . 3 ? phasing ? ? ? ? ? ? ? ? ? ? ? PHENIX ? ? ? . 4 # _cell.entry_id 5B5X _cell.length_a 55.972 _cell.length_b 88.004 _cell.length_c 100.842 _cell.angle_alpha 90.00 _cell.angle_beta 90.00 _cell.angle_gamma 90.00 _cell.Z_PDB 8 _cell.pdbx_unique_axis ? # _symmetry.entry_id 5B5X _symmetry.space_group_name_H-M 'I 2 2 2' _symmetry.pdbx_full_space_group_name_H-M ? _symmetry.cell_setting ? _symmetry.Int_Tables_number 23 # _exptl.absorpt_coefficient_mu ? _exptl.absorpt_correction_T_max ? _exptl.absorpt_correction_T_min ? _exptl.absorpt_correction_type ? _exptl.absorpt_process_details ? _exptl.entry_id 5B5X _exptl.crystals_number 1 _exptl.details ? _exptl.method 'X-RAY DIFFRACTION' _exptl.method_details ? # _exptl_crystal.colour ? _exptl_crystal.density_diffrn ? _exptl_crystal.density_Matthews 1.87 _exptl_crystal.density_method ? _exptl_crystal.density_percent_sol 34.12 _exptl_crystal.description ? _exptl_crystal.F_000 ? _exptl_crystal.id 1 _exptl_crystal.preparation ? _exptl_crystal.size_max ? _exptl_crystal.size_mid ? _exptl_crystal.size_min ? _exptl_crystal.size_rad ? _exptl_crystal.colour_lustre ? _exptl_crystal.colour_modifier ? _exptl_crystal.colour_primary ? _exptl_crystal.density_meas ? _exptl_crystal.density_meas_esd ? _exptl_crystal.density_meas_gt ? _exptl_crystal.density_meas_lt ? _exptl_crystal.density_meas_temp ? _exptl_crystal.density_meas_temp_esd ? _exptl_crystal.density_meas_temp_gt ? _exptl_crystal.density_meas_temp_lt ? _exptl_crystal.pdbx_crystal_image_url ? _exptl_crystal.pdbx_crystal_image_format ? _exptl_crystal.pdbx_mosaicity ? _exptl_crystal.pdbx_mosaicity_esd ? # _exptl_crystal_grow.apparatus ? _exptl_crystal_grow.atmosphere ? _exptl_crystal_grow.crystal_id 1 _exptl_crystal_grow.details ? _exptl_crystal_grow.method 'VAPOR DIFFUSION, HANGING DROP' _exptl_crystal_grow.method_ref ? _exptl_crystal_grow.pH 5.5 _exptl_crystal_grow.pressure ? _exptl_crystal_grow.pressure_esd ? _exptl_crystal_grow.seeding ? _exptl_crystal_grow.seeding_ref ? _exptl_crystal_grow.temp 293.15 _exptl_crystal_grow.temp_details ? _exptl_crystal_grow.temp_esd ? _exptl_crystal_grow.time ? _exptl_crystal_grow.pdbx_details '200 mM lithium sulfate monohydrate, 100 mM Bis-Tris, 25% w/v PEG3350' _exptl_crystal_grow.pdbx_pH_range ? # _diffrn.ambient_environment ? _diffrn.ambient_temp 100 _diffrn.ambient_temp_details ? _diffrn.ambient_temp_esd ? _diffrn.crystal_id 1 _diffrn.crystal_support ? _diffrn.crystal_treatment ? _diffrn.details ? _diffrn.id 1 _diffrn.ambient_pressure ? _diffrn.ambient_pressure_esd ? _diffrn.ambient_pressure_gt ? _diffrn.ambient_pressure_lt ? _diffrn.ambient_temp_gt ? _diffrn.ambient_temp_lt ? # _diffrn_detector.details ? _diffrn_detector.detector CCD _diffrn_detector.diffrn_id 1 _diffrn_detector.type 'ADSC QUANTUM 315r' _diffrn_detector.area_resol_mean ? _diffrn_detector.dtime ? _diffrn_detector.pdbx_frames_total ? _diffrn_detector.pdbx_collection_time_total ? _diffrn_detector.pdbx_collection_date 2015-07-01 # _diffrn_radiation.collimation ? _diffrn_radiation.diffrn_id 1 _diffrn_radiation.filter_edge ? _diffrn_radiation.inhomogeneity ? _diffrn_radiation.monochromator ? _diffrn_radiation.polarisn_norm ? _diffrn_radiation.polarisn_ratio ? _diffrn_radiation.probe ? _diffrn_radiation.type ? _diffrn_radiation.xray_symbol ? _diffrn_radiation.wavelength_id 1 _diffrn_radiation.pdbx_monochromatic_or_laue_m_l M _diffrn_radiation.pdbx_wavelength_list ? _diffrn_radiation.pdbx_wavelength ? _diffrn_radiation.pdbx_diffrn_protocol 'SINGLE WAVELENGTH' _diffrn_radiation.pdbx_analyzer ? _diffrn_radiation.pdbx_scattering_type x-ray # _diffrn_radiation_wavelength.id 1 _diffrn_radiation_wavelength.wavelength 1.0 _diffrn_radiation_wavelength.wt 1.0 # _diffrn_source.current ? _diffrn_source.details ? _diffrn_source.diffrn_id 1 _diffrn_source.power ? _diffrn_source.size ? _diffrn_source.source SYNCHROTRON _diffrn_source.target ? _diffrn_source.type 'NSRRC BEAMLINE BL13B1' _diffrn_source.voltage ? _diffrn_source.take-off_angle ? _diffrn_source.pdbx_wavelength_list 1.0 _diffrn_source.pdbx_wavelength ? _diffrn_source.pdbx_synchrotron_beamline BL13B1 _diffrn_source.pdbx_synchrotron_site NSRRC # _reflns.B_iso_Wilson_estimate ? _reflns.entry_id 5B5X _reflns.data_reduction_details ? _reflns.data_reduction_method ? _reflns.d_resolution_high 2.5 _reflns.d_resolution_low 50 _reflns.details ? _reflns.limit_h_max ? _reflns.limit_h_min ? _reflns.limit_k_max ? _reflns.limit_k_min ? _reflns.limit_l_max ? _reflns.limit_l_min ? _reflns.number_all ? _reflns.number_obs 8828 _reflns.observed_criterion ? _reflns.observed_criterion_F_max ? _reflns.observed_criterion_F_min ? _reflns.observed_criterion_I_max ? _reflns.observed_criterion_I_min ? _reflns.observed_criterion_sigma_F ? _reflns.observed_criterion_sigma_I ? _reflns.percent_possible_obs 98.3 _reflns.R_free_details ? _reflns.Rmerge_F_all ? _reflns.Rmerge_F_obs ? _reflns.Friedel_coverage ? _reflns.number_gt ? _reflns.threshold_expression ? _reflns.pdbx_redundancy 5.8 _reflns.pdbx_Rmerge_I_obs ? _reflns.pdbx_Rmerge_I_all ? _reflns.pdbx_Rsym_value ? _reflns.pdbx_netI_over_av_sigmaI ? _reflns.pdbx_netI_over_sigmaI 27.5 _reflns.pdbx_res_netI_over_av_sigmaI_2 ? _reflns.pdbx_res_netI_over_sigmaI_2 ? _reflns.pdbx_chi_squared ? _reflns.pdbx_scaling_rejects ? _reflns.pdbx_d_res_high_opt ? _reflns.pdbx_d_res_low_opt ? _reflns.pdbx_d_res_opt_method ? _reflns.phase_calculation_details ? _reflns.pdbx_Rrim_I_all ? _reflns.pdbx_Rpim_I_all ? _reflns.pdbx_d_opt ? _reflns.pdbx_number_measured_all ? _reflns.pdbx_diffrn_id 1 _reflns.pdbx_ordinal 1 _reflns.pdbx_CC_half ? _reflns.pdbx_R_split ? # _reflns_shell.d_res_high 2.50 _reflns_shell.d_res_low 2.54 _reflns_shell.meanI_over_sigI_all ? _reflns_shell.meanI_over_sigI_obs ? _reflns_shell.number_measured_all ? _reflns_shell.number_measured_obs ? _reflns_shell.number_possible ? _reflns_shell.number_unique_all ? _reflns_shell.number_unique_obs ? _reflns_shell.percent_possible_all ? _reflns_shell.percent_possible_obs ? _reflns_shell.Rmerge_F_all ? _reflns_shell.Rmerge_F_obs ? _reflns_shell.Rmerge_I_all ? _reflns_shell.Rmerge_I_obs ? _reflns_shell.meanI_over_sigI_gt ? _reflns_shell.meanI_over_uI_all ? _reflns_shell.meanI_over_uI_gt ? _reflns_shell.number_measured_gt ? _reflns_shell.number_unique_gt ? _reflns_shell.percent_possible_gt ? _reflns_shell.Rmerge_F_gt ? _reflns_shell.Rmerge_I_gt ? _reflns_shell.pdbx_redundancy ? _reflns_shell.pdbx_Rsym_value ? _reflns_shell.pdbx_chi_squared ? _reflns_shell.pdbx_netI_over_sigmaI_all ? _reflns_shell.pdbx_netI_over_sigmaI_obs ? _reflns_shell.pdbx_Rrim_I_all ? _reflns_shell.pdbx_Rpim_I_all ? _reflns_shell.pdbx_rejects ? _reflns_shell.pdbx_ordinal 1 _reflns_shell.pdbx_diffrn_id 1 _reflns_shell.pdbx_CC_half ? _reflns_shell.pdbx_R_split ? # _refine.pdbx_refine_id 'X-RAY DIFFRACTION' _refine.entry_id 5B5X _refine.pdbx_diffrn_id 1 _refine.pdbx_TLS_residual_ADP_flag ? _refine.ls_number_reflns_obs 8636 _refine.ls_number_reflns_all ? _refine.pdbx_ls_sigma_I ? _refine.pdbx_ls_sigma_F 1.35 _refine.pdbx_data_cutoff_high_absF ? _refine.pdbx_data_cutoff_low_absF ? _refine.pdbx_data_cutoff_high_rms_absF ? _refine.ls_d_res_low 34.469 _refine.ls_d_res_high 2.511 _refine.ls_percent_reflns_obs 97.86 _refine.ls_R_factor_obs 0.2195 _refine.ls_R_factor_all ? _refine.ls_R_factor_R_work 0.2165 _refine.ls_R_factor_R_free 0.2826 _refine.ls_R_factor_R_free_error ? _refine.ls_R_factor_R_free_error_details ? _refine.ls_percent_reflns_R_free 4.74 _refine.ls_number_reflns_R_free 409 _refine.ls_number_parameters ? _refine.ls_number_restraints ? _refine.occupancy_min ? _refine.occupancy_max ? _refine.correlation_coeff_Fo_to_Fc ? _refine.correlation_coeff_Fo_to_Fc_free ? _refine.B_iso_mean ? _refine.aniso_B[1][1] ? _refine.aniso_B[2][2] ? _refine.aniso_B[3][3] ? _refine.aniso_B[1][2] ? _refine.aniso_B[1][3] ? _refine.aniso_B[2][3] ? _refine.solvent_model_details 'FLAT BULK SOLVENT MODEL' _refine.solvent_model_param_ksol ? _refine.solvent_model_param_bsol ? _refine.pdbx_solvent_vdw_probe_radii 1.11 _refine.pdbx_solvent_ion_probe_radii ? _refine.pdbx_solvent_shrinkage_radii 0.90 _refine.pdbx_ls_cross_valid_method 'FREE R-VALUE' _refine.details ? _refine.pdbx_starting_model ? _refine.pdbx_method_to_determine_struct SAD _refine.pdbx_isotropic_thermal_model ? _refine.pdbx_stereochemistry_target_values ML _refine.pdbx_stereochem_target_val_spec_case ? _refine.pdbx_R_Free_selection_details ? _refine.pdbx_overall_ESU_R ? _refine.pdbx_overall_ESU_R_Free ? _refine.overall_SU_ML 0.38 _refine.pdbx_overall_phase_error 35.27 _refine.overall_SU_B ? _refine.overall_SU_R_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_free_Cruickshank_DPI ? _refine.pdbx_overall_SU_R_Blow_DPI ? _refine.pdbx_overall_SU_R_free_Blow_DPI ? # _refine_hist.pdbx_refine_id 'X-RAY DIFFRACTION' _refine_hist.cycle_id LAST _refine_hist.pdbx_number_atoms_protein 1714 _refine_hist.pdbx_number_atoms_nucleic_acid 0 _refine_hist.pdbx_number_atoms_ligand 6 _refine_hist.number_atoms_solvent 14 _refine_hist.number_atoms_total 1734 _refine_hist.d_res_high 2.511 _refine_hist.d_res_low 34.469 # loop_ _refine_ls_restr.type _refine_ls_restr.dev_ideal _refine_ls_restr.dev_ideal_target _refine_ls_restr.weight _refine_ls_restr.number _refine_ls_restr.pdbx_refine_id _refine_ls_restr.pdbx_restraint_function f_bond_d 0.009 ? ? 1747 'X-RAY DIFFRACTION' ? f_angle_d 1.246 ? ? 2366 'X-RAY DIFFRACTION' ? f_dihedral_angle_d 14.050 ? ? 635 'X-RAY DIFFRACTION' ? f_chiral_restr 0.050 ? ? 279 'X-RAY DIFFRACTION' ? f_plane_restr 0.005 ? ? 302 'X-RAY DIFFRACTION' ? # loop_ _refine_ls_shell.pdbx_refine_id _refine_ls_shell.pdbx_total_number_of_bins_used _refine_ls_shell.d_res_high _refine_ls_shell.d_res_low _refine_ls_shell.number_reflns_R_work _refine_ls_shell.R_factor_R_work _refine_ls_shell.percent_reflns_obs _refine_ls_shell.R_factor_R_free _refine_ls_shell.R_factor_R_free_error _refine_ls_shell.percent_reflns_R_free _refine_ls_shell.number_reflns_R_free _refine_ls_shell.number_reflns_all _refine_ls_shell.R_factor_all _refine_ls_shell.R_factor_obs _refine_ls_shell.number_reflns_obs 'X-RAY DIFFRACTION' . 2.5109 2.8741 2618 0.2541 95.00 0.3885 . . 131 . . . . 'X-RAY DIFFRACTION' . 2.8741 3.6204 2766 0.2281 100.00 0.2800 . . 139 . . . . 'X-RAY DIFFRACTION' . 3.6204 34.4724 2843 0.2023 98.00 0.2589 . . 139 . . . . # _struct.entry_id 5B5X _struct.title 'Crystal structure of limiting CO2-inducible protein LCIC' _struct.pdbx_model_details ? _struct.pdbx_formula_weight ? _struct.pdbx_formula_weight_method ? _struct.pdbx_model_type_details ? _struct.pdbx_CASP_flag N # _struct_keywords.entry_id 5B5X _struct_keywords.text 'metalloprotein, METAL BINDING PROTEIN' _struct_keywords.pdbx_keywords 'METAL BINDING PROTEIN' # loop_ _struct_asym.id _struct_asym.pdbx_blank_PDB_chainid_flag _struct_asym.pdbx_modified _struct_asym.entity_id _struct_asym.details A N N 1 ? B N N 2 ? C N N 3 ? D N N 4 ? # _struct_ref.id 1 _struct_ref.db_name UNP _struct_ref.db_code Q75NZ1_CHLRE _struct_ref.pdbx_db_accession Q75NZ1 _struct_ref.pdbx_db_isoform ? _struct_ref.entity_id 1 _struct_ref.pdbx_seq_one_letter_code ;ASQALTVSQSKAVAPSNGAPAPLAQVEEVDIARHMNDRHAHILRYFPTALGVDDFMARTEIVLGGFGFTGDNTIAMTNLC RDEVTQVVKDKIEAAFGSSFNTNGLGAVLTCGVTGMKAGLSHSPVCAGGRERYVFFAFPHIAINSEGEVGAISRPGRPKM SCACGALQKCLVELKAEGVDAAVRAPGLHDPIEPEYSILKQRLARRIRYEKLDPQLMDLPSLTALAERTISDDLEYLIEK AVNPATSDYAVITGVEIHNWAAHLEEGGDPSMEFIAPTKAYVVVNGVKTHLDLMMVPPMSFRQLQ ; _struct_ref.pdbx_align_begin 40 # _struct_ref_seq.align_id 1 _struct_ref_seq.ref_id 1 _struct_ref_seq.pdbx_PDB_id_code 5B5X _struct_ref_seq.pdbx_strand_id A _struct_ref_seq.seq_align_beg 4 _struct_ref_seq.pdbx_seq_align_beg_ins_code ? _struct_ref_seq.seq_align_end 308 _struct_ref_seq.pdbx_seq_align_end_ins_code ? _struct_ref_seq.pdbx_db_accession Q75NZ1 _struct_ref_seq.db_align_beg 40 _struct_ref_seq.pdbx_db_align_beg_ins_code ? _struct_ref_seq.db_align_end 344 _struct_ref_seq.pdbx_db_align_end_ins_code ? _struct_ref_seq.pdbx_auth_seq_align_beg 40 _struct_ref_seq.pdbx_auth_seq_align_end 344 # loop_ _struct_ref_seq_dif.align_id _struct_ref_seq_dif.pdbx_pdb_id_code _struct_ref_seq_dif.mon_id _struct_ref_seq_dif.pdbx_pdb_strand_id _struct_ref_seq_dif.seq_num _struct_ref_seq_dif.pdbx_pdb_ins_code _struct_ref_seq_dif.pdbx_seq_db_name _struct_ref_seq_dif.pdbx_seq_db_accession_code _struct_ref_seq_dif.db_mon_id _struct_ref_seq_dif.pdbx_seq_db_seq_num _struct_ref_seq_dif.details _struct_ref_seq_dif.pdbx_auth_seq_num _struct_ref_seq_dif.pdbx_ordinal 1 5B5X GLY A 1 ? UNP Q75NZ1 ? ? 'expression tag' 37 1 1 5B5X HIS A 2 ? UNP Q75NZ1 ? ? 'expression tag' 38 2 1 5B5X MET A 3 ? UNP Q75NZ1 ? ? 'expression tag' 39 3 # _pdbx_struct_assembly.id 1 _pdbx_struct_assembly.details author_and_software_defined_assembly _pdbx_struct_assembly.method_details PISA _pdbx_struct_assembly.oligomeric_details dimeric _pdbx_struct_assembly.oligomeric_count 2 # loop_ _pdbx_struct_assembly_prop.biol_id _pdbx_struct_assembly_prop.type _pdbx_struct_assembly_prop.value _pdbx_struct_assembly_prop.details 1 'ABSA (A^2)' 2990 ? 1 MORE -131 ? 1 'SSA (A^2)' 18710 ? # _pdbx_struct_assembly_gen.assembly_id 1 _pdbx_struct_assembly_gen.oper_expression 1,2 _pdbx_struct_assembly_gen.asym_id_list A,B,C,D # loop_ _pdbx_struct_oper_list.id _pdbx_struct_oper_list.type _pdbx_struct_oper_list.name _pdbx_struct_oper_list.symmetry_operation _pdbx_struct_oper_list.matrix[1][1] _pdbx_struct_oper_list.matrix[1][2] _pdbx_struct_oper_list.matrix[1][3] _pdbx_struct_oper_list.vector[1] _pdbx_struct_oper_list.matrix[2][1] _pdbx_struct_oper_list.matrix[2][2] _pdbx_struct_oper_list.matrix[2][3] _pdbx_struct_oper_list.vector[2] _pdbx_struct_oper_list.matrix[3][1] _pdbx_struct_oper_list.matrix[3][2] _pdbx_struct_oper_list.matrix[3][3] _pdbx_struct_oper_list.vector[3] 1 'identity operation' 1_555 x,y,z 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 2 'crystal symmetry operation' 3_556 -x,y,-z+1 -1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 1.0000000000 0.0000000000 0.0000000000 0.0000000000 0.0000000000 -1.0000000000 100.8420000000 # loop_ _struct_conf.conf_type_id _struct_conf.id _struct_conf.pdbx_PDB_helix_id _struct_conf.beg_label_comp_id _struct_conf.beg_label_asym_id _struct_conf.beg_label_seq_id _struct_conf.pdbx_beg_PDB_ins_code _struct_conf.end_label_comp_id _struct_conf.end_label_asym_id _struct_conf.end_label_seq_id _struct_conf.pdbx_end_PDB_ins_code _struct_conf.beg_auth_comp_id _struct_conf.beg_auth_asym_id _struct_conf.beg_auth_seq_id _struct_conf.end_auth_comp_id _struct_conf.end_auth_asym_id _struct_conf.end_auth_seq_id _struct_conf.pdbx_PDB_helix_class _struct_conf.details _struct_conf.pdbx_PDB_helix_length HELX_P HELX_P1 AA1 VAL A 55 ? PHE A 69 ? VAL A 91 PHE A 105 1 ? 15 HELX_P HELX_P2 AA2 ASP A 85 ? VAL A 87 ? ASP A 121 VAL A 123 5 ? 3 HELX_P HELX_P3 AA3 THR A 88 ? PHE A 99 ? THR A 124 PHE A 135 1 ? 12 HELX_P HELX_P4 AA4 LEU A 108 ? VAL A 111 ? LEU A 144 VAL A 147 5 ? 4 HELX_P HELX_P5 AA5 CYS A 114 ? GLY A 122 ? CYS A 150 GLY A 158 1 ? 9 HELX_P HELX_P6 AA6 GLY A 168 ? GLU A 180 ? GLY A 204 GLU A 216 1 ? 13 HELX_P HELX_P7 AA7 GLY A 181 ? VAL A 186 ? GLY A 217 VAL A 222 1 ? 6 HELX_P HELX_P8 AA8 GLU A 196 ? TYR A 212 ? GLU A 232 TYR A 248 1 ? 17 HELX_P HELX_P9 AA9 ASP A 221 ? VAL A 245 ? ASP A 257 VAL A 281 1 ? 25 HELX_P HELX_P10 AB1 ASP A 295 ? VAL A 299 ? ASP A 331 VAL A 335 5 ? 5 HELX_P HELX_P11 AB2 MET A 302 ? GLN A 306 ? MET A 338 GLN A 342 5 ? 5 # _struct_conf_type.id HELX_P _struct_conf_type.criteria ? _struct_conf_type.reference ? # loop_ _struct_conn.id _struct_conn.conn_type_id _struct_conn.pdbx_leaving_atom_flag _struct_conn.pdbx_PDB_id _struct_conn.ptnr1_label_asym_id _struct_conn.ptnr1_label_comp_id _struct_conn.ptnr1_label_seq_id _struct_conn.ptnr1_label_atom_id _struct_conn.pdbx_ptnr1_label_alt_id _struct_conn.pdbx_ptnr1_PDB_ins_code _struct_conn.pdbx_ptnr1_standard_comp_id _struct_conn.ptnr1_symmetry _struct_conn.ptnr2_label_asym_id _struct_conn.ptnr2_label_comp_id _struct_conn.ptnr2_label_seq_id _struct_conn.ptnr2_label_atom_id _struct_conn.pdbx_ptnr2_label_alt_id _struct_conn.pdbx_ptnr2_PDB_ins_code _struct_conn.ptnr1_auth_asym_id _struct_conn.ptnr1_auth_comp_id _struct_conn.ptnr1_auth_seq_id _struct_conn.ptnr2_auth_asym_id _struct_conn.ptnr2_auth_comp_id _struct_conn.ptnr2_auth_seq_id _struct_conn.ptnr2_symmetry _struct_conn.pdbx_ptnr3_label_atom_id _struct_conn.pdbx_ptnr3_label_seq_id _struct_conn.pdbx_ptnr3_label_comp_id _struct_conn.pdbx_ptnr3_label_asym_id _struct_conn.pdbx_ptnr3_label_alt_id _struct_conn.pdbx_ptnr3_PDB_ins_code _struct_conn.details _struct_conn.pdbx_dist_value _struct_conn.pdbx_value_order _struct_conn.pdbx_role metalc1 metalc ? ? A CYS 83 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 119 A ZN 500 1_555 ? ? ? ? ? ? ? 2.230 ? ? metalc2 metalc ? ? A HIS 143 NE2 ? ? ? 1_555 B ZN . ZN ? ? A HIS 179 A ZN 500 1_555 ? ? ? ? ? ? ? 2.134 ? ? metalc3 metalc ? ? A CYS 167 SG ? ? ? 1_555 B ZN . ZN ? ? A CYS 203 A ZN 500 1_555 ? ? ? ? ? ? ? 2.544 ? ? metalc4 metalc ? ? B ZN . ZN ? ? ? 1_555 D HOH . O ? ? A ZN 500 A HOH 601 1_555 ? ? ? ? ? ? ? 2.475 ? ? # _struct_conn_type.id metalc _struct_conn_type.criteria ? _struct_conn_type.reference ? # loop_ _pdbx_struct_conn_angle.id _pdbx_struct_conn_angle.ptnr1_label_atom_id _pdbx_struct_conn_angle.ptnr1_label_alt_id _pdbx_struct_conn_angle.ptnr1_label_asym_id _pdbx_struct_conn_angle.ptnr1_label_comp_id _pdbx_struct_conn_angle.ptnr1_label_seq_id _pdbx_struct_conn_angle.ptnr1_auth_atom_id _pdbx_struct_conn_angle.ptnr1_auth_asym_id _pdbx_struct_conn_angle.ptnr1_auth_comp_id _pdbx_struct_conn_angle.ptnr1_auth_seq_id _pdbx_struct_conn_angle.ptnr1_PDB_ins_code _pdbx_struct_conn_angle.ptnr1_symmetry _pdbx_struct_conn_angle.ptnr2_label_atom_id _pdbx_struct_conn_angle.ptnr2_label_alt_id _pdbx_struct_conn_angle.ptnr2_label_asym_id _pdbx_struct_conn_angle.ptnr2_label_comp_id _pdbx_struct_conn_angle.ptnr2_label_seq_id _pdbx_struct_conn_angle.ptnr2_auth_atom_id _pdbx_struct_conn_angle.ptnr2_auth_asym_id _pdbx_struct_conn_angle.ptnr2_auth_comp_id _pdbx_struct_conn_angle.ptnr2_auth_seq_id _pdbx_struct_conn_angle.ptnr2_PDB_ins_code _pdbx_struct_conn_angle.ptnr2_symmetry _pdbx_struct_conn_angle.ptnr3_label_atom_id _pdbx_struct_conn_angle.ptnr3_label_alt_id _pdbx_struct_conn_angle.ptnr3_label_asym_id _pdbx_struct_conn_angle.ptnr3_label_comp_id _pdbx_struct_conn_angle.ptnr3_label_seq_id _pdbx_struct_conn_angle.ptnr3_auth_atom_id _pdbx_struct_conn_angle.ptnr3_auth_asym_id _pdbx_struct_conn_angle.ptnr3_auth_comp_id _pdbx_struct_conn_angle.ptnr3_auth_seq_id _pdbx_struct_conn_angle.ptnr3_PDB_ins_code _pdbx_struct_conn_angle.ptnr3_symmetry _pdbx_struct_conn_angle.value _pdbx_struct_conn_angle.value_esd 1 SG ? A CYS 83 ? A CYS 119 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 NE2 ? A HIS 143 ? A HIS 179 ? 1_555 130.5 ? 2 SG ? A CYS 83 ? A CYS 119 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 SG ? A CYS 167 ? A CYS 203 ? 1_555 102.9 ? 3 NE2 ? A HIS 143 ? A HIS 179 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 SG ? A CYS 167 ? A CYS 203 ? 1_555 98.4 ? 4 SG ? A CYS 83 ? A CYS 119 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 O ? D HOH . ? A HOH 601 ? 1_555 118.9 ? 5 NE2 ? A HIS 143 ? A HIS 179 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 O ? D HOH . ? A HOH 601 ? 1_555 83.4 ? 6 SG ? A CYS 167 ? A CYS 203 ? 1_555 ZN ? B ZN . ? A ZN 500 ? 1_555 O ? D HOH . ? A HOH 601 ? 1_555 122.7 ? # _struct_mon_prot_cis.pdbx_id 1 _struct_mon_prot_cis.label_comp_id ALA _struct_mon_prot_cis.label_seq_id 166 _struct_mon_prot_cis.label_asym_id A _struct_mon_prot_cis.label_alt_id . _struct_mon_prot_cis.pdbx_PDB_ins_code ? _struct_mon_prot_cis.auth_comp_id ALA _struct_mon_prot_cis.auth_seq_id 202 _struct_mon_prot_cis.auth_asym_id A _struct_mon_prot_cis.pdbx_label_comp_id_2 CYS _struct_mon_prot_cis.pdbx_label_seq_id_2 167 _struct_mon_prot_cis.pdbx_label_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_ins_code_2 ? _struct_mon_prot_cis.pdbx_auth_comp_id_2 CYS _struct_mon_prot_cis.pdbx_auth_seq_id_2 203 _struct_mon_prot_cis.pdbx_auth_asym_id_2 A _struct_mon_prot_cis.pdbx_PDB_model_num 1 _struct_mon_prot_cis.pdbx_omega_angle 8.77 # loop_ _struct_sheet.id _struct_sheet.type _struct_sheet.number_strands _struct_sheet.details AA1 ? 4 ? AA2 ? 6 ? # loop_ _struct_sheet_order.sheet_id _struct_sheet_order.range_id_1 _struct_sheet_order.range_id_2 _struct_sheet_order.offset _struct_sheet_order.sense AA1 1 2 ? anti-parallel AA1 2 3 ? anti-parallel AA1 3 4 ? parallel AA2 1 2 ? parallel AA2 2 3 ? parallel AA2 3 4 ? parallel AA2 4 5 ? anti-parallel AA2 5 6 ? anti-parallel # loop_ _struct_sheet_range.sheet_id _struct_sheet_range.id _struct_sheet_range.beg_label_comp_id _struct_sheet_range.beg_label_asym_id _struct_sheet_range.beg_label_seq_id _struct_sheet_range.pdbx_beg_PDB_ins_code _struct_sheet_range.end_label_comp_id _struct_sheet_range.end_label_asym_id _struct_sheet_range.end_label_seq_id _struct_sheet_range.pdbx_end_PDB_ins_code _struct_sheet_range.beg_auth_comp_id _struct_sheet_range.beg_auth_asym_id _struct_sheet_range.beg_auth_seq_id _struct_sheet_range.end_auth_comp_id _struct_sheet_range.end_auth_asym_id _struct_sheet_range.end_auth_seq_id AA1 1 LEU A 53 ? GLY A 54 ? LEU A 89 GLY A 90 AA1 2 PHE A 277 ? VAL A 286 ? PHE A 313 VAL A 322 AA1 3 SER A 250 ? HIS A 261 ? SER A 286 HIS A 297 AA1 4 HIS A 143 ? ALA A 145 ? HIS A 179 ALA A 181 AA2 1 SER A 101 ? GLY A 107 ? SER A 137 GLY A 143 AA2 2 ILE A 77 ? CYS A 83 ? ILE A 113 CYS A 119 AA2 3 GLU A 134 ? PHE A 141 ? GLU A 170 PHE A 177 AA2 4 SER A 250 ? HIS A 261 ? SER A 286 HIS A 297 AA2 5 PHE A 277 ? VAL A 286 ? PHE A 313 VAL A 322 AA2 6 LYS A 291 ? HIS A 293 ? LYS A 327 HIS A 329 # loop_ _pdbx_struct_sheet_hbond.sheet_id _pdbx_struct_sheet_hbond.range_id_1 _pdbx_struct_sheet_hbond.range_id_2 _pdbx_struct_sheet_hbond.range_1_label_atom_id _pdbx_struct_sheet_hbond.range_1_label_comp_id _pdbx_struct_sheet_hbond.range_1_label_asym_id _pdbx_struct_sheet_hbond.range_1_label_seq_id _pdbx_struct_sheet_hbond.range_1_PDB_ins_code _pdbx_struct_sheet_hbond.range_1_auth_atom_id _pdbx_struct_sheet_hbond.range_1_auth_comp_id _pdbx_struct_sheet_hbond.range_1_auth_asym_id _pdbx_struct_sheet_hbond.range_1_auth_seq_id _pdbx_struct_sheet_hbond.range_2_label_atom_id _pdbx_struct_sheet_hbond.range_2_label_comp_id _pdbx_struct_sheet_hbond.range_2_label_asym_id _pdbx_struct_sheet_hbond.range_2_label_seq_id _pdbx_struct_sheet_hbond.range_2_PDB_ins_code _pdbx_struct_sheet_hbond.range_2_auth_atom_id _pdbx_struct_sheet_hbond.range_2_auth_comp_id _pdbx_struct_sheet_hbond.range_2_auth_asym_id _pdbx_struct_sheet_hbond.range_2_auth_seq_id AA1 1 2 N LEU A 53 ? N LEU A 89 O ILE A 278 ? O ILE A 314 AA1 2 3 O VAL A 286 ? O VAL A 322 N TYR A 252 ? N TYR A 288 AA1 3 4 O HIS A 261 ? O HIS A 297 N ILE A 144 ? N ILE A 180 AA2 1 2 O THR A 105 ? O THR A 141 N THR A 80 ? N THR A 116 AA2 2 3 N MET A 79 ? N MET A 115 O PHE A 139 ? O PHE A 175 AA2 3 4 N PHE A 138 ? N PHE A 174 O ILE A 255 ? O ILE A 291 AA2 4 5 N TYR A 252 ? N TYR A 288 O VAL A 286 ? O VAL A 322 AA2 5 6 N VAL A 285 ? N VAL A 321 O THR A 292 ? O THR A 328 # loop_ _struct_site.id _struct_site.pdbx_evidence_code _struct_site.pdbx_auth_asym_id _struct_site.pdbx_auth_comp_id _struct_site.pdbx_auth_seq_id _struct_site.pdbx_auth_ins_code _struct_site.pdbx_num_residues _struct_site.details AC1 Software A ZN 500 ? 4 'binding site for residue ZN A 500' AC2 Software A SO4 501 ? 8 'binding site for residue SO4 A 501' # loop_ _struct_site_gen.id _struct_site_gen.site_id _struct_site_gen.pdbx_num_res _struct_site_gen.label_comp_id _struct_site_gen.label_asym_id _struct_site_gen.label_seq_id _struct_site_gen.pdbx_auth_ins_code _struct_site_gen.auth_comp_id _struct_site_gen.auth_asym_id _struct_site_gen.auth_seq_id _struct_site_gen.label_atom_id _struct_site_gen.label_alt_id _struct_site_gen.symmetry _struct_site_gen.details 1 AC1 4 CYS A 83 ? CYS A 119 . ? 1_555 ? 2 AC1 4 HIS A 143 ? HIS A 179 . ? 1_555 ? 3 AC1 4 CYS A 167 ? CYS A 203 . ? 1_555 ? 4 AC1 4 HOH D . ? HOH A 601 . ? 1_555 ? 5 AC2 8 PRO A 189 ? PRO A 225 . ? 1_555 ? 6 AC2 8 GLY A 190 ? GLY A 226 . ? 1_555 ? 7 AC2 8 HIS A 192 ? HIS A 228 . ? 3_556 ? 8 AC2 8 PRO A 194 ? PRO A 230 . ? 3_556 ? 9 AC2 8 ILE A 201 ? ILE A 237 . ? 1_555 ? 10 AC2 8 ARG A 205 ? ARG A 241 . ? 1_555 ? 11 AC2 8 ARG A 208 ? ARG A 244 . ? 1_555 ? 12 AC2 8 HOH D . ? HOH A 603 . ? 1_555 ? # loop_ _pdbx_validate_close_contact.id _pdbx_validate_close_contact.PDB_model_num _pdbx_validate_close_contact.auth_atom_id_1 _pdbx_validate_close_contact.auth_asym_id_1 _pdbx_validate_close_contact.auth_comp_id_1 _pdbx_validate_close_contact.auth_seq_id_1 _pdbx_validate_close_contact.PDB_ins_code_1 _pdbx_validate_close_contact.label_alt_id_1 _pdbx_validate_close_contact.auth_atom_id_2 _pdbx_validate_close_contact.auth_asym_id_2 _pdbx_validate_close_contact.auth_comp_id_2 _pdbx_validate_close_contact.auth_seq_id_2 _pdbx_validate_close_contact.PDB_ins_code_2 _pdbx_validate_close_contact.label_alt_id_2 _pdbx_validate_close_contact.dist 1 1 O A HOH 612 ? ? O A HOH 614 ? ? 2.08 2 1 O A HOH 613 ? ? O A HOH 614 ? ? 2.15 3 1 O A CYS 203 ? ? O A HOH 601 ? ? 2.16 # loop_ _pdbx_validate_symm_contact.id _pdbx_validate_symm_contact.PDB_model_num _pdbx_validate_symm_contact.auth_atom_id_1 _pdbx_validate_symm_contact.auth_asym_id_1 _pdbx_validate_symm_contact.auth_comp_id_1 _pdbx_validate_symm_contact.auth_seq_id_1 _pdbx_validate_symm_contact.PDB_ins_code_1 _pdbx_validate_symm_contact.label_alt_id_1 _pdbx_validate_symm_contact.site_symmetry_1 _pdbx_validate_symm_contact.auth_atom_id_2 _pdbx_validate_symm_contact.auth_asym_id_2 _pdbx_validate_symm_contact.auth_comp_id_2 _pdbx_validate_symm_contact.auth_seq_id_2 _pdbx_validate_symm_contact.PDB_ins_code_2 _pdbx_validate_symm_contact.label_alt_id_2 _pdbx_validate_symm_contact.site_symmetry_2 _pdbx_validate_symm_contact.dist 1 1 NE A ARG 267 ? ? 1_555 ND2 A ASN 324 ? ? 8_555 1.62 2 1 CZ A ARG 267 ? ? 1_555 ND2 A ASN 324 ? ? 8_555 1.81 3 1 NH2 A ARG 267 ? ? 1_555 ND2 A ASN 324 ? ? 8_555 1.95 # loop_ _pdbx_validate_torsion.id _pdbx_validate_torsion.PDB_model_num _pdbx_validate_torsion.auth_comp_id _pdbx_validate_torsion.auth_asym_id _pdbx_validate_torsion.auth_seq_id _pdbx_validate_torsion.PDB_ins_code _pdbx_validate_torsion.label_alt_id _pdbx_validate_torsion.phi _pdbx_validate_torsion.psi 1 1 ASN A 142 ? ? -173.59 146.05 2 1 GLU A 232 ? ? -141.18 54.00 3 1 PRO A 283 ? ? -68.17 1.10 # loop_ _pdbx_unobs_or_zero_occ_residues.id _pdbx_unobs_or_zero_occ_residues.PDB_model_num _pdbx_unobs_or_zero_occ_residues.polymer_flag _pdbx_unobs_or_zero_occ_residues.occupancy_flag _pdbx_unobs_or_zero_occ_residues.auth_asym_id _pdbx_unobs_or_zero_occ_residues.auth_comp_id _pdbx_unobs_or_zero_occ_residues.auth_seq_id _pdbx_unobs_or_zero_occ_residues.PDB_ins_code _pdbx_unobs_or_zero_occ_residues.label_asym_id _pdbx_unobs_or_zero_occ_residues.label_comp_id _pdbx_unobs_or_zero_occ_residues.label_seq_id 1 1 Y 1 A GLY 37 ? A GLY 1 2 1 Y 1 A HIS 38 ? A HIS 2 3 1 Y 1 A MET 39 ? A MET 3 4 1 Y 1 A ALA 40 ? A ALA 4 5 1 Y 1 A SER 41 ? A SER 5 6 1 Y 1 A GLN 42 ? A GLN 6 7 1 Y 1 A ALA 43 ? A ALA 7 8 1 Y 1 A LEU 44 ? A LEU 8 9 1 Y 1 A THR 45 ? A THR 9 10 1 Y 1 A VAL 46 ? A VAL 10 11 1 Y 1 A SER 47 ? A SER 11 12 1 Y 1 A GLN 48 ? A GLN 12 13 1 Y 1 A SER 49 ? A SER 13 14 1 Y 1 A LYS 50 ? A LYS 14 15 1 Y 1 A ALA 51 ? A ALA 15 16 1 Y 1 A VAL 52 ? A VAL 16 17 1 Y 1 A ALA 53 ? A ALA 17 18 1 Y 1 A PRO 54 ? A PRO 18 19 1 Y 1 A SER 55 ? A SER 19 20 1 Y 1 A ASN 56 ? A ASN 20 21 1 Y 1 A GLY 57 ? A GLY 21 22 1 Y 1 A ALA 58 ? A ALA 22 23 1 Y 1 A PRO 59 ? A PRO 23 24 1 Y 1 A ALA 60 ? A ALA 24 25 1 Y 1 A PRO 61 ? A PRO 25 26 1 Y 1 A LEU 62 ? A LEU 26 27 1 Y 1 A ALA 63 ? A ALA 27 28 1 Y 1 A GLN 64 ? A GLN 28 29 1 Y 1 A VAL 65 ? A VAL 29 30 1 Y 1 A GLU 66 ? A GLU 30 31 1 Y 1 A GLU 67 ? A GLU 31 32 1 Y 1 A VAL 68 ? A VAL 32 33 1 Y 1 A ASP 69 ? A ASP 33 34 1 Y 1 A ILE 70 ? A ILE 34 35 1 Y 1 A ALA 71 ? A ALA 35 36 1 Y 1 A ARG 72 ? A ARG 36 37 1 Y 1 A HIS 73 ? A HIS 37 38 1 Y 1 A MET 74 ? A MET 38 39 1 Y 1 A ASN 75 ? A ASN 39 40 1 Y 1 A ASP 76 ? A ASP 40 41 1 Y 1 A ARG 77 ? A ARG 41 42 1 Y 1 A HIS 78 ? A HIS 42 43 1 Y 1 A ALA 79 ? A ALA 43 44 1 Y 1 A HIS 80 ? A HIS 44 45 1 Y 1 A HIS 161 ? A HIS 125 46 1 Y 1 A SER 162 ? A SER 126 47 1 Y 1 A PRO 163 ? A PRO 127 48 1 Y 1 A VAL 164 ? A VAL 128 49 1 Y 1 A CYS 165 ? A CYS 129 50 1 Y 1 A ALA 166 ? A ALA 130 51 1 Y 1 A GLY 167 ? A GLY 131 52 1 Y 1 A GLY 168 ? A GLY 132 53 1 Y 1 A SER 184 ? A SER 148 54 1 Y 1 A GLU 185 ? A GLU 149 55 1 Y 1 A GLY 186 ? A GLY 150 56 1 Y 1 A GLU 187 ? A GLU 151 57 1 Y 1 A VAL 188 ? A VAL 152 58 1 Y 1 A GLY 189 ? A GLY 153 59 1 Y 1 A ALA 190 ? A ALA 154 60 1 Y 1 A ILE 191 ? A ILE 155 61 1 Y 1 A SER 192 ? A SER 156 62 1 Y 1 A ARG 193 ? A ARG 157 63 1 Y 1 A PRO 194 ? A PRO 158 64 1 Y 1 A GLY 195 ? A GLY 159 65 1 Y 1 A ARG 196 ? A ARG 160 66 1 Y 1 A PRO 197 ? A PRO 161 67 1 Y 1 A LYS 198 ? A LYS 162 68 1 Y 1 A MET 199 ? A MET 163 69 1 Y 1 A SER 200 ? A SER 164 70 1 Y 1 A CYS 201 ? A CYS 165 71 1 Y 1 A TRP 299 ? A TRP 263 72 1 Y 1 A ALA 300 ? A ALA 264 73 1 Y 1 A ALA 301 ? A ALA 265 74 1 Y 1 A HIS 302 ? A HIS 266 75 1 Y 1 A LEU 303 ? A LEU 267 76 1 Y 1 A GLU 304 ? A GLU 268 77 1 Y 1 A GLU 305 ? A GLU 269 78 1 Y 1 A GLY 306 ? A GLY 270 79 1 Y 1 A GLY 307 ? A GLY 271 80 1 Y 1 A ASP 308 ? A ASP 272 81 1 Y 1 A PRO 309 ? A PRO 273 82 1 Y 1 A SER 310 ? A SER 274 83 1 Y 1 A GLN 344 ? A GLN 308 # loop_ _chem_comp_atom.comp_id _chem_comp_atom.atom_id _chem_comp_atom.type_symbol _chem_comp_atom.pdbx_aromatic_flag _chem_comp_atom.pdbx_stereo_config _chem_comp_atom.pdbx_ordinal ALA N N N N 1 ALA CA C N S 2 ALA C C N N 3 ALA O O N N 4 ALA CB C N N 5 ALA OXT O N N 6 ALA H H N N 7 ALA H2 H N N 8 ALA HA H N N 9 ALA HB1 H N N 10 ALA HB2 H N N 11 ALA HB3 H N N 12 ALA HXT H N N 13 ARG N N N N 14 ARG CA C N S 15 ARG C C N N 16 ARG O O N N 17 ARG CB C N N 18 ARG CG C N N 19 ARG CD C N N 20 ARG NE N N N 21 ARG CZ C N N 22 ARG NH1 N N N 23 ARG NH2 N N N 24 ARG OXT O N N 25 ARG H H N N 26 ARG H2 H N N 27 ARG HA H N N 28 ARG HB2 H N N 29 ARG HB3 H N N 30 ARG HG2 H N N 31 ARG HG3 H N N 32 ARG HD2 H N N 33 ARG HD3 H N N 34 ARG HE H N N 35 ARG HH11 H N N 36 ARG HH12 H N N 37 ARG HH21 H N N 38 ARG HH22 H N N 39 ARG HXT H N N 40 ASN N N N N 41 ASN CA C N S 42 ASN C C N N 43 ASN O O N N 44 ASN CB C N N 45 ASN CG C N N 46 ASN OD1 O N N 47 ASN ND2 N N N 48 ASN OXT O N N 49 ASN H H N N 50 ASN H2 H N N 51 ASN HA H N N 52 ASN HB2 H N N 53 ASN HB3 H N N 54 ASN HD21 H N N 55 ASN HD22 H N N 56 ASN HXT H N N 57 ASP N N N N 58 ASP CA C N S 59 ASP C C N N 60 ASP O O N N 61 ASP CB C N N 62 ASP CG C N N 63 ASP OD1 O N N 64 ASP OD2 O N N 65 ASP OXT O N N 66 ASP H H N N 67 ASP H2 H N N 68 ASP HA H N N 69 ASP HB2 H N N 70 ASP HB3 H N N 71 ASP HD2 H N N 72 ASP HXT H N N 73 CYS N N N N 74 CYS CA C N R 75 CYS C C N N 76 CYS O O N N 77 CYS CB C N N 78 CYS SG S N N 79 CYS OXT O N N 80 CYS H H N N 81 CYS H2 H N N 82 CYS HA H N N 83 CYS HB2 H N N 84 CYS HB3 H N N 85 CYS HG H N N 86 CYS HXT H N N 87 GLN N N N N 88 GLN CA C N S 89 GLN C C N N 90 GLN O O N N 91 GLN CB C N N 92 GLN CG C N N 93 GLN CD C N N 94 GLN OE1 O N N 95 GLN NE2 N N N 96 GLN OXT O N N 97 GLN H H N N 98 GLN H2 H N N 99 GLN HA H N N 100 GLN HB2 H N N 101 GLN HB3 H N N 102 GLN HG2 H N N 103 GLN HG3 H N N 104 GLN HE21 H N N 105 GLN HE22 H N N 106 GLN HXT H N N 107 GLU N N N N 108 GLU CA C N S 109 GLU C C N N 110 GLU O O N N 111 GLU CB C N N 112 GLU CG C N N 113 GLU CD C N N 114 GLU OE1 O N N 115 GLU OE2 O N N 116 GLU OXT O N N 117 GLU H H N N 118 GLU H2 H N N 119 GLU HA H N N 120 GLU HB2 H N N 121 GLU HB3 H N N 122 GLU HG2 H N N 123 GLU HG3 H N N 124 GLU HE2 H N N 125 GLU HXT H N N 126 GLY N N N N 127 GLY CA C N N 128 GLY C C N N 129 GLY O O N N 130 GLY OXT O N N 131 GLY H H N N 132 GLY H2 H N N 133 GLY HA2 H N N 134 GLY HA3 H N N 135 GLY HXT H N N 136 HIS N N N N 137 HIS CA C N S 138 HIS C C N N 139 HIS O O N N 140 HIS CB C N N 141 HIS CG C Y N 142 HIS ND1 N Y N 143 HIS CD2 C Y N 144 HIS CE1 C Y N 145 HIS NE2 N Y N 146 HIS OXT O N N 147 HIS H H N N 148 HIS H2 H N N 149 HIS HA H N N 150 HIS HB2 H N N 151 HIS HB3 H N N 152 HIS HD1 H N N 153 HIS HD2 H N N 154 HIS HE1 H N N 155 HIS HE2 H N N 156 HIS HXT H N N 157 HOH O O N N 158 HOH H1 H N N 159 HOH H2 H N N 160 ILE N N N N 161 ILE CA C N S 162 ILE C C N N 163 ILE O O N N 164 ILE CB C N S 165 ILE CG1 C N N 166 ILE CG2 C N N 167 ILE CD1 C N N 168 ILE OXT O N N 169 ILE H H N N 170 ILE H2 H N N 171 ILE HA H N N 172 ILE HB H N N 173 ILE HG12 H N N 174 ILE HG13 H N N 175 ILE HG21 H N N 176 ILE HG22 H N N 177 ILE HG23 H N N 178 ILE HD11 H N N 179 ILE HD12 H N N 180 ILE HD13 H N N 181 ILE HXT H N N 182 LEU N N N N 183 LEU CA C N S 184 LEU C C N N 185 LEU O O N N 186 LEU CB C N N 187 LEU CG C N N 188 LEU CD1 C N N 189 LEU CD2 C N N 190 LEU OXT O N N 191 LEU H H N N 192 LEU H2 H N N 193 LEU HA H N N 194 LEU HB2 H N N 195 LEU HB3 H N N 196 LEU HG H N N 197 LEU HD11 H N N 198 LEU HD12 H N N 199 LEU HD13 H N N 200 LEU HD21 H N N 201 LEU HD22 H N N 202 LEU HD23 H N N 203 LEU HXT H N N 204 LYS N N N N 205 LYS CA C N S 206 LYS C C N N 207 LYS O O N N 208 LYS CB C N N 209 LYS CG C N N 210 LYS CD C N N 211 LYS CE C N N 212 LYS NZ N N N 213 LYS OXT O N N 214 LYS H H N N 215 LYS H2 H N N 216 LYS HA H N N 217 LYS HB2 H N N 218 LYS HB3 H N N 219 LYS HG2 H N N 220 LYS HG3 H N N 221 LYS HD2 H N N 222 LYS HD3 H N N 223 LYS HE2 H N N 224 LYS HE3 H N N 225 LYS HZ1 H N N 226 LYS HZ2 H N N 227 LYS HZ3 H N N 228 LYS HXT H N N 229 MET N N N N 230 MET CA C N S 231 MET C C N N 232 MET O O N N 233 MET CB C N N 234 MET CG C N N 235 MET SD S N N 236 MET CE C N N 237 MET OXT O N N 238 MET H H N N 239 MET H2 H N N 240 MET HA H N N 241 MET HB2 H N N 242 MET HB3 H N N 243 MET HG2 H N N 244 MET HG3 H N N 245 MET HE1 H N N 246 MET HE2 H N N 247 MET HE3 H N N 248 MET HXT H N N 249 PHE N N N N 250 PHE CA C N S 251 PHE C C N N 252 PHE O O N N 253 PHE CB C N N 254 PHE CG C Y N 255 PHE CD1 C Y N 256 PHE CD2 C Y N 257 PHE CE1 C Y N 258 PHE CE2 C Y N 259 PHE CZ C Y N 260 PHE OXT O N N 261 PHE H H N N 262 PHE H2 H N N 263 PHE HA H N N 264 PHE HB2 H N N 265 PHE HB3 H N N 266 PHE HD1 H N N 267 PHE HD2 H N N 268 PHE HE1 H N N 269 PHE HE2 H N N 270 PHE HZ H N N 271 PHE HXT H N N 272 PRO N N N N 273 PRO CA C N S 274 PRO C C N N 275 PRO O O N N 276 PRO CB C N N 277 PRO CG C N N 278 PRO CD C N N 279 PRO OXT O N N 280 PRO H H N N 281 PRO HA H N N 282 PRO HB2 H N N 283 PRO HB3 H N N 284 PRO HG2 H N N 285 PRO HG3 H N N 286 PRO HD2 H N N 287 PRO HD3 H N N 288 PRO HXT H N N 289 SER N N N N 290 SER CA C N S 291 SER C C N N 292 SER O O N N 293 SER CB C N N 294 SER OG O N N 295 SER OXT O N N 296 SER H H N N 297 SER H2 H N N 298 SER HA H N N 299 SER HB2 H N N 300 SER HB3 H N N 301 SER HG H N N 302 SER HXT H N N 303 SO4 S S N N 304 SO4 O1 O N N 305 SO4 O2 O N N 306 SO4 O3 O N N 307 SO4 O4 O N N 308 THR N N N N 309 THR CA C N S 310 THR C C N N 311 THR O O N N 312 THR CB C N R 313 THR OG1 O N N 314 THR CG2 C N N 315 THR OXT O N N 316 THR H H N N 317 THR H2 H N N 318 THR HA H N N 319 THR HB H N N 320 THR HG1 H N N 321 THR HG21 H N N 322 THR HG22 H N N 323 THR HG23 H N N 324 THR HXT H N N 325 TRP N N N N 326 TRP CA C N S 327 TRP C C N N 328 TRP O O N N 329 TRP CB C N N 330 TRP CG C Y N 331 TRP CD1 C Y N 332 TRP CD2 C Y N 333 TRP NE1 N Y N 334 TRP CE2 C Y N 335 TRP CE3 C Y N 336 TRP CZ2 C Y N 337 TRP CZ3 C Y N 338 TRP CH2 C Y N 339 TRP OXT O N N 340 TRP H H N N 341 TRP H2 H N N 342 TRP HA H N N 343 TRP HB2 H N N 344 TRP HB3 H N N 345 TRP HD1 H N N 346 TRP HE1 H N N 347 TRP HE3 H N N 348 TRP HZ2 H N N 349 TRP HZ3 H N N 350 TRP HH2 H N N 351 TRP HXT H N N 352 TYR N N N N 353 TYR CA C N S 354 TYR C C N N 355 TYR O O N N 356 TYR CB C N N 357 TYR CG C Y N 358 TYR CD1 C Y N 359 TYR CD2 C Y N 360 TYR CE1 C Y N 361 TYR CE2 C Y N 362 TYR CZ C Y N 363 TYR OH O N N 364 TYR OXT O N N 365 TYR H H N N 366 TYR H2 H N N 367 TYR HA H N N 368 TYR HB2 H N N 369 TYR HB3 H N N 370 TYR HD1 H N N 371 TYR HD2 H N N 372 TYR HE1 H N N 373 TYR HE2 H N N 374 TYR HH H N N 375 TYR HXT H N N 376 VAL N N N N 377 VAL CA C N S 378 VAL C C N N 379 VAL O O N N 380 VAL CB C N N 381 VAL CG1 C N N 382 VAL CG2 C N N 383 VAL OXT O N N 384 VAL H H N N 385 VAL H2 H N N 386 VAL HA H N N 387 VAL HB H N N 388 VAL HG11 H N N 389 VAL HG12 H N N 390 VAL HG13 H N N 391 VAL HG21 H N N 392 VAL HG22 H N N 393 VAL HG23 H N N 394 VAL HXT H N N 395 ZN ZN ZN N N 396 # loop_ _chem_comp_bond.comp_id _chem_comp_bond.atom_id_1 _chem_comp_bond.atom_id_2 _chem_comp_bond.value_order _chem_comp_bond.pdbx_aromatic_flag _chem_comp_bond.pdbx_stereo_config _chem_comp_bond.pdbx_ordinal ALA N CA sing N N 1 ALA N H sing N N 2 ALA N H2 sing N N 3 ALA CA C sing N N 4 ALA CA CB sing N N 5 ALA CA HA sing N N 6 ALA C O doub N N 7 ALA C OXT sing N N 8 ALA CB HB1 sing N N 9 ALA CB HB2 sing N N 10 ALA CB HB3 sing N N 11 ALA OXT HXT sing N N 12 ARG N CA sing N N 13 ARG N H sing N N 14 ARG N H2 sing N N 15 ARG CA C sing N N 16 ARG CA CB sing N N 17 ARG CA HA sing N N 18 ARG C O doub N N 19 ARG C OXT sing N N 20 ARG CB CG sing N N 21 ARG CB HB2 sing N N 22 ARG CB HB3 sing N N 23 ARG CG CD sing N N 24 ARG CG HG2 sing N N 25 ARG CG HG3 sing N N 26 ARG CD NE sing N N 27 ARG CD HD2 sing N N 28 ARG CD HD3 sing N N 29 ARG NE CZ sing N N 30 ARG NE HE sing N N 31 ARG CZ NH1 sing N N 32 ARG CZ NH2 doub N N 33 ARG NH1 HH11 sing N N 34 ARG NH1 HH12 sing N N 35 ARG NH2 HH21 sing N N 36 ARG NH2 HH22 sing N N 37 ARG OXT HXT sing N N 38 ASN N CA sing N N 39 ASN N H sing N N 40 ASN N H2 sing N N 41 ASN CA C sing N N 42 ASN CA CB sing N N 43 ASN CA HA sing N N 44 ASN C O doub N N 45 ASN C OXT sing N N 46 ASN CB CG sing N N 47 ASN CB HB2 sing N N 48 ASN CB HB3 sing N N 49 ASN CG OD1 doub N N 50 ASN CG ND2 sing N N 51 ASN ND2 HD21 sing N N 52 ASN ND2 HD22 sing N N 53 ASN OXT HXT sing N N 54 ASP N CA sing N N 55 ASP N H sing N N 56 ASP N H2 sing N N 57 ASP CA C sing N N 58 ASP CA CB sing N N 59 ASP CA HA sing N N 60 ASP C O doub N N 61 ASP C OXT sing N N 62 ASP CB CG sing N N 63 ASP CB HB2 sing N N 64 ASP CB HB3 sing N N 65 ASP CG OD1 doub N N 66 ASP CG OD2 sing N N 67 ASP OD2 HD2 sing N N 68 ASP OXT HXT sing N N 69 CYS N CA sing N N 70 CYS N H sing N N 71 CYS N H2 sing N N 72 CYS CA C sing N N 73 CYS CA CB sing N N 74 CYS CA HA sing N N 75 CYS C O doub N N 76 CYS C OXT sing N N 77 CYS CB SG sing N N 78 CYS CB HB2 sing N N 79 CYS CB HB3 sing N N 80 CYS SG HG sing N N 81 CYS OXT HXT sing N N 82 GLN N CA sing N N 83 GLN N H sing N N 84 GLN N H2 sing N N 85 GLN CA C sing N N 86 GLN CA CB sing N N 87 GLN CA HA sing N N 88 GLN C O doub N N 89 GLN C OXT sing N N 90 GLN CB CG sing N N 91 GLN CB HB2 sing N N 92 GLN CB HB3 sing N N 93 GLN CG CD sing N N 94 GLN CG HG2 sing N N 95 GLN CG HG3 sing N N 96 GLN CD OE1 doub N N 97 GLN CD NE2 sing N N 98 GLN NE2 HE21 sing N N 99 GLN NE2 HE22 sing N N 100 GLN OXT HXT sing N N 101 GLU N CA sing N N 102 GLU N H sing N N 103 GLU N H2 sing N N 104 GLU CA C sing N N 105 GLU CA CB sing N N 106 GLU CA HA sing N N 107 GLU C O doub N N 108 GLU C OXT sing N N 109 GLU CB CG sing N N 110 GLU CB HB2 sing N N 111 GLU CB HB3 sing N N 112 GLU CG CD sing N N 113 GLU CG HG2 sing N N 114 GLU CG HG3 sing N N 115 GLU CD OE1 doub N N 116 GLU CD OE2 sing N N 117 GLU OE2 HE2 sing N N 118 GLU OXT HXT sing N N 119 GLY N CA sing N N 120 GLY N H sing N N 121 GLY N H2 sing N N 122 GLY CA C sing N N 123 GLY CA HA2 sing N N 124 GLY CA HA3 sing N N 125 GLY C O doub N N 126 GLY C OXT sing N N 127 GLY OXT HXT sing N N 128 HIS N CA sing N N 129 HIS N H sing N N 130 HIS N H2 sing N N 131 HIS CA C sing N N 132 HIS CA CB sing N N 133 HIS CA HA sing N N 134 HIS C O doub N N 135 HIS C OXT sing N N 136 HIS CB CG sing N N 137 HIS CB HB2 sing N N 138 HIS CB HB3 sing N N 139 HIS CG ND1 sing Y N 140 HIS CG CD2 doub Y N 141 HIS ND1 CE1 doub Y N 142 HIS ND1 HD1 sing N N 143 HIS CD2 NE2 sing Y N 144 HIS CD2 HD2 sing N N 145 HIS CE1 NE2 sing Y N 146 HIS CE1 HE1 sing N N 147 HIS NE2 HE2 sing N N 148 HIS OXT HXT sing N N 149 HOH O H1 sing N N 150 HOH O H2 sing N N 151 ILE N CA sing N N 152 ILE N H sing N N 153 ILE N H2 sing N N 154 ILE CA C sing N N 155 ILE CA CB sing N N 156 ILE CA HA sing N N 157 ILE C O doub N N 158 ILE C OXT sing N N 159 ILE CB CG1 sing N N 160 ILE CB CG2 sing N N 161 ILE CB HB sing N N 162 ILE CG1 CD1 sing N N 163 ILE CG1 HG12 sing N N 164 ILE CG1 HG13 sing N N 165 ILE CG2 HG21 sing N N 166 ILE CG2 HG22 sing N N 167 ILE CG2 HG23 sing N N 168 ILE CD1 HD11 sing N N 169 ILE CD1 HD12 sing N N 170 ILE CD1 HD13 sing N N 171 ILE OXT HXT sing N N 172 LEU N CA sing N N 173 LEU N H sing N N 174 LEU N H2 sing N N 175 LEU CA C sing N N 176 LEU CA CB sing N N 177 LEU CA HA sing N N 178 LEU C O doub N N 179 LEU C OXT sing N N 180 LEU CB CG sing N N 181 LEU CB HB2 sing N N 182 LEU CB HB3 sing N N 183 LEU CG CD1 sing N N 184 LEU CG CD2 sing N N 185 LEU CG HG sing N N 186 LEU CD1 HD11 sing N N 187 LEU CD1 HD12 sing N N 188 LEU CD1 HD13 sing N N 189 LEU CD2 HD21 sing N N 190 LEU CD2 HD22 sing N N 191 LEU CD2 HD23 sing N N 192 LEU OXT HXT sing N N 193 LYS N CA sing N N 194 LYS N H sing N N 195 LYS N H2 sing N N 196 LYS CA C sing N N 197 LYS CA CB sing N N 198 LYS CA HA sing N N 199 LYS C O doub N N 200 LYS C OXT sing N N 201 LYS CB CG sing N N 202 LYS CB HB2 sing N N 203 LYS CB HB3 sing N N 204 LYS CG CD sing N N 205 LYS CG HG2 sing N N 206 LYS CG HG3 sing N N 207 LYS CD CE sing N N 208 LYS CD HD2 sing N N 209 LYS CD HD3 sing N N 210 LYS CE NZ sing N N 211 LYS CE HE2 sing N N 212 LYS CE HE3 sing N N 213 LYS NZ HZ1 sing N N 214 LYS NZ HZ2 sing N N 215 LYS NZ HZ3 sing N N 216 LYS OXT HXT sing N N 217 MET N CA sing N N 218 MET N H sing N N 219 MET N H2 sing N N 220 MET CA C sing N N 221 MET CA CB sing N N 222 MET CA HA sing N N 223 MET C O doub N N 224 MET C OXT sing N N 225 MET CB CG sing N N 226 MET CB HB2 sing N N 227 MET CB HB3 sing N N 228 MET CG SD sing N N 229 MET CG HG2 sing N N 230 MET CG HG3 sing N N 231 MET SD CE sing N N 232 MET CE HE1 sing N N 233 MET CE HE2 sing N N 234 MET CE HE3 sing N N 235 MET OXT HXT sing N N 236 PHE N CA sing N N 237 PHE N H sing N N 238 PHE N H2 sing N N 239 PHE CA C sing N N 240 PHE CA CB sing N N 241 PHE CA HA sing N N 242 PHE C O doub N N 243 PHE C OXT sing N N 244 PHE CB CG sing N N 245 PHE CB HB2 sing N N 246 PHE CB HB3 sing N N 247 PHE CG CD1 doub Y N 248 PHE CG CD2 sing Y N 249 PHE CD1 CE1 sing Y N 250 PHE CD1 HD1 sing N N 251 PHE CD2 CE2 doub Y N 252 PHE CD2 HD2 sing N N 253 PHE CE1 CZ doub Y N 254 PHE CE1 HE1 sing N N 255 PHE CE2 CZ sing Y N 256 PHE CE2 HE2 sing N N 257 PHE CZ HZ sing N N 258 PHE OXT HXT sing N N 259 PRO N CA sing N N 260 PRO N CD sing N N 261 PRO N H sing N N 262 PRO CA C sing N N 263 PRO CA CB sing N N 264 PRO CA HA sing N N 265 PRO C O doub N N 266 PRO C OXT sing N N 267 PRO CB CG sing N N 268 PRO CB HB2 sing N N 269 PRO CB HB3 sing N N 270 PRO CG CD sing N N 271 PRO CG HG2 sing N N 272 PRO CG HG3 sing N N 273 PRO CD HD2 sing N N 274 PRO CD HD3 sing N N 275 PRO OXT HXT sing N N 276 SER N CA sing N N 277 SER N H sing N N 278 SER N H2 sing N N 279 SER CA C sing N N 280 SER CA CB sing N N 281 SER CA HA sing N N 282 SER C O doub N N 283 SER C OXT sing N N 284 SER CB OG sing N N 285 SER CB HB2 sing N N 286 SER CB HB3 sing N N 287 SER OG HG sing N N 288 SER OXT HXT sing N N 289 SO4 S O1 doub N N 290 SO4 S O2 doub N N 291 SO4 S O3 sing N N 292 SO4 S O4 sing N N 293 THR N CA sing N N 294 THR N H sing N N 295 THR N H2 sing N N 296 THR CA C sing N N 297 THR CA CB sing N N 298 THR CA HA sing N N 299 THR C O doub N N 300 THR C OXT sing N N 301 THR CB OG1 sing N N 302 THR CB CG2 sing N N 303 THR CB HB sing N N 304 THR OG1 HG1 sing N N 305 THR CG2 HG21 sing N N 306 THR CG2 HG22 sing N N 307 THR CG2 HG23 sing N N 308 THR OXT HXT sing N N 309 TRP N CA sing N N 310 TRP N H sing N N 311 TRP N H2 sing N N 312 TRP CA C sing N N 313 TRP CA CB sing N N 314 TRP CA HA sing N N 315 TRP C O doub N N 316 TRP C OXT sing N N 317 TRP CB CG sing N N 318 TRP CB HB2 sing N N 319 TRP CB HB3 sing N N 320 TRP CG CD1 doub Y N 321 TRP CG CD2 sing Y N 322 TRP CD1 NE1 sing Y N 323 TRP CD1 HD1 sing N N 324 TRP CD2 CE2 doub Y N 325 TRP CD2 CE3 sing Y N 326 TRP NE1 CE2 sing Y N 327 TRP NE1 HE1 sing N N 328 TRP CE2 CZ2 sing Y N 329 TRP CE3 CZ3 doub Y N 330 TRP CE3 HE3 sing N N 331 TRP CZ2 CH2 doub Y N 332 TRP CZ2 HZ2 sing N N 333 TRP CZ3 CH2 sing Y N 334 TRP CZ3 HZ3 sing N N 335 TRP CH2 HH2 sing N N 336 TRP OXT HXT sing N N 337 TYR N CA sing N N 338 TYR N H sing N N 339 TYR N H2 sing N N 340 TYR CA C sing N N 341 TYR CA CB sing N N 342 TYR CA HA sing N N 343 TYR C O doub N N 344 TYR C OXT sing N N 345 TYR CB CG sing N N 346 TYR CB HB2 sing N N 347 TYR CB HB3 sing N N 348 TYR CG CD1 doub Y N 349 TYR CG CD2 sing Y N 350 TYR CD1 CE1 sing Y N 351 TYR CD1 HD1 sing N N 352 TYR CD2 CE2 doub Y N 353 TYR CD2 HD2 sing N N 354 TYR CE1 CZ doub Y N 355 TYR CE1 HE1 sing N N 356 TYR CE2 CZ sing Y N 357 TYR CE2 HE2 sing N N 358 TYR CZ OH sing N N 359 TYR OH HH sing N N 360 TYR OXT HXT sing N N 361 VAL N CA sing N N 362 VAL N H sing N N 363 VAL N H2 sing N N 364 VAL CA C sing N N 365 VAL CA CB sing N N 366 VAL CA HA sing N N 367 VAL C O doub N N 368 VAL C OXT sing N N 369 VAL CB CG1 sing N N 370 VAL CB CG2 sing N N 371 VAL CB HB sing N N 372 VAL CG1 HG11 sing N N 373 VAL CG1 HG12 sing N N 374 VAL CG1 HG13 sing N N 375 VAL CG2 HG21 sing N N 376 VAL CG2 HG22 sing N N 377 VAL CG2 HG23 sing N N 378 VAL OXT HXT sing N N 379 # _pdbx_audit_support.funding_organization 'Singapore National Research Foundation' _pdbx_audit_support.country Singapore _pdbx_audit_support.grant_number NRF-RF2009-RF001-267 _pdbx_audit_support.ordinal 1 # _atom_sites.entry_id 5B5X _atom_sites.fract_transf_matrix[1][1] 0.017866 _atom_sites.fract_transf_matrix[1][2] 0.000000 _atom_sites.fract_transf_matrix[1][3] 0.000000 _atom_sites.fract_transf_matrix[2][1] 0.000000 _atom_sites.fract_transf_matrix[2][2] 0.011363 _atom_sites.fract_transf_matrix[2][3] 0.000000 _atom_sites.fract_transf_matrix[3][1] 0.000000 _atom_sites.fract_transf_matrix[3][2] 0.000000 _atom_sites.fract_transf_matrix[3][3] 0.009917 _atom_sites.fract_transf_vector[1] 0.00000 _atom_sites.fract_transf_vector[2] 0.00000 _atom_sites.fract_transf_vector[3] 0.00000 # loop_ _atom_type.symbol C N O S ZN # loop_